--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:25:18 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1698/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1141.16 -1145.44 2 -1141.22 -1146.13 -------------------------------------- TOTAL -1141.19 -1145.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.866168 0.080835 0.377680 1.459543 0.837451 1459.42 1480.21 1.000 r(A<->C){all} 0.127400 0.014138 0.000036 0.374833 0.089719 164.54 314.63 1.004 r(A<->G){all} 0.218073 0.024109 0.000128 0.514740 0.189176 223.27 242.49 1.004 r(A<->T){all} 0.137552 0.016319 0.000058 0.396729 0.099585 166.05 177.39 1.000 r(C<->G){all} 0.181890 0.024971 0.000041 0.504340 0.138699 140.98 188.59 1.000 r(C<->T){all} 0.172916 0.022384 0.000067 0.472685 0.133261 189.54 231.92 1.000 r(G<->T){all} 0.162169 0.019031 0.000061 0.447878 0.125173 104.67 172.64 1.000 pi(A){all} 0.169691 0.000169 0.144629 0.194892 0.169593 1242.76 1285.08 1.001 pi(C){all} 0.296021 0.000248 0.268759 0.330939 0.295344 1290.59 1307.95 1.000 pi(G){all} 0.316589 0.000257 0.285648 0.349537 0.316486 1165.04 1269.23 1.000 pi(T){all} 0.217699 0.000206 0.191289 0.246502 0.217498 1197.93 1289.35 1.000 alpha{1,2} 0.209418 0.047795 0.000450 0.557971 0.151329 1323.09 1412.05 1.000 alpha{3} 0.411452 0.217707 0.000248 1.328124 0.240105 1160.19 1330.60 1.000 pinvar{all} 0.995774 0.000011 0.989527 0.999883 0.996569 1143.67 1322.34 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1105.374254 Model 2: PositiveSelection -1104.947704 Model 0: one-ratio -1104.947526 Model 7: beta -1105.374253 Model 8: beta&w>1 -1104.947679 Model 0 vs 1 0.8534560000002784 Model 2 vs 1 0.8531000000002678 Model 8 vs 7 0.8531479999996918
>C1 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C2 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C3 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C4 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C5 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C6 VTGQSHDEHWRRPGECPGPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=277 C1 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C2 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C3 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C4 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C5 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C6 VTGQSHDEHWRRPGECPGPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV ***************** ******************************** C1 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C2 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C3 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C4 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C5 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C6 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE ************************************************** C1 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C2 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C3 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C4 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C5 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C6 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL ************************************************** C1 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C2 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C3 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C4 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C5 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C6 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA ************************************************** C1 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C2 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C3 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C4 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C5 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C6 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI ************************************************** C1 GSFIVLIAGIAAGIAVWVLLNGVNPLA C2 GSFIVLIAGIAAGIAVWVLLNGVNPLA C3 GSFIVLIAGIAAGIAVWVLLNGVNPLA C4 GSFIVLIAGIAAGIAVWVLLNGVNPLA C5 GSFIVLIAGIAAGIAVWVLLNGVNPLA C6 GSFIVLIAGIAAGIAVWVLLNGVNPLA *************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8310] Library Relaxation: Multi_proc [96] Relaxation Summary: [8310]--->[8310] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.501 Mb, Max= 30.834 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C2 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C3 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C4 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C5 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV C6 VTGQSHDEHWRRPGECPGPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV ***************** ******************************** C1 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C2 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C3 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C4 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C5 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE C6 IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE ************************************************** C1 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C2 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C3 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C4 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C5 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL C6 RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL ************************************************** C1 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C2 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C3 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C4 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C5 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA C6 TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA ************************************************** C1 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C2 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C3 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C4 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C5 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI C6 WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI ************************************************** C1 GSFIVLIAGIAAGIAVWVLLNGVNPLA C2 GSFIVLIAGIAAGIAVWVLLNGVNPLA C3 GSFIVLIAGIAAGIAVWVLLNGVNPLA C4 GSFIVLIAGIAAGIAVWVLLNGVNPLA C5 GSFIVLIAGIAAGIAVWVLLNGVNPLA C6 GSFIVLIAGIAAGIAVWVLLNGVNPLA *************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.64 C1 C6 99.64 TOP 5 0 99.64 C6 C1 99.64 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.64 C2 C6 99.64 TOP 5 1 99.64 C6 C2 99.64 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.64 C3 C6 99.64 TOP 5 2 99.64 C6 C3 99.64 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 99.64 C4 C6 99.64 TOP 5 3 99.64 C6 C4 99.64 BOT 4 5 99.64 C5 C6 99.64 TOP 5 4 99.64 C6 C5 99.64 AVG 0 C1 * 99.93 AVG 1 C2 * 99.93 AVG 2 C3 * 99.93 AVG 3 C4 * 99.93 AVG 4 C5 * 99.93 AVG 5 C6 * 99.64 TOT TOT * 99.88 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC C2 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC C3 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC C4 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC C5 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC C6 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC ************************************************** C1 GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG C2 GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG C3 GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG C4 GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG C5 GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG C6 GGGGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG **.*********************************************** C1 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC C2 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC C3 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC C4 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC C5 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC C6 ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ************************************************** C1 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA C2 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA C3 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA C4 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA C5 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA C6 ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA ************************************************** C1 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC C2 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC C3 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC C4 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC C5 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC C6 CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC ************************************************** C1 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG C2 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG C3 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG C4 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG C5 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG C6 GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG ************************************************** C1 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT C2 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT C3 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT C4 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT C5 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT C6 CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ************************************************** C1 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC C2 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC C3 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC C4 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC C5 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC C6 ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC ************************************************** C1 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG C2 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG C3 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG C4 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG C5 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG C6 TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ************************************************** C1 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG C2 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG C3 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG C4 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG C5 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG C6 ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG ************************************************** C1 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG C2 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG C3 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG C4 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG C5 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG C6 CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG ************************************************** C1 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA C2 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA C3 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA C4 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA C5 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA C6 TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA ************************************************** C1 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA C2 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA C3 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA C4 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA C5 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA C6 TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA ************************************************** C1 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG C2 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG C3 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG C4 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG C5 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG C6 TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG ************************************************** C1 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT C2 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT C3 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT C4 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT C5 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT C6 GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT ************************************************** C1 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG C2 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG C3 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG C4 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG C5 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG C6 GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG ************************************************** C1 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC C2 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC C3 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC C4 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC C5 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC C6 GGTGCTGCTCAACGGCGTGAATCCCCTAGCC ******************************* >C1 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C2 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C3 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C4 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C5 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGAGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C6 GTGACCGGTCAATCGCATGACGAACATTGGCGGCGGCCGGGCGAATGCCC GGGGCCAATCCCGGGACGCCCTGCCTCAGCAAGCCTGGTCGATCCCGAAG ATGACCTGACGCCAGTCGGCTACCCAGGCGATTTCGGAACTACCACCGTC ATCCCGTACAGTGACCCTGATCACTTGAAGGGTCCCGGTGGTACGGGATA CAACCTACTCGACCAGCAGGAGCCGTTACCTTACGTCCAGCCGCAGGCTC GGCATGCAGTGGCTGAGCCTACTGAGATCGATTCAGACCAGGACAACGAG CGATTACACACCGTCGGTCGGCGCGGTACCCAGCATCTCGGTTTGCTGGT ACTCCGGGTCGGGCTGGGCGTAGTGTTGGCCGCCCAAGGGCTGCATAAGC TGTTCGGTTGGTGGGGTGGCCAGGGGTTGACCGGATTCAAGAATTCGCTG ACCCAGGTTGGCTACCAGCACGCCGACATCCTGGCTTATGTGAGCGCTGG CGGAGAGGCTGTTGCCGGCGTGCTTCTGGTCCTGGGATTATTTGCGCCGG TGGTCGCTGCGGGCGCGCTGGCGTTCCTGATCAATGGTCTGCTCGCGGCA TGGCCGCATTCGCCCCTATTCTCATTCTTTTTACCGGACGGGAATGAACA TCAGATCACCCTGATCGTAATGGATGTTACTGTCATCCTGTGTGGTCCGG GTCGGTACGGCCTCGATGCCGGTCGGCGCTGGGCCTATCGACCGTTCATT GGGTCCTTCATAGTGCTAATTGCCGGCATCGCCGCCGGCATCGCGGTGTG GGTGCTGCTCAACGGCGTGAATCCCCTAGCC >C1 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C2 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C3 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C4 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C5 VTGQSHDEHWRRPGECPEPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA >C6 VTGQSHDEHWRRPGECPGPIPGRPASASLVDPEDDLTPVGYPGDFGTTTV IPYSDPDHLKGPGGTGYNLLDQQEPLPYVQPQARHAVAEPTEIDSDQDNE RLHTVGRRGTQHLGLLVLRVGLGVVLAAQGLHKLFGWWGGQGLTGFKNSL TQVGYQHADILAYVSAGGEAVAGVLLVLGLFAPVVAAGALAFLINGLLAA WPHSPLFSFFLPDGNEHQITLIVMDVTVILCGPGRYGLDAGRRWAYRPFI GSFIVLIAGIAAGIAVWVLLNGVNPLA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 831 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579857817 Setting output file names to "/data/7res/ML1698/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 897281526 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5881616681 Seed = 1670326162 Swapseed = 1579857817 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 5 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1863.219149 -- -24.965149 Chain 2 -- -1863.220349 -- -24.965149 Chain 3 -- -1863.219148 -- -24.965149 Chain 4 -- -1863.220698 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1863.219148 -- -24.965149 Chain 2 -- -1863.220698 -- -24.965149 Chain 3 -- -1863.220698 -- -24.965149 Chain 4 -- -1863.220698 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1863.219] (-1863.220) (-1863.219) (-1863.221) * [-1863.219] (-1863.221) (-1863.221) (-1863.221) 500 -- [-1150.519] (-1165.583) (-1143.384) (-1152.110) * (-1154.678) (-1156.489) [-1155.144] (-1159.656) -- 0:00:00 1000 -- (-1146.901) (-1149.436) [-1152.358] (-1147.590) * [-1145.437] (-1154.523) (-1148.408) (-1161.142) -- 0:00:00 1500 -- (-1157.316) (-1153.745) [-1139.719] (-1141.099) * (-1160.440) (-1145.345) (-1150.241) [-1150.247] -- 0:00:00 2000 -- [-1144.498] (-1147.498) (-1148.978) (-1144.639) * [-1140.242] (-1147.565) (-1155.556) (-1147.261) -- 0:00:00 2500 -- (-1149.530) [-1147.710] (-1144.290) (-1148.118) * [-1143.414] (-1148.238) (-1148.576) (-1148.153) -- 0:00:00 3000 -- (-1157.607) (-1146.893) (-1145.539) [-1141.657] * [-1152.925] (-1154.228) (-1148.755) (-1143.056) -- 0:00:00 3500 -- (-1149.811) (-1141.099) [-1148.982] (-1144.131) * [-1146.934] (-1156.097) (-1152.251) (-1149.310) -- 0:00:00 4000 -- (-1153.963) (-1141.193) (-1143.663) [-1145.280] * [-1145.736] (-1144.566) (-1149.913) (-1150.759) -- 0:00:00 4500 -- (-1154.482) [-1147.278] (-1148.517) (-1148.690) * (-1145.549) (-1142.334) [-1140.868] (-1150.015) -- 0:00:00 5000 -- (-1140.696) (-1143.365) [-1143.498] (-1150.131) * (-1149.057) [-1151.293] (-1145.657) (-1151.625) -- 0:00:00 Average standard deviation of split frequencies: 0.086424 5500 -- (-1148.258) (-1146.178) [-1150.067] (-1140.791) * (-1147.656) (-1144.584) (-1144.621) [-1145.488] -- 0:00:00 6000 -- (-1144.656) (-1148.560) (-1155.057) [-1144.767] * (-1143.299) (-1143.791) [-1146.866] (-1152.389) -- 0:00:00 6500 -- (-1143.142) (-1146.840) (-1138.933) [-1149.391] * [-1150.412] (-1151.171) (-1147.631) (-1142.458) -- 0:00:00 7000 -- (-1156.301) [-1147.376] (-1149.572) (-1150.757) * (-1150.943) [-1146.125] (-1152.993) (-1154.438) -- 0:02:21 7500 -- (-1153.965) (-1149.671) [-1143.515] (-1146.035) * (-1144.754) [-1144.975] (-1150.303) (-1148.443) -- 0:02:12 8000 -- (-1145.004) (-1143.067) [-1151.781] (-1141.090) * (-1140.742) (-1148.183) (-1149.961) [-1144.427] -- 0:02:04 8500 -- (-1149.040) [-1144.744] (-1143.839) (-1142.917) * (-1148.691) (-1151.482) (-1142.936) [-1143.969] -- 0:01:56 9000 -- (-1149.226) (-1145.593) [-1144.410] (-1151.232) * (-1147.255) [-1152.220] (-1149.122) (-1146.812) -- 0:01:50 9500 -- (-1144.735) (-1146.935) [-1150.699] (-1152.489) * [-1141.183] (-1146.192) (-1146.892) (-1146.241) -- 0:01:44 10000 -- [-1149.097] (-1155.281) (-1144.579) (-1149.373) * (-1142.273) (-1150.390) (-1142.020) [-1142.977] -- 0:01:39 Average standard deviation of split frequencies: 0.072920 10500 -- (-1144.718) (-1143.592) (-1156.298) [-1143.247] * (-1141.133) (-1145.761) (-1144.697) [-1145.697] -- 0:01:34 11000 -- (-1149.018) (-1145.410) [-1145.078] (-1147.687) * [-1145.107] (-1144.279) (-1144.725) (-1142.570) -- 0:01:29 11500 -- (-1145.230) [-1144.769] (-1153.529) (-1149.038) * (-1141.721) (-1145.028) (-1144.948) [-1143.224] -- 0:01:25 12000 -- (-1144.817) (-1150.386) [-1145.210] (-1144.816) * (-1142.981) (-1143.426) (-1144.298) [-1146.622] -- 0:01:22 12500 -- (-1145.567) (-1147.637) (-1150.048) [-1148.473] * [-1141.333] (-1141.276) (-1146.194) (-1142.030) -- 0:01:19 13000 -- (-1147.584) [-1144.467] (-1150.220) (-1148.493) * (-1139.794) (-1141.111) (-1148.728) [-1148.272] -- 0:01:15 13500 -- [-1144.378] (-1150.078) (-1145.119) (-1143.095) * (-1140.641) (-1143.991) (-1152.636) [-1146.139] -- 0:01:13 14000 -- (-1142.936) (-1148.633) [-1144.881] (-1148.424) * (-1141.180) (-1147.076) (-1146.125) [-1143.444] -- 0:01:10 14500 -- (-1140.844) (-1142.363) [-1140.340] (-1152.111) * (-1145.119) (-1146.282) (-1143.186) [-1145.891] -- 0:01:07 15000 -- (-1145.463) (-1148.483) [-1147.978] (-1145.679) * (-1141.334) (-1145.763) [-1140.652] (-1151.505) -- 0:01:05 Average standard deviation of split frequencies: 0.051911 15500 -- (-1142.455) (-1148.187) [-1146.633] (-1142.209) * (-1140.620) (-1142.498) (-1148.958) [-1146.580] -- 0:01:03 16000 -- (-1139.796) [-1141.868] (-1158.110) (-1144.399) * [-1142.362] (-1144.235) (-1156.647) (-1148.407) -- 0:01:01 16500 -- [-1143.203] (-1149.050) (-1146.300) (-1145.380) * (-1143.487) (-1141.624) (-1151.737) [-1143.661] -- 0:00:59 17000 -- (-1141.065) [-1145.089] (-1147.343) (-1140.852) * (-1149.158) (-1142.955) [-1140.532] (-1143.670) -- 0:00:57 17500 -- (-1145.379) (-1147.769) [-1145.196] (-1143.202) * (-1143.209) (-1144.423) [-1145.488] (-1141.081) -- 0:00:56 18000 -- (-1147.436) [-1145.648] (-1146.820) (-1143.288) * (-1141.703) (-1146.213) (-1148.491) [-1143.921] -- 0:00:54 18500 -- (-1145.724) [-1151.873] (-1145.617) (-1155.377) * [-1141.640] (-1141.785) (-1170.886) (-1148.133) -- 0:00:53 19000 -- (-1147.857) [-1144.529] (-1145.152) (-1147.800) * (-1141.289) [-1144.607] (-1141.660) (-1143.221) -- 0:00:51 19500 -- [-1141.345] (-1147.277) (-1144.493) (-1148.742) * [-1142.049] (-1142.888) (-1144.624) (-1140.931) -- 0:00:50 20000 -- (-1142.845) [-1144.466] (-1146.764) (-1144.786) * (-1143.276) (-1145.655) (-1139.752) [-1138.905] -- 0:00:49 Average standard deviation of split frequencies: 0.041595 20500 -- (-1144.587) [-1143.594] (-1146.136) (-1143.229) * (-1143.115) (-1145.657) (-1142.579) [-1143.415] -- 0:01:35 21000 -- [-1139.410] (-1146.773) (-1145.911) (-1143.116) * (-1141.195) (-1144.975) [-1140.849] (-1145.150) -- 0:01:33 21500 -- [-1139.514] (-1146.113) (-1145.082) (-1143.368) * (-1139.267) (-1142.849) (-1142.429) [-1144.894] -- 0:01:31 22000 -- (-1142.702) (-1142.489) (-1142.577) [-1139.774] * (-1141.519) (-1143.625) (-1142.302) [-1143.954] -- 0:01:28 22500 -- (-1140.964) (-1145.991) (-1143.682) [-1141.621] * (-1140.988) [-1139.912] (-1145.934) (-1144.205) -- 0:01:26 23000 -- (-1143.003) [-1152.783] (-1150.239) (-1141.911) * (-1139.442) (-1142.114) [-1142.567] (-1143.495) -- 0:01:24 23500 -- (-1142.256) [-1147.498] (-1145.289) (-1142.787) * [-1139.783] (-1142.389) (-1148.519) (-1144.822) -- 0:01:23 24000 -- [-1142.225] (-1150.202) (-1147.929) (-1142.119) * (-1141.741) [-1141.610] (-1145.752) (-1141.845) -- 0:01:21 24500 -- (-1144.694) (-1154.536) (-1146.442) [-1141.493] * (-1142.823) (-1143.991) (-1140.196) [-1142.372] -- 0:01:19 25000 -- [-1141.974] (-1149.960) (-1143.483) (-1139.437) * (-1141.929) (-1140.782) (-1142.004) [-1140.341] -- 0:01:18 Average standard deviation of split frequencies: 0.044032 25500 -- (-1139.590) [-1147.640] (-1140.538) (-1139.459) * [-1145.212] (-1142.578) (-1141.667) (-1141.641) -- 0:01:16 26000 -- (-1142.840) (-1142.360) [-1140.014] (-1140.198) * (-1141.355) [-1142.903] (-1141.290) (-1141.876) -- 0:01:14 26500 -- [-1143.142] (-1145.466) (-1141.297) (-1143.097) * [-1143.902] (-1142.474) (-1142.511) (-1141.788) -- 0:01:13 27000 -- (-1141.291) [-1145.154] (-1140.338) (-1139.660) * (-1144.347) (-1143.499) (-1148.209) [-1147.575] -- 0:01:12 27500 -- [-1144.519] (-1143.625) (-1142.470) (-1139.888) * (-1142.942) (-1141.379) (-1142.815) [-1146.856] -- 0:01:10 28000 -- (-1144.682) [-1146.481] (-1140.810) (-1142.372) * [-1140.621] (-1142.043) (-1145.135) (-1144.188) -- 0:01:09 28500 -- (-1145.162) (-1148.707) [-1140.822] (-1141.949) * (-1143.404) (-1139.602) [-1142.338] (-1143.414) -- 0:01:08 29000 -- (-1144.308) (-1144.917) [-1143.283] (-1142.440) * (-1143.895) (-1142.412) (-1148.678) [-1142.117] -- 0:01:06 29500 -- (-1141.490) [-1149.183] (-1143.497) (-1142.761) * (-1147.442) (-1141.005) (-1142.486) [-1139.826] -- 0:01:05 30000 -- (-1142.133) [-1146.974] (-1143.475) (-1142.796) * (-1144.934) [-1141.777] (-1144.892) (-1145.407) -- 0:01:04 Average standard deviation of split frequencies: 0.042273 30500 -- (-1145.916) [-1147.479] (-1145.706) (-1141.432) * [-1142.080] (-1141.075) (-1160.182) (-1142.078) -- 0:01:03 31000 -- (-1140.134) [-1143.647] (-1143.921) (-1142.520) * (-1145.712) [-1145.670] (-1150.304) (-1140.881) -- 0:01:02 31500 -- (-1144.133) (-1144.862) (-1141.319) [-1141.927] * (-1142.936) [-1144.041] (-1152.121) (-1141.899) -- 0:01:01 32000 -- (-1142.748) (-1146.987) (-1141.910) [-1141.335] * (-1143.168) [-1141.346] (-1144.075) (-1146.013) -- 0:01:00 32500 -- (-1145.620) [-1150.372] (-1143.452) (-1144.300) * (-1143.749) [-1142.974] (-1142.018) (-1139.775) -- 0:00:59 33000 -- [-1144.238] (-1148.961) (-1141.513) (-1141.586) * (-1145.590) (-1145.862) [-1144.769] (-1140.781) -- 0:00:58 33500 -- (-1141.161) (-1148.312) [-1140.803] (-1141.513) * [-1146.157] (-1149.627) (-1144.436) (-1140.010) -- 0:01:26 34000 -- (-1141.920) (-1146.641) (-1142.173) [-1142.464] * (-1147.379) (-1144.417) (-1140.675) [-1140.994] -- 0:01:25 34500 -- [-1141.521] (-1151.393) (-1140.136) (-1142.515) * (-1146.270) (-1143.003) (-1142.658) [-1141.741] -- 0:01:23 35000 -- (-1142.988) (-1146.901) (-1142.718) [-1140.620] * (-1144.988) [-1141.538] (-1145.331) (-1140.268) -- 0:01:22 Average standard deviation of split frequencies: 0.037829 35500 -- (-1148.971) (-1146.432) [-1142.653] (-1147.942) * (-1143.759) [-1139.426] (-1143.999) (-1144.595) -- 0:01:21 36000 -- (-1141.722) (-1147.545) [-1145.296] (-1142.710) * (-1144.649) (-1142.450) (-1144.046) [-1145.154] -- 0:01:20 36500 -- (-1146.293) (-1149.664) [-1141.648] (-1139.017) * [-1143.264] (-1142.149) (-1142.651) (-1140.824) -- 0:01:19 37000 -- (-1148.758) (-1142.865) (-1141.270) [-1140.674] * (-1145.688) (-1143.607) [-1142.195] (-1144.875) -- 0:01:18 37500 -- (-1147.968) (-1143.739) (-1139.704) [-1141.839] * (-1144.163) [-1142.011] (-1143.330) (-1140.172) -- 0:01:17 38000 -- [-1145.515] (-1142.072) (-1142.598) (-1142.273) * (-1145.973) [-1140.497] (-1142.295) (-1141.500) -- 0:01:15 38500 -- (-1142.202) [-1144.095] (-1148.948) (-1141.428) * (-1143.840) [-1140.550] (-1140.335) (-1141.862) -- 0:01:14 39000 -- (-1146.655) (-1150.617) [-1144.446] (-1145.056) * (-1144.843) (-1140.998) (-1142.726) [-1139.991] -- 0:01:13 39500 -- (-1142.395) (-1143.261) [-1140.524] (-1141.153) * (-1149.601) (-1140.872) [-1145.253] (-1140.802) -- 0:01:12 40000 -- (-1144.732) [-1142.713] (-1141.332) (-1140.984) * [-1144.285] (-1142.157) (-1143.322) (-1141.698) -- 0:01:12 Average standard deviation of split frequencies: 0.042504 40500 -- (-1147.835) (-1146.625) [-1141.478] (-1143.727) * (-1144.297) (-1139.757) [-1142.323] (-1142.485) -- 0:01:11 41000 -- (-1145.975) [-1142.598] (-1144.175) (-1139.552) * (-1141.976) [-1144.556] (-1141.630) (-1141.193) -- 0:01:10 41500 -- (-1143.756) (-1145.069) (-1141.733) [-1140.826] * (-1140.122) (-1143.533) [-1140.808] (-1142.423) -- 0:01:09 42000 -- (-1140.329) (-1145.180) (-1147.278) [-1139.806] * (-1143.978) (-1142.974) (-1141.025) [-1142.868] -- 0:01:08 42500 -- [-1140.514] (-1142.076) (-1147.073) (-1141.784) * (-1141.236) (-1142.612) (-1140.175) [-1145.233] -- 0:01:07 43000 -- (-1141.810) (-1143.696) (-1142.110) [-1144.224] * [-1142.334] (-1139.638) (-1143.743) (-1141.352) -- 0:01:06 43500 -- [-1140.712] (-1144.124) (-1141.476) (-1139.730) * (-1140.605) [-1139.793] (-1144.262) (-1143.224) -- 0:01:05 44000 -- (-1142.451) [-1141.493] (-1139.719) (-1139.385) * (-1145.623) [-1140.349] (-1144.720) (-1143.860) -- 0:01:05 44500 -- [-1144.071] (-1142.940) (-1140.411) (-1139.976) * [-1141.887] (-1142.411) (-1142.320) (-1140.676) -- 0:01:04 45000 -- (-1144.464) (-1148.424) (-1141.541) [-1140.422] * (-1143.562) [-1142.633] (-1144.272) (-1141.475) -- 0:01:03 Average standard deviation of split frequencies: 0.037917 45500 -- (-1143.507) (-1143.077) [-1140.366] (-1143.673) * [-1142.345] (-1143.948) (-1141.568) (-1140.906) -- 0:01:02 46000 -- (-1143.318) (-1142.709) (-1140.483) [-1144.386] * [-1144.556] (-1140.296) (-1145.766) (-1140.589) -- 0:01:02 46500 -- (-1139.922) [-1141.175] (-1141.114) (-1145.801) * (-1147.422) [-1140.994] (-1143.516) (-1141.839) -- 0:01:01 47000 -- (-1144.804) (-1143.737) [-1141.650] (-1142.381) * (-1147.821) (-1142.930) [-1142.789] (-1142.680) -- 0:01:21 47500 -- (-1143.624) (-1143.734) (-1143.686) [-1141.182] * (-1144.130) (-1141.954) (-1143.856) [-1140.635] -- 0:01:20 48000 -- (-1142.904) [-1144.737] (-1142.152) (-1142.350) * [-1143.266] (-1149.115) (-1144.948) (-1142.146) -- 0:01:19 48500 -- (-1141.365) (-1143.645) [-1139.317] (-1144.300) * [-1140.579] (-1147.603) (-1142.293) (-1142.540) -- 0:01:18 49000 -- (-1142.520) [-1141.669] (-1141.484) (-1149.074) * (-1141.406) (-1141.928) (-1143.165) [-1143.605] -- 0:01:17 49500 -- (-1141.202) (-1140.234) (-1143.164) [-1146.079] * (-1140.718) [-1142.520] (-1144.961) (-1143.502) -- 0:01:16 50000 -- [-1140.997] (-1142.488) (-1142.079) (-1143.742) * (-1140.860) [-1144.188] (-1143.528) (-1146.126) -- 0:01:16 Average standard deviation of split frequencies: 0.041403 50500 -- [-1144.418] (-1143.012) (-1142.261) (-1141.865) * (-1142.534) (-1141.621) (-1144.578) [-1140.389] -- 0:01:15 51000 -- [-1144.853] (-1144.647) (-1141.383) (-1143.344) * [-1139.599] (-1144.125) (-1141.452) (-1143.366) -- 0:01:14 51500 -- (-1142.574) (-1141.870) (-1139.774) [-1141.400] * (-1142.582) [-1144.518] (-1141.162) (-1140.982) -- 0:01:13 52000 -- [-1141.794] (-1139.961) (-1145.179) (-1140.539) * (-1141.744) (-1144.468) (-1141.393) [-1141.480] -- 0:01:12 52500 -- (-1141.668) (-1141.195) [-1142.702] (-1140.174) * (-1146.655) (-1144.954) (-1145.279) [-1138.947] -- 0:01:12 53000 -- [-1139.356] (-1140.633) (-1143.428) (-1140.558) * (-1145.801) (-1143.625) (-1142.679) [-1140.416] -- 0:01:11 53500 -- (-1143.005) (-1141.560) (-1139.774) [-1143.652] * (-1152.013) (-1145.642) (-1144.883) [-1139.728] -- 0:01:10 54000 -- (-1145.870) (-1143.598) [-1141.447] (-1146.548) * (-1146.481) (-1146.429) (-1143.622) [-1141.741] -- 0:01:10 54500 -- (-1142.519) (-1140.094) (-1141.359) [-1141.216] * (-1145.057) (-1145.718) (-1143.438) [-1143.076] -- 0:01:09 55000 -- (-1143.446) (-1144.883) [-1146.270] (-1141.707) * [-1142.154] (-1146.783) (-1141.291) (-1140.274) -- 0:01:08 Average standard deviation of split frequencies: 0.034607 55500 -- [-1144.306] (-1142.763) (-1145.674) (-1140.890) * [-1142.943] (-1146.480) (-1144.534) (-1142.308) -- 0:01:08 56000 -- (-1143.671) (-1141.247) (-1144.782) [-1139.794] * (-1144.938) (-1140.108) (-1142.696) [-1140.779] -- 0:01:07 56500 -- (-1144.200) (-1143.382) (-1141.348) [-1143.405] * (-1147.902) (-1139.819) (-1140.252) [-1144.273] -- 0:01:06 57000 -- (-1144.700) [-1144.787] (-1140.825) (-1143.132) * (-1146.470) (-1146.859) (-1142.692) [-1143.011] -- 0:01:06 57500 -- [-1142.042] (-1143.529) (-1142.319) (-1142.013) * [-1143.420] (-1143.337) (-1141.705) (-1143.531) -- 0:01:05 58000 -- [-1140.535] (-1141.655) (-1145.449) (-1140.667) * (-1142.258) [-1145.753] (-1142.376) (-1144.666) -- 0:01:04 58500 -- [-1141.310] (-1141.598) (-1144.919) (-1140.019) * [-1140.158] (-1146.402) (-1148.302) (-1145.829) -- 0:01:04 59000 -- (-1142.547) (-1141.786) (-1144.128) [-1139.762] * [-1141.490] (-1141.283) (-1144.757) (-1146.059) -- 0:01:03 59500 -- (-1141.802) [-1140.408] (-1145.334) (-1140.185) * (-1145.972) (-1144.310) (-1145.988) [-1144.948] -- 0:01:03 60000 -- (-1142.768) (-1140.659) (-1143.584) [-1140.829] * (-1143.977) (-1140.312) [-1142.903] (-1141.649) -- 0:01:02 Average standard deviation of split frequencies: 0.036567 60500 -- (-1142.145) (-1143.936) (-1145.471) [-1144.642] * (-1143.712) (-1142.877) [-1142.117] (-1142.177) -- 0:01:02 61000 -- (-1144.560) (-1143.557) [-1143.612] (-1143.670) * (-1144.504) (-1144.668) [-1144.122] (-1146.403) -- 0:01:16 61500 -- (-1141.677) [-1143.700] (-1143.734) (-1140.070) * (-1142.769) (-1140.884) [-1142.550] (-1140.547) -- 0:01:16 62000 -- (-1143.151) (-1146.234) (-1140.772) [-1140.856] * (-1142.519) (-1145.404) [-1140.063] (-1141.113) -- 0:01:15 62500 -- (-1141.939) (-1145.363) (-1143.808) [-1143.648] * (-1142.670) (-1141.075) [-1142.330] (-1139.959) -- 0:01:15 63000 -- (-1144.531) (-1144.294) [-1144.992] (-1139.969) * (-1144.725) (-1143.274) (-1141.783) [-1142.160] -- 0:01:14 63500 -- (-1143.921) (-1143.550) (-1144.097) [-1142.393] * (-1145.727) (-1149.692) [-1140.909] (-1140.560) -- 0:01:13 64000 -- (-1142.413) (-1143.621) (-1142.906) [-1141.512] * (-1142.185) (-1145.580) [-1143.844] (-1143.102) -- 0:01:13 64500 -- (-1144.580) [-1142.065] (-1143.728) (-1142.438) * (-1143.245) [-1144.316] (-1143.402) (-1144.067) -- 0:01:12 65000 -- (-1142.221) (-1141.508) [-1140.661] (-1142.679) * (-1143.497) [-1145.988] (-1141.318) (-1143.593) -- 0:01:11 Average standard deviation of split frequencies: 0.033927 65500 -- (-1139.746) [-1141.528] (-1144.793) (-1140.558) * [-1140.186] (-1146.747) (-1145.487) (-1141.727) -- 0:01:11 66000 -- (-1141.201) (-1142.040) (-1141.404) [-1139.162] * (-1140.435) (-1143.434) [-1144.028] (-1142.041) -- 0:01:10 66500 -- (-1146.708) (-1143.134) (-1144.834) [-1141.312] * (-1140.780) (-1144.109) [-1142.925] (-1142.835) -- 0:01:10 67000 -- (-1147.657) [-1143.152] (-1146.192) (-1145.236) * (-1142.669) (-1142.510) [-1144.432] (-1140.603) -- 0:01:09 67500 -- (-1145.169) [-1144.729] (-1145.680) (-1140.677) * (-1141.177) [-1140.964] (-1141.069) (-1143.937) -- 0:01:09 68000 -- (-1146.705) (-1141.631) (-1145.983) [-1140.647] * [-1142.969] (-1142.049) (-1142.507) (-1146.280) -- 0:01:08 68500 -- [-1142.443] (-1140.398) (-1147.612) (-1142.467) * (-1143.334) (-1142.014) [-1144.210] (-1144.679) -- 0:01:07 69000 -- (-1141.924) (-1145.454) (-1147.267) [-1140.679] * (-1143.531) (-1146.020) [-1141.524] (-1142.010) -- 0:01:07 69500 -- (-1143.036) [-1142.114] (-1143.782) (-1141.231) * (-1145.345) (-1147.169) (-1141.047) [-1142.578] -- 0:01:06 70000 -- (-1142.484) [-1141.542] (-1142.319) (-1142.227) * (-1142.102) (-1142.467) [-1144.010] (-1142.651) -- 0:01:06 Average standard deviation of split frequencies: 0.030495 70500 -- (-1142.358) (-1141.401) (-1140.334) [-1140.174] * (-1144.622) (-1144.404) [-1140.432] (-1143.153) -- 0:01:05 71000 -- [-1144.332] (-1141.010) (-1141.612) (-1139.909) * (-1143.202) [-1140.535] (-1143.069) (-1145.071) -- 0:01:05 71500 -- (-1148.708) (-1143.207) (-1142.847) [-1140.154] * (-1141.522) (-1146.313) [-1140.265] (-1144.293) -- 0:01:04 72000 -- [-1143.874] (-1148.049) (-1141.859) (-1139.989) * [-1142.812] (-1144.727) (-1141.561) (-1143.684) -- 0:01:04 72500 -- (-1141.920) [-1142.139] (-1139.644) (-1146.354) * (-1141.510) (-1142.368) [-1140.014] (-1140.998) -- 0:01:03 73000 -- (-1140.651) [-1141.636] (-1140.579) (-1139.939) * (-1143.046) (-1142.999) [-1140.645] (-1143.098) -- 0:01:03 73500 -- [-1143.719] (-1146.069) (-1143.722) (-1142.674) * (-1145.390) [-1141.402] (-1141.007) (-1141.016) -- 0:01:03 74000 -- (-1142.307) [-1143.255] (-1143.822) (-1143.370) * (-1144.392) (-1144.671) [-1143.249] (-1140.067) -- 0:01:15 74500 -- [-1142.786] (-1142.350) (-1142.198) (-1142.491) * (-1144.427) (-1140.001) [-1141.165] (-1141.510) -- 0:01:14 75000 -- (-1140.903) (-1144.237) [-1142.424] (-1142.107) * (-1144.656) (-1146.869) (-1141.801) [-1143.810] -- 0:01:14 Average standard deviation of split frequencies: 0.028222 75500 -- (-1148.259) (-1141.406) (-1139.919) [-1139.989] * (-1145.904) [-1142.271] (-1145.458) (-1138.891) -- 0:01:13 76000 -- (-1142.890) (-1145.136) (-1142.228) [-1139.467] * (-1143.259) (-1144.116) (-1145.717) [-1143.198] -- 0:01:12 76500 -- (-1142.983) [-1143.680] (-1142.315) (-1142.865) * (-1141.966) (-1144.238) (-1144.844) [-1142.521] -- 0:01:12 77000 -- (-1142.211) [-1141.015] (-1140.593) (-1141.726) * (-1142.986) [-1142.953] (-1143.933) (-1143.163) -- 0:01:11 77500 -- (-1145.814) (-1143.079) [-1140.247] (-1144.892) * (-1142.034) (-1139.863) [-1143.856] (-1142.224) -- 0:01:11 78000 -- (-1147.080) [-1144.013] (-1145.960) (-1139.941) * (-1143.738) (-1143.291) [-1145.035] (-1141.152) -- 0:01:10 78500 -- (-1146.990) (-1144.440) [-1141.079] (-1141.452) * (-1143.786) [-1145.404] (-1140.678) (-1141.317) -- 0:01:10 79000 -- (-1144.646) [-1144.054] (-1141.385) (-1144.843) * (-1142.055) (-1145.823) [-1141.753] (-1144.015) -- 0:01:09 79500 -- [-1144.258] (-1141.563) (-1143.178) (-1143.695) * [-1143.684] (-1141.470) (-1142.809) (-1143.032) -- 0:01:09 80000 -- (-1149.864) (-1146.111) [-1141.380] (-1145.582) * (-1144.590) (-1143.416) (-1143.628) [-1143.199] -- 0:01:09 Average standard deviation of split frequencies: 0.026451 80500 -- (-1146.830) [-1141.364] (-1141.659) (-1144.833) * (-1146.320) (-1148.302) [-1144.239] (-1145.371) -- 0:01:08 81000 -- (-1145.871) [-1142.261] (-1142.464) (-1143.185) * (-1141.371) (-1146.450) (-1144.034) [-1142.289] -- 0:01:08 81500 -- (-1144.383) [-1142.494] (-1142.600) (-1142.941) * (-1142.873) (-1140.462) [-1143.331] (-1141.741) -- 0:01:07 82000 -- [-1145.555] (-1141.850) (-1140.498) (-1144.147) * (-1144.433) (-1141.994) [-1144.796] (-1145.947) -- 0:01:07 82500 -- (-1144.322) (-1142.762) (-1146.824) [-1140.718] * (-1140.543) [-1141.240] (-1144.007) (-1149.708) -- 0:01:06 83000 -- (-1148.528) [-1143.722] (-1143.352) (-1145.128) * [-1141.112] (-1140.064) (-1145.571) (-1147.212) -- 0:01:06 83500 -- (-1147.114) (-1141.413) [-1142.931] (-1145.073) * (-1143.778) [-1142.418] (-1140.379) (-1140.581) -- 0:01:05 84000 -- (-1142.612) (-1144.199) [-1147.920] (-1145.020) * (-1143.984) (-1142.866) [-1140.280] (-1144.040) -- 0:01:05 84500 -- (-1143.425) [-1141.854] (-1144.251) (-1144.748) * (-1142.958) (-1140.278) [-1145.374] (-1145.839) -- 0:01:05 85000 -- [-1141.741] (-1144.034) (-1141.888) (-1147.231) * (-1142.587) (-1141.442) [-1141.665] (-1144.245) -- 0:01:04 Average standard deviation of split frequencies: 0.023231 85500 -- (-1145.553) (-1144.378) [-1140.485] (-1150.396) * [-1142.452] (-1142.552) (-1141.258) (-1141.509) -- 0:01:04 86000 -- (-1144.453) (-1142.529) (-1141.543) [-1143.589] * (-1145.515) (-1142.213) [-1142.448] (-1144.726) -- 0:01:03 86500 -- (-1141.252) (-1144.025) [-1142.411] (-1146.478) * (-1142.703) (-1143.525) [-1142.872] (-1141.441) -- 0:01:03 87000 -- (-1140.876) (-1146.548) (-1141.891) [-1140.971] * [-1143.561] (-1142.271) (-1141.686) (-1142.871) -- 0:01:13 87500 -- (-1142.290) (-1145.858) (-1141.574) [-1142.392] * [-1141.429] (-1143.056) (-1146.798) (-1143.053) -- 0:01:13 88000 -- (-1145.339) [-1145.907] (-1148.960) (-1142.380) * (-1140.267) (-1142.902) [-1143.186] (-1141.089) -- 0:01:12 88500 -- (-1142.327) (-1146.174) [-1145.132] (-1139.515) * (-1142.730) (-1141.869) [-1145.327] (-1143.289) -- 0:01:12 89000 -- (-1143.764) (-1144.651) (-1145.526) [-1143.562] * (-1143.520) (-1145.185) (-1144.345) [-1141.810] -- 0:01:11 89500 -- (-1142.878) (-1147.169) (-1145.573) [-1141.412] * [-1140.072] (-1144.525) (-1143.623) (-1146.873) -- 0:01:11 90000 -- (-1143.589) (-1148.306) [-1140.401] (-1142.713) * (-1143.288) (-1144.135) [-1142.512] (-1143.438) -- 0:01:10 Average standard deviation of split frequencies: 0.024628 90500 -- (-1145.184) [-1142.885] (-1140.937) (-1147.732) * (-1142.081) (-1145.639) (-1144.332) [-1140.196] -- 0:01:10 91000 -- (-1151.497) (-1142.876) [-1144.849] (-1148.848) * (-1141.923) (-1147.164) (-1145.565) [-1140.856] -- 0:01:09 91500 -- [-1141.869] (-1145.186) (-1144.095) (-1144.351) * (-1146.567) (-1143.838) (-1147.253) [-1143.812] -- 0:01:09 92000 -- [-1145.248] (-1148.374) (-1143.888) (-1142.821) * (-1142.623) (-1145.870) [-1144.371] (-1149.526) -- 0:01:09 92500 -- [-1145.030] (-1145.655) (-1141.270) (-1144.088) * (-1141.197) [-1142.459] (-1148.629) (-1145.086) -- 0:01:08 93000 -- (-1145.203) [-1142.577] (-1140.843) (-1146.323) * (-1142.728) [-1145.464] (-1141.424) (-1143.419) -- 0:01:08 93500 -- (-1143.018) (-1144.222) (-1143.076) [-1142.223] * (-1143.566) (-1145.383) [-1139.528] (-1143.703) -- 0:01:07 94000 -- [-1141.511] (-1144.508) (-1140.509) (-1144.462) * (-1141.287) [-1142.184] (-1142.936) (-1140.178) -- 0:01:07 94500 -- (-1144.803) [-1147.270] (-1141.835) (-1142.213) * [-1142.416] (-1143.368) (-1141.968) (-1143.442) -- 0:01:07 95000 -- (-1144.436) [-1142.294] (-1143.272) (-1142.220) * (-1144.250) (-1142.358) (-1141.895) [-1142.145] -- 0:01:06 Average standard deviation of split frequencies: 0.022915 95500 -- (-1141.712) [-1144.282] (-1143.121) (-1144.424) * (-1143.049) (-1142.510) (-1141.262) [-1141.015] -- 0:01:06 96000 -- (-1141.508) (-1144.113) [-1151.360] (-1145.865) * [-1141.402] (-1140.729) (-1142.786) (-1142.638) -- 0:01:05 96500 -- (-1146.323) (-1144.409) (-1142.390) [-1145.027] * (-1143.093) [-1142.137] (-1141.398) (-1142.091) -- 0:01:05 97000 -- [-1142.260] (-1146.361) (-1143.056) (-1144.881) * (-1142.703) [-1146.703] (-1145.907) (-1142.213) -- 0:01:05 97500 -- [-1140.671] (-1141.471) (-1143.342) (-1144.727) * (-1141.803) (-1144.799) [-1144.621] (-1141.625) -- 0:01:04 98000 -- [-1139.176] (-1143.776) (-1144.402) (-1146.626) * (-1142.256) (-1141.516) (-1146.274) [-1143.078] -- 0:01:04 98500 -- (-1141.005) (-1142.114) [-1142.458] (-1143.437) * [-1141.475] (-1141.809) (-1146.240) (-1139.977) -- 0:01:04 99000 -- (-1141.727) (-1140.793) (-1142.863) [-1143.827] * (-1143.417) (-1141.304) (-1143.786) [-1142.432] -- 0:01:03 99500 -- (-1140.609) (-1142.936) [-1142.077] (-1146.187) * (-1141.266) [-1142.689] (-1143.264) (-1143.626) -- 0:01:03 100000 -- (-1146.177) [-1142.633] (-1141.705) (-1144.833) * (-1143.153) (-1143.337) (-1142.357) [-1145.346] -- 0:01:02 Average standard deviation of split frequencies: 0.021593 100500 -- (-1141.515) (-1140.154) [-1141.733] (-1143.994) * (-1141.492) [-1145.911] (-1144.498) (-1147.616) -- 0:01:11 101000 -- (-1141.790) [-1140.870] (-1142.584) (-1144.974) * (-1142.248) [-1144.194] (-1144.474) (-1146.783) -- 0:01:11 101500 -- [-1139.132] (-1142.544) (-1144.018) (-1146.571) * (-1141.308) [-1142.279] (-1146.739) (-1148.965) -- 0:01:10 102000 -- (-1138.118) (-1143.113) (-1143.933) [-1147.663] * [-1145.387] (-1147.292) (-1148.033) (-1143.052) -- 0:01:10 102500 -- (-1144.188) [-1145.209] (-1141.358) (-1145.476) * (-1146.126) [-1145.175] (-1146.419) (-1147.277) -- 0:01:10 103000 -- (-1140.614) (-1141.389) [-1142.971] (-1150.356) * (-1141.994) (-1143.891) (-1144.774) [-1146.032] -- 0:01:09 103500 -- [-1140.143] (-1141.680) (-1144.192) (-1145.799) * (-1142.862) (-1145.196) (-1143.713) [-1140.872] -- 0:01:09 104000 -- [-1139.138] (-1141.648) (-1141.192) (-1144.703) * [-1140.498] (-1143.204) (-1144.911) (-1144.659) -- 0:01:08 104500 -- (-1143.820) [-1140.866] (-1144.104) (-1141.547) * (-1145.489) (-1140.282) (-1147.545) [-1146.147] -- 0:01:08 105000 -- (-1141.862) [-1143.260] (-1144.994) (-1146.036) * (-1141.454) (-1141.394) (-1143.989) [-1141.154] -- 0:01:08 Average standard deviation of split frequencies: 0.018636 105500 -- [-1141.459] (-1145.470) (-1144.157) (-1141.251) * (-1141.499) (-1142.044) [-1141.434] (-1142.676) -- 0:01:07 106000 -- (-1141.824) (-1140.330) [-1142.035] (-1143.575) * (-1142.102) (-1140.555) (-1143.374) [-1140.284] -- 0:01:07 106500 -- (-1142.225) [-1141.553] (-1142.818) (-1146.441) * (-1143.385) [-1147.466] (-1142.273) (-1139.704) -- 0:01:07 107000 -- [-1139.651] (-1142.129) (-1142.442) (-1148.437) * (-1141.818) (-1145.390) (-1147.862) [-1141.854] -- 0:01:06 107500 -- [-1143.931] (-1140.616) (-1141.403) (-1149.927) * (-1143.851) (-1141.350) [-1144.288] (-1140.851) -- 0:01:06 108000 -- [-1143.250] (-1142.276) (-1142.699) (-1146.749) * (-1140.894) [-1141.497] (-1142.850) (-1141.229) -- 0:01:06 108500 -- (-1139.546) (-1142.287) [-1143.876] (-1146.042) * (-1143.990) (-1139.699) [-1144.133] (-1145.084) -- 0:01:05 109000 -- [-1144.595] (-1149.222) (-1141.710) (-1148.800) * (-1144.894) (-1142.240) [-1142.269] (-1142.314) -- 0:01:05 109500 -- (-1144.143) (-1154.245) (-1146.673) [-1144.829] * (-1141.007) (-1143.775) [-1142.989] (-1141.123) -- 0:01:05 110000 -- (-1141.029) [-1140.300] (-1145.422) (-1140.850) * [-1142.400] (-1142.793) (-1140.811) (-1143.976) -- 0:01:04 Average standard deviation of split frequencies: 0.017891 110500 -- [-1143.834] (-1139.946) (-1143.314) (-1141.414) * (-1143.209) (-1144.520) [-1144.976] (-1146.002) -- 0:01:04 111000 -- (-1143.521) (-1143.760) (-1143.422) [-1140.926] * (-1140.644) [-1142.964] (-1139.237) (-1148.245) -- 0:01:04 111500 -- (-1144.977) (-1142.696) (-1146.495) [-1142.559] * (-1147.038) [-1143.660] (-1143.300) (-1144.724) -- 0:01:03 112000 -- (-1142.633) (-1142.128) (-1146.528) [-1141.762] * (-1145.670) [-1143.347] (-1143.495) (-1144.301) -- 0:01:03 112500 -- (-1145.168) [-1144.432] (-1141.691) (-1144.432) * [-1141.483] (-1148.122) (-1141.433) (-1142.318) -- 0:01:03 113000 -- (-1140.505) (-1140.955) [-1142.726] (-1144.421) * (-1148.382) (-1144.157) [-1141.370] (-1147.459) -- 0:01:02 113500 -- (-1143.305) (-1140.844) (-1145.494) [-1141.210] * (-1149.988) (-1144.695) (-1142.034) [-1145.560] -- 0:01:10 114000 -- [-1143.193] (-1139.813) (-1143.800) (-1139.142) * [-1143.701] (-1143.397) (-1142.722) (-1141.762) -- 0:01:09 114500 -- (-1147.349) [-1141.023] (-1152.355) (-1140.277) * (-1140.561) (-1141.482) [-1140.494] (-1140.552) -- 0:01:09 115000 -- (-1143.104) [-1143.085] (-1143.543) (-1151.502) * (-1141.705) [-1142.078] (-1146.372) (-1140.463) -- 0:01:09 Average standard deviation of split frequencies: 0.021602 115500 -- (-1140.865) (-1142.078) (-1144.271) [-1138.461] * (-1143.699) (-1140.882) (-1143.703) [-1139.612] -- 0:01:08 116000 -- (-1144.418) [-1143.051] (-1143.955) (-1142.997) * (-1145.132) [-1141.415] (-1146.113) (-1140.253) -- 0:01:08 116500 -- (-1141.891) (-1143.762) (-1144.422) [-1140.400] * (-1142.494) [-1141.469] (-1143.267) (-1142.922) -- 0:01:08 117000 -- (-1140.012) (-1142.749) [-1144.922] (-1140.997) * (-1144.625) (-1144.799) (-1143.763) [-1144.739] -- 0:01:07 117500 -- (-1140.799) (-1141.843) (-1144.274) [-1140.754] * (-1145.386) [-1140.996] (-1149.284) (-1143.885) -- 0:01:07 118000 -- (-1141.027) (-1141.323) [-1143.693] (-1142.178) * (-1142.747) [-1141.234] (-1144.925) (-1145.273) -- 0:01:07 118500 -- (-1144.832) [-1143.799] (-1141.645) (-1142.110) * (-1145.799) [-1143.412] (-1144.478) (-1145.998) -- 0:01:06 119000 -- (-1144.642) (-1141.930) [-1147.404] (-1140.819) * [-1142.639] (-1144.684) (-1147.524) (-1145.296) -- 0:01:06 119500 -- (-1145.853) [-1140.925] (-1147.358) (-1141.879) * [-1143.193] (-1142.763) (-1141.966) (-1145.022) -- 0:01:06 120000 -- (-1144.738) (-1145.353) [-1141.763] (-1139.693) * (-1143.248) [-1142.103] (-1141.328) (-1143.547) -- 0:01:06 Average standard deviation of split frequencies: 0.020150 120500 -- (-1143.923) (-1143.685) (-1142.651) [-1141.816] * [-1145.689] (-1144.210) (-1141.046) (-1143.647) -- 0:01:05 121000 -- (-1144.285) [-1140.063] (-1140.683) (-1140.677) * [-1145.350] (-1144.857) (-1141.042) (-1140.340) -- 0:01:05 121500 -- (-1146.995) (-1142.946) (-1143.826) [-1143.706] * (-1144.476) [-1143.793] (-1142.567) (-1141.503) -- 0:01:05 122000 -- (-1146.358) [-1139.958] (-1141.196) (-1139.953) * (-1141.864) (-1148.402) (-1142.403) [-1141.272] -- 0:01:04 122500 -- (-1144.067) (-1141.809) (-1143.169) [-1141.312] * [-1143.670] (-1140.940) (-1141.482) (-1145.089) -- 0:01:04 123000 -- [-1146.253] (-1140.812) (-1143.141) (-1140.562) * (-1144.713) (-1144.665) (-1142.031) [-1144.579] -- 0:01:04 123500 -- (-1142.876) [-1143.129] (-1148.594) (-1141.245) * [-1143.592] (-1143.957) (-1142.960) (-1143.537) -- 0:01:03 124000 -- (-1142.644) (-1143.336) (-1146.907) [-1141.098] * [-1141.986] (-1143.736) (-1142.999) (-1146.097) -- 0:01:03 124500 -- (-1140.943) (-1145.465) [-1143.534] (-1141.235) * [-1141.013] (-1148.234) (-1142.253) (-1142.387) -- 0:01:03 125000 -- (-1142.537) (-1144.224) [-1141.787] (-1141.772) * (-1141.088) (-1148.489) (-1141.896) [-1142.315] -- 0:01:03 Average standard deviation of split frequencies: 0.022448 125500 -- (-1140.256) [-1143.285] (-1145.701) (-1140.470) * [-1142.873] (-1148.029) (-1144.470) (-1145.406) -- 0:01:02 126000 -- (-1144.219) (-1141.481) (-1141.804) [-1140.559] * (-1144.348) (-1144.393) [-1140.449] (-1141.642) -- 0:01:09 126500 -- (-1149.501) [-1143.568] (-1141.397) (-1147.113) * (-1138.954) (-1145.370) (-1148.810) [-1140.455] -- 0:01:09 127000 -- (-1142.116) (-1143.398) (-1141.783) [-1142.593] * (-1140.739) (-1141.027) [-1147.147] (-1139.778) -- 0:01:08 127500 -- (-1141.893) (-1145.521) [-1140.656] (-1140.308) * (-1141.468) (-1144.376) (-1143.376) [-1138.247] -- 0:01:08 128000 -- (-1142.455) (-1141.330) [-1141.654] (-1142.764) * (-1140.250) (-1145.411) (-1141.341) [-1143.025] -- 0:01:08 128500 -- (-1145.265) (-1139.776) (-1140.143) [-1144.339] * (-1141.781) (-1145.694) (-1140.419) [-1141.881] -- 0:01:07 129000 -- (-1142.527) (-1141.733) (-1143.488) [-1141.091] * (-1140.772) (-1141.215) (-1140.562) [-1142.379] -- 0:01:07 129500 -- (-1142.158) [-1143.444] (-1144.022) (-1141.945) * (-1139.564) (-1141.079) [-1140.079] (-1142.300) -- 0:01:07 130000 -- [-1143.855] (-1143.671) (-1142.016) (-1142.985) * (-1141.040) (-1140.696) (-1144.363) [-1139.618] -- 0:01:06 Average standard deviation of split frequencies: 0.020383 130500 -- (-1142.815) (-1144.734) [-1142.007] (-1143.333) * (-1141.530) (-1140.865) (-1145.214) [-1141.058] -- 0:01:06 131000 -- (-1143.243) (-1144.945) [-1140.932] (-1143.461) * (-1141.694) [-1141.152] (-1142.272) (-1142.547) -- 0:01:06 131500 -- (-1139.534) (-1143.486) (-1142.377) [-1142.348] * (-1148.735) (-1141.455) (-1142.488) [-1140.741] -- 0:01:06 132000 -- [-1140.728] (-1148.213) (-1140.710) (-1141.688) * (-1142.948) (-1141.746) (-1141.602) [-1140.910] -- 0:01:05 132500 -- [-1141.973] (-1151.705) (-1141.992) (-1140.083) * (-1139.796) [-1145.274] (-1140.482) (-1142.725) -- 0:01:05 133000 -- [-1141.766] (-1146.156) (-1143.226) (-1143.547) * [-1143.230] (-1146.163) (-1140.560) (-1147.573) -- 0:01:05 133500 -- (-1146.382) (-1141.778) [-1140.558] (-1142.723) * [-1142.290] (-1143.658) (-1140.898) (-1141.279) -- 0:01:04 134000 -- (-1145.274) (-1143.438) (-1140.601) [-1143.479] * (-1142.649) (-1145.201) [-1142.156] (-1142.809) -- 0:01:04 134500 -- (-1142.676) [-1145.474] (-1141.789) (-1141.785) * (-1142.901) (-1149.689) [-1144.353] (-1141.738) -- 0:01:04 135000 -- (-1146.535) (-1140.648) [-1139.772] (-1143.605) * (-1143.574) (-1146.177) [-1139.381] (-1141.877) -- 0:01:04 Average standard deviation of split frequencies: 0.020797 135500 -- (-1142.775) (-1146.874) [-1144.079] (-1142.392) * (-1143.831) [-1143.698] (-1146.370) (-1140.658) -- 0:01:03 136000 -- [-1143.174] (-1144.633) (-1140.695) (-1143.845) * (-1145.961) [-1143.502] (-1140.047) (-1142.939) -- 0:01:03 136500 -- (-1146.235) (-1140.689) [-1144.666] (-1142.837) * (-1143.869) (-1143.136) (-1142.037) [-1141.586] -- 0:01:03 137000 -- (-1144.040) (-1142.435) (-1142.056) [-1141.229] * (-1142.258) [-1141.422] (-1141.056) (-1141.985) -- 0:01:02 137500 -- [-1144.061] (-1145.391) (-1145.458) (-1144.658) * (-1141.836) [-1143.798] (-1141.808) (-1145.437) -- 0:01:02 138000 -- [-1145.471] (-1141.848) (-1141.911) (-1143.864) * (-1140.162) (-1144.640) (-1145.418) [-1140.182] -- 0:01:02 138500 -- (-1143.252) [-1140.062] (-1142.135) (-1146.907) * (-1141.257) (-1143.217) (-1143.720) [-1140.206] -- 0:01:02 139000 -- (-1144.234) (-1142.213) (-1143.124) [-1141.834] * (-1141.838) [-1143.512] (-1143.652) (-1143.150) -- 0:01:08 139500 -- (-1146.313) [-1140.352] (-1142.596) (-1146.439) * (-1141.811) (-1144.004) (-1145.667) [-1141.244] -- 0:01:07 140000 -- (-1144.372) [-1139.878] (-1146.001) (-1143.511) * (-1143.860) (-1142.196) [-1141.234] (-1140.082) -- 0:01:07 Average standard deviation of split frequencies: 0.021411 140500 -- (-1141.494) [-1140.801] (-1143.625) (-1145.275) * (-1145.229) (-1141.995) [-1143.506] (-1143.798) -- 0:01:07 141000 -- [-1144.088] (-1142.945) (-1146.449) (-1144.240) * [-1144.613] (-1147.400) (-1143.954) (-1144.543) -- 0:01:07 141500 -- (-1146.828) (-1142.427) (-1149.851) [-1144.226] * (-1141.519) (-1144.072) (-1142.676) [-1141.287] -- 0:01:06 142000 -- [-1143.375] (-1141.013) (-1147.638) (-1144.803) * (-1141.252) (-1140.556) (-1147.898) [-1139.601] -- 0:01:06 142500 -- (-1141.740) (-1141.536) [-1144.196] (-1145.223) * [-1142.028] (-1141.210) (-1142.517) (-1140.867) -- 0:01:06 143000 -- (-1142.852) [-1142.677] (-1143.919) (-1143.687) * (-1140.589) (-1139.001) (-1144.026) [-1139.824] -- 0:01:05 143500 -- [-1141.594] (-1140.742) (-1144.637) (-1145.139) * [-1143.900] (-1140.593) (-1144.594) (-1139.756) -- 0:01:05 144000 -- (-1141.831) [-1143.099] (-1143.032) (-1141.303) * [-1141.315] (-1143.913) (-1143.311) (-1144.780) -- 0:01:05 144500 -- [-1143.394] (-1142.275) (-1140.629) (-1142.656) * [-1141.532] (-1146.796) (-1141.994) (-1141.514) -- 0:01:05 145000 -- (-1142.813) (-1141.044) (-1146.327) [-1144.158] * (-1143.038) (-1143.750) (-1148.315) [-1141.013] -- 0:01:04 Average standard deviation of split frequencies: 0.018693 145500 -- (-1144.239) (-1140.168) [-1143.676] (-1147.862) * (-1142.811) (-1142.932) (-1140.427) [-1142.549] -- 0:01:04 146000 -- (-1143.218) [-1140.674] (-1144.324) (-1142.968) * (-1143.389) (-1143.443) [-1141.096] (-1141.115) -- 0:01:04 146500 -- (-1144.441) (-1140.423) (-1141.395) [-1144.400] * (-1140.338) (-1143.235) [-1140.264] (-1140.768) -- 0:01:04 147000 -- (-1145.518) [-1141.574] (-1144.416) (-1148.982) * [-1142.786] (-1141.083) (-1139.194) (-1142.682) -- 0:01:03 147500 -- [-1140.664] (-1142.355) (-1143.959) (-1147.756) * [-1139.965] (-1142.010) (-1140.826) (-1141.068) -- 0:01:03 148000 -- (-1142.356) [-1144.720] (-1146.537) (-1146.532) * (-1140.367) [-1141.795] (-1143.593) (-1142.619) -- 0:01:03 148500 -- (-1145.978) (-1140.125) (-1140.996) [-1145.659] * (-1140.902) [-1142.409] (-1141.983) (-1145.104) -- 0:01:03 149000 -- (-1146.914) (-1139.831) [-1143.026] (-1146.870) * [-1143.228] (-1139.799) (-1143.369) (-1142.025) -- 0:01:02 149500 -- (-1145.067) (-1144.755) [-1144.041] (-1146.966) * [-1140.038] (-1143.443) (-1142.812) (-1143.485) -- 0:01:02 150000 -- [-1142.180] (-1141.319) (-1149.086) (-1146.508) * (-1142.336) [-1142.860] (-1143.687) (-1142.734) -- 0:01:02 Average standard deviation of split frequencies: 0.020337 150500 -- [-1142.543] (-1143.301) (-1147.053) (-1144.990) * (-1144.863) [-1140.462] (-1144.159) (-1143.726) -- 0:01:02 151000 -- (-1143.588) [-1143.157] (-1142.259) (-1143.016) * [-1145.910] (-1142.236) (-1143.192) (-1139.578) -- 0:01:01 151500 -- (-1141.929) (-1139.754) [-1142.530] (-1144.837) * (-1142.011) (-1142.082) (-1141.194) [-1140.470] -- 0:01:01 152000 -- (-1146.400) (-1141.216) (-1142.204) [-1142.724] * (-1141.811) (-1144.528) (-1143.624) [-1139.625] -- 0:01:01 152500 -- [-1141.724] (-1143.412) (-1143.117) (-1142.618) * (-1145.161) (-1140.375) (-1139.839) [-1142.131] -- 0:01:06 153000 -- (-1142.482) (-1141.986) [-1141.123] (-1145.902) * [-1141.854] (-1141.432) (-1144.190) (-1141.828) -- 0:01:06 153500 -- (-1139.729) [-1142.589] (-1142.285) (-1146.089) * (-1141.086) (-1142.218) (-1142.438) [-1139.463] -- 0:01:06 154000 -- (-1145.625) (-1141.594) (-1145.382) [-1146.343] * (-1142.725) (-1143.158) [-1146.074] (-1143.730) -- 0:01:05 154500 -- (-1145.740) [-1140.374] (-1143.287) (-1147.619) * (-1141.899) [-1141.731] (-1146.407) (-1144.935) -- 0:01:05 155000 -- [-1142.273] (-1140.980) (-1140.344) (-1142.862) * (-1143.453) (-1143.152) (-1146.846) [-1146.525] -- 0:01:05 Average standard deviation of split frequencies: 0.019474 155500 -- (-1143.003) (-1141.172) [-1141.432] (-1143.538) * [-1142.400] (-1143.581) (-1145.701) (-1141.637) -- 0:01:05 156000 -- (-1143.529) (-1142.019) [-1140.375] (-1146.660) * [-1140.944] (-1146.177) (-1149.435) (-1140.835) -- 0:01:04 156500 -- (-1144.275) (-1149.545) [-1141.801] (-1142.690) * (-1140.737) (-1141.499) [-1144.894] (-1147.767) -- 0:01:04 157000 -- (-1144.389) [-1141.934] (-1140.179) (-1144.798) * [-1144.977] (-1146.223) (-1145.225) (-1145.353) -- 0:01:04 157500 -- (-1146.861) (-1143.927) [-1143.347] (-1144.090) * (-1145.457) [-1140.509] (-1154.852) (-1142.746) -- 0:01:04 158000 -- [-1144.354] (-1141.688) (-1141.342) (-1144.295) * (-1143.588) (-1145.173) [-1143.737] (-1143.020) -- 0:01:03 158500 -- (-1144.604) (-1145.377) [-1140.753] (-1141.591) * [-1142.547] (-1144.421) (-1146.144) (-1143.147) -- 0:01:03 159000 -- (-1141.898) [-1143.705] (-1140.130) (-1141.692) * (-1144.683) (-1142.443) [-1144.317] (-1140.350) -- 0:01:03 159500 -- (-1141.829) [-1141.995] (-1143.544) (-1142.002) * [-1141.960] (-1143.676) (-1143.867) (-1140.244) -- 0:01:03 160000 -- (-1142.129) [-1142.744] (-1140.246) (-1139.464) * (-1141.508) (-1142.948) [-1143.111] (-1141.255) -- 0:01:02 Average standard deviation of split frequencies: 0.020864 160500 -- [-1140.080] (-1141.186) (-1146.101) (-1141.306) * [-1144.951] (-1145.395) (-1142.264) (-1139.503) -- 0:01:02 161000 -- [-1142.513] (-1140.805) (-1140.674) (-1141.511) * (-1142.295) (-1142.027) (-1143.842) [-1139.901] -- 0:01:02 161500 -- (-1140.666) [-1148.258] (-1140.645) (-1140.349) * (-1143.325) (-1143.888) (-1144.627) [-1141.278] -- 0:01:02 162000 -- (-1144.618) (-1146.849) (-1140.578) [-1141.077] * (-1143.414) (-1147.325) (-1146.532) [-1140.906] -- 0:01:02 162500 -- (-1141.672) (-1141.445) [-1140.632] (-1138.978) * [-1142.728] (-1146.368) (-1146.938) (-1142.175) -- 0:01:01 163000 -- (-1143.814) [-1142.627] (-1139.699) (-1143.489) * (-1143.445) (-1144.199) (-1143.920) [-1142.712] -- 0:01:01 163500 -- (-1145.421) (-1141.462) (-1141.383) [-1139.209] * (-1145.739) [-1144.562] (-1145.720) (-1142.779) -- 0:01:01 164000 -- (-1145.898) (-1141.453) (-1140.011) [-1141.507] * (-1140.781) (-1140.233) (-1142.234) [-1139.429] -- 0:01:01 164500 -- [-1143.344] (-1140.836) (-1146.647) (-1140.985) * (-1140.063) [-1140.158] (-1146.450) (-1141.822) -- 0:01:00 165000 -- (-1142.495) [-1141.460] (-1144.718) (-1140.272) * (-1141.808) (-1143.585) (-1143.960) [-1142.550] -- 0:01:00 Average standard deviation of split frequencies: 0.018982 165500 -- (-1144.722) [-1142.009] (-1147.288) (-1142.748) * (-1143.454) (-1146.904) [-1145.499] (-1143.819) -- 0:01:00 166000 -- (-1145.492) (-1145.384) [-1142.895] (-1142.808) * (-1141.832) [-1144.743] (-1145.833) (-1142.255) -- 0:01:05 166500 -- (-1147.926) (-1142.124) (-1147.330) [-1142.513] * (-1141.200) (-1143.922) [-1145.789] (-1141.856) -- 0:01:05 167000 -- [-1149.462] (-1143.125) (-1140.891) (-1145.292) * (-1140.369) [-1143.174] (-1144.257) (-1141.311) -- 0:01:04 167500 -- [-1145.563] (-1141.603) (-1141.557) (-1144.455) * (-1143.765) (-1143.672) (-1140.817) [-1143.389] -- 0:01:04 168000 -- (-1142.802) [-1143.943] (-1144.527) (-1142.010) * (-1142.094) [-1143.299] (-1144.483) (-1139.835) -- 0:01:04 168500 -- (-1144.582) (-1146.014) (-1146.656) [-1142.065] * (-1148.167) (-1144.615) (-1144.316) [-1139.630] -- 0:01:04 169000 -- (-1144.435) (-1142.635) [-1145.697] (-1141.681) * (-1145.340) (-1143.457) (-1144.393) [-1141.587] -- 0:01:03 169500 -- (-1147.098) (-1144.385) [-1143.909] (-1145.500) * (-1141.203) (-1144.357) (-1143.839) [-1140.280] -- 0:01:03 170000 -- (-1143.269) (-1140.606) (-1142.361) [-1141.840] * (-1142.839) (-1145.207) [-1144.989] (-1148.956) -- 0:01:03 Average standard deviation of split frequencies: 0.019028 170500 -- (-1140.763) (-1143.727) (-1143.995) [-1142.520] * (-1143.980) (-1143.648) (-1145.819) [-1145.892] -- 0:01:03 171000 -- (-1141.844) (-1143.770) [-1145.512] (-1140.552) * (-1141.678) [-1146.023] (-1146.769) (-1144.395) -- 0:01:03 171500 -- (-1142.056) [-1141.347] (-1150.763) (-1140.750) * (-1149.315) (-1144.679) (-1145.546) [-1141.390] -- 0:01:02 172000 -- (-1144.221) (-1141.490) (-1144.293) [-1141.648] * (-1142.132) (-1145.511) [-1141.696] (-1140.348) -- 0:01:02 172500 -- (-1146.690) [-1142.388] (-1144.444) (-1143.245) * (-1144.654) (-1143.510) (-1143.982) [-1141.003] -- 0:01:02 173000 -- (-1140.117) (-1142.123) [-1144.335] (-1147.044) * (-1142.365) (-1145.156) [-1142.064] (-1144.859) -- 0:01:02 173500 -- [-1141.312] (-1143.619) (-1148.496) (-1140.962) * [-1142.897] (-1144.681) (-1142.637) (-1143.590) -- 0:01:01 174000 -- (-1143.090) (-1142.623) (-1144.448) [-1143.574] * (-1140.929) (-1142.701) (-1142.064) [-1141.317] -- 0:01:01 174500 -- [-1139.996] (-1144.172) (-1143.673) (-1142.472) * (-1144.966) (-1142.379) [-1144.823] (-1144.268) -- 0:01:01 175000 -- (-1144.361) (-1142.475) [-1144.042] (-1144.455) * [-1141.759] (-1144.553) (-1146.977) (-1143.760) -- 0:01:01 Average standard deviation of split frequencies: 0.020535 175500 -- [-1142.378] (-1142.192) (-1140.293) (-1147.306) * (-1140.769) (-1140.665) (-1146.933) [-1145.229] -- 0:01:01 176000 -- (-1145.118) [-1144.824] (-1142.303) (-1144.088) * (-1141.049) [-1141.039] (-1141.467) (-1145.232) -- 0:01:00 176500 -- (-1146.416) [-1141.381] (-1142.079) (-1140.648) * (-1145.153) (-1143.650) [-1142.051] (-1143.131) -- 0:01:00 177000 -- (-1142.252) (-1141.876) [-1140.900] (-1143.049) * (-1140.333) (-1144.678) (-1141.629) [-1140.399] -- 0:01:00 177500 -- (-1144.664) (-1143.338) [-1142.784] (-1139.496) * (-1142.990) (-1140.963) (-1145.252) [-1140.546] -- 0:01:00 178000 -- [-1144.601] (-1142.315) (-1147.515) (-1140.383) * (-1142.797) [-1141.499] (-1147.958) (-1141.351) -- 0:01:04 178500 -- (-1144.669) (-1140.477) (-1144.584) [-1142.208] * (-1139.607) (-1145.236) [-1144.528] (-1142.017) -- 0:01:04 179000 -- (-1143.526) [-1143.088] (-1143.407) (-1142.739) * [-1143.040] (-1141.899) (-1143.539) (-1144.255) -- 0:01:04 179500 -- (-1146.042) (-1141.226) [-1140.446] (-1140.820) * (-1140.956) [-1140.438] (-1143.781) (-1144.100) -- 0:01:03 180000 -- [-1142.245] (-1141.519) (-1145.112) (-1143.166) * (-1141.829) [-1146.553] (-1143.434) (-1143.066) -- 0:01:03 Average standard deviation of split frequencies: 0.020149 180500 -- (-1142.585) (-1140.894) (-1143.407) [-1143.777] * [-1140.189] (-1141.703) (-1142.761) (-1143.145) -- 0:01:03 181000 -- (-1141.172) (-1140.048) (-1141.328) [-1142.742] * [-1141.233] (-1143.058) (-1142.593) (-1142.805) -- 0:01:03 181500 -- (-1142.365) (-1139.691) [-1141.368] (-1143.649) * (-1147.477) (-1141.737) (-1140.906) [-1140.834] -- 0:01:03 182000 -- (-1144.829) (-1141.296) [-1142.778] (-1145.617) * (-1144.185) [-1145.488] (-1142.576) (-1143.423) -- 0:01:02 182500 -- (-1151.041) [-1144.692] (-1142.324) (-1146.128) * (-1146.590) (-1142.775) [-1148.104] (-1142.103) -- 0:01:02 183000 -- [-1143.572] (-1140.914) (-1140.676) (-1145.238) * (-1141.852) (-1144.240) (-1144.541) [-1140.495] -- 0:01:02 183500 -- (-1143.527) (-1145.793) (-1139.859) [-1139.632] * (-1141.068) [-1140.609] (-1144.471) (-1143.628) -- 0:01:02 184000 -- (-1144.988) [-1140.243] (-1139.818) (-1141.587) * (-1142.579) (-1144.202) (-1147.765) [-1142.932] -- 0:01:02 184500 -- (-1143.028) [-1140.401] (-1140.494) (-1140.358) * (-1143.475) (-1141.255) (-1147.172) [-1144.359] -- 0:01:01 185000 -- (-1143.118) (-1144.659) [-1143.325] (-1143.373) * (-1143.298) [-1141.142] (-1144.204) (-1141.423) -- 0:01:01 Average standard deviation of split frequencies: 0.019895 185500 -- [-1146.033] (-1144.446) (-1141.132) (-1143.963) * (-1144.908) (-1144.659) [-1145.161] (-1141.418) -- 0:01:01 186000 -- (-1145.699) (-1143.323) (-1144.121) [-1142.892] * (-1141.038) (-1145.797) [-1143.029] (-1144.659) -- 0:01:01 186500 -- [-1143.174] (-1142.816) (-1144.294) (-1141.232) * (-1142.291) (-1141.828) [-1141.484] (-1144.445) -- 0:01:01 187000 -- [-1142.622] (-1145.094) (-1141.872) (-1143.926) * [-1141.724] (-1142.542) (-1148.066) (-1140.762) -- 0:01:00 187500 -- (-1145.093) (-1142.664) [-1142.656] (-1144.873) * [-1143.677] (-1143.063) (-1144.823) (-1145.674) -- 0:01:00 188000 -- [-1142.561] (-1141.025) (-1142.788) (-1146.771) * (-1141.283) [-1143.891] (-1143.988) (-1143.929) -- 0:01:00 188500 -- [-1142.255] (-1142.683) (-1141.253) (-1145.564) * (-1139.852) [-1141.656] (-1144.902) (-1142.379) -- 0:01:00 189000 -- (-1144.598) (-1144.079) [-1142.637] (-1144.467) * (-1143.656) (-1144.870) (-1142.728) [-1140.867] -- 0:01:00 189500 -- [-1142.907] (-1145.308) (-1141.304) (-1143.702) * (-1144.944) [-1142.080] (-1142.647) (-1141.030) -- 0:00:59 190000 -- (-1145.296) (-1140.369) (-1142.214) [-1142.232] * (-1145.261) (-1146.950) [-1144.339] (-1140.372) -- 0:00:59 Average standard deviation of split frequencies: 0.020300 190500 -- (-1150.992) [-1142.592] (-1141.306) (-1145.547) * (-1145.285) (-1141.591) (-1144.555) [-1144.059] -- 0:00:59 191000 -- (-1150.211) [-1144.175] (-1140.933) (-1142.768) * (-1144.736) (-1143.087) (-1140.710) [-1142.256] -- 0:00:59 191500 -- (-1140.626) [-1139.214] (-1141.212) (-1143.786) * (-1146.183) (-1143.350) [-1140.157] (-1145.451) -- 0:01:03 192000 -- [-1140.710] (-1142.337) (-1145.321) (-1142.220) * (-1143.499) [-1142.329] (-1139.356) (-1147.978) -- 0:01:03 192500 -- (-1143.459) (-1139.737) (-1144.474) [-1143.527] * [-1144.001] (-1142.924) (-1144.585) (-1147.286) -- 0:01:02 193000 -- (-1145.197) (-1143.578) [-1146.500] (-1145.899) * (-1144.188) (-1147.725) [-1144.842] (-1144.256) -- 0:01:02 193500 -- (-1143.314) [-1142.813] (-1148.813) (-1145.046) * (-1150.497) [-1138.161] (-1143.988) (-1142.590) -- 0:01:02 194000 -- (-1144.429) [-1141.111] (-1142.483) (-1141.461) * (-1144.529) (-1141.785) (-1145.793) [-1141.201] -- 0:01:02 194500 -- (-1141.879) (-1142.286) [-1142.808] (-1142.935) * [-1150.193] (-1143.477) (-1147.538) (-1141.762) -- 0:01:02 195000 -- (-1140.728) (-1140.033) (-1149.685) [-1141.023] * (-1147.379) [-1144.554] (-1150.330) (-1145.188) -- 0:01:01 Average standard deviation of split frequencies: 0.021646 195500 -- (-1145.419) (-1142.282) [-1140.184] (-1147.269) * (-1142.496) (-1146.387) [-1141.585] (-1143.309) -- 0:01:01 196000 -- [-1140.736] (-1142.941) (-1140.853) (-1145.302) * [-1142.829] (-1146.833) (-1145.800) (-1144.556) -- 0:01:01 196500 -- (-1145.412) (-1144.363) (-1141.432) [-1149.099] * (-1142.509) (-1142.522) (-1144.276) [-1146.152] -- 0:01:01 197000 -- (-1147.001) (-1141.814) [-1140.920] (-1141.380) * [-1143.911] (-1143.040) (-1140.752) (-1146.625) -- 0:01:01 197500 -- (-1146.720) (-1140.078) (-1140.378) [-1141.734] * [-1143.885] (-1146.768) (-1143.593) (-1150.052) -- 0:01:00 198000 -- (-1140.596) (-1142.225) [-1143.640] (-1142.700) * (-1146.167) (-1143.235) [-1141.690] (-1140.520) -- 0:01:00 198500 -- (-1141.545) (-1140.199) (-1142.411) [-1142.435] * (-1148.026) [-1141.583] (-1142.830) (-1140.534) -- 0:01:00 199000 -- (-1143.956) [-1139.604] (-1142.834) (-1147.045) * (-1148.691) (-1140.381) [-1147.398] (-1142.398) -- 0:01:00 199500 -- (-1144.854) [-1141.656] (-1142.513) (-1144.028) * [-1148.548] (-1143.518) (-1143.126) (-1142.706) -- 0:01:00 200000 -- (-1145.339) (-1139.481) [-1141.352] (-1146.295) * (-1144.483) [-1142.395] (-1145.472) (-1147.853) -- 0:00:59 Average standard deviation of split frequencies: 0.022187 200500 -- (-1146.256) [-1140.843] (-1140.714) (-1144.717) * (-1144.584) (-1141.539) [-1140.259] (-1142.791) -- 0:00:59 201000 -- [-1141.494] (-1145.490) (-1145.221) (-1142.636) * (-1144.530) [-1143.588] (-1140.632) (-1141.710) -- 0:00:59 201500 -- (-1144.993) (-1141.187) [-1141.681] (-1146.090) * (-1143.833) (-1139.328) [-1142.496] (-1143.113) -- 0:00:59 202000 -- (-1145.056) (-1140.360) [-1145.388] (-1143.834) * (-1143.047) (-1140.915) (-1149.956) [-1143.085] -- 0:00:59 202500 -- (-1145.214) (-1138.840) (-1142.384) [-1144.106] * (-1140.950) (-1144.347) (-1145.210) [-1141.511] -- 0:00:59 203000 -- (-1142.328) [-1142.057] (-1140.599) (-1144.011) * (-1142.033) [-1141.531] (-1143.598) (-1144.811) -- 0:00:58 203500 -- (-1144.153) (-1139.455) (-1142.829) [-1145.799] * (-1143.160) [-1143.892] (-1144.556) (-1152.062) -- 0:00:58 204000 -- (-1145.698) [-1140.626] (-1141.802) (-1145.565) * (-1144.467) (-1142.238) (-1147.027) [-1141.968] -- 0:00:58 204500 -- (-1140.822) (-1145.125) (-1142.550) [-1144.663] * [-1144.033] (-1141.441) (-1150.425) (-1140.777) -- 0:00:58 205000 -- [-1141.387] (-1145.400) (-1145.607) (-1146.103) * [-1141.985] (-1144.516) (-1142.785) (-1139.901) -- 0:00:58 Average standard deviation of split frequencies: 0.020354 205500 -- [-1142.559] (-1144.494) (-1141.385) (-1143.654) * [-1141.975] (-1144.476) (-1140.122) (-1140.967) -- 0:01:01 206000 -- (-1139.304) (-1142.743) (-1141.024) [-1143.197] * (-1143.308) (-1143.386) [-1145.708] (-1140.640) -- 0:01:01 206500 -- (-1141.065) (-1144.967) (-1144.067) [-1141.853] * (-1140.904) [-1141.618] (-1144.165) (-1140.844) -- 0:01:01 207000 -- [-1142.207] (-1141.255) (-1144.420) (-1145.468) * (-1143.081) (-1141.168) [-1138.846] (-1143.734) -- 0:01:01 207500 -- (-1141.997) [-1140.862] (-1144.015) (-1144.728) * (-1143.418) (-1143.734) [-1139.929] (-1145.488) -- 0:01:01 208000 -- (-1141.203) (-1144.834) (-1143.669) [-1143.638] * (-1147.525) (-1141.686) (-1139.833) [-1142.438] -- 0:01:00 208500 -- [-1144.075] (-1139.648) (-1140.689) (-1141.921) * (-1147.121) (-1139.012) (-1141.829) [-1140.231] -- 0:01:00 209000 -- (-1143.165) [-1142.227] (-1145.370) (-1144.056) * (-1147.351) (-1140.804) (-1141.416) [-1140.888] -- 0:01:00 209500 -- [-1144.679] (-1141.709) (-1143.614) (-1150.441) * (-1141.387) (-1142.679) (-1145.069) [-1140.000] -- 0:01:00 210000 -- [-1141.228] (-1145.185) (-1145.913) (-1142.289) * [-1140.574] (-1142.242) (-1144.607) (-1141.574) -- 0:01:00 Average standard deviation of split frequencies: 0.021788 210500 -- (-1141.465) (-1141.569) (-1141.251) [-1142.022] * [-1143.455] (-1139.923) (-1142.185) (-1144.442) -- 0:01:00 211000 -- (-1142.656) (-1147.809) (-1143.175) [-1140.895] * (-1142.360) (-1140.434) [-1150.541] (-1145.346) -- 0:00:59 211500 -- (-1140.331) (-1142.911) [-1141.962] (-1141.331) * (-1146.130) (-1141.399) [-1144.750] (-1145.565) -- 0:00:59 212000 -- (-1141.133) (-1140.753) [-1140.535] (-1140.922) * [-1141.527] (-1142.237) (-1139.718) (-1144.776) -- 0:00:59 212500 -- (-1143.534) (-1140.868) [-1141.922] (-1143.285) * (-1144.787) [-1142.490] (-1145.953) (-1144.244) -- 0:00:59 213000 -- (-1146.860) (-1140.082) (-1148.246) [-1140.534] * [-1143.072] (-1144.968) (-1143.611) (-1142.996) -- 0:00:59 213500 -- (-1141.969) [-1141.748] (-1146.727) (-1140.988) * (-1140.547) (-1143.849) [-1141.934] (-1139.961) -- 0:00:58 214000 -- (-1143.015) [-1141.635] (-1141.205) (-1140.636) * (-1141.889) (-1140.869) (-1145.478) [-1140.535] -- 0:00:58 214500 -- [-1140.108] (-1141.734) (-1138.960) (-1139.398) * [-1141.353] (-1142.095) (-1139.913) (-1144.106) -- 0:00:58 215000 -- (-1141.831) (-1141.338) (-1139.540) [-1139.704] * (-1149.748) [-1141.763] (-1143.090) (-1141.660) -- 0:00:58 Average standard deviation of split frequencies: 0.020926 215500 -- (-1141.344) [-1140.236] (-1144.966) (-1146.495) * (-1142.925) (-1141.317) (-1151.724) [-1142.524] -- 0:00:58 216000 -- (-1143.717) [-1143.522] (-1142.808) (-1144.321) * (-1143.160) (-1144.600) (-1145.818) [-1141.610] -- 0:00:58 216500 -- (-1146.172) (-1140.812) (-1141.211) [-1142.840] * (-1150.782) (-1144.324) (-1144.208) [-1143.088] -- 0:00:57 217000 -- (-1144.910) [-1140.259] (-1143.435) (-1142.617) * (-1140.206) (-1140.434) (-1145.892) [-1145.165] -- 0:00:57 217500 -- (-1145.008) (-1141.218) (-1142.597) [-1140.069] * [-1141.903] (-1141.658) (-1152.439) (-1144.440) -- 0:00:57 218000 -- (-1143.816) (-1142.220) (-1141.724) [-1142.038] * (-1142.165) (-1141.953) (-1145.411) [-1141.712] -- 0:00:57 218500 -- (-1144.448) (-1144.241) (-1144.257) [-1143.881] * (-1144.814) (-1144.620) [-1141.355] (-1143.168) -- 0:00:57 219000 -- (-1142.915) (-1141.845) (-1142.121) [-1143.243] * (-1143.365) (-1145.165) [-1142.029] (-1142.801) -- 0:01:00 219500 -- [-1143.356] (-1144.938) (-1146.289) (-1142.355) * (-1140.993) (-1142.991) [-1141.323] (-1143.618) -- 0:01:00 220000 -- [-1140.167] (-1142.399) (-1141.939) (-1145.042) * (-1141.420) (-1141.325) (-1141.975) [-1142.989] -- 0:01:00 Average standard deviation of split frequencies: 0.021991 220500 -- [-1139.962] (-1144.570) (-1147.879) (-1141.043) * (-1141.408) (-1145.362) [-1143.702] (-1142.038) -- 0:01:00 221000 -- (-1138.666) [-1142.369] (-1141.732) (-1140.832) * (-1142.501) (-1142.471) [-1142.271] (-1143.511) -- 0:00:59 221500 -- (-1142.666) (-1143.370) [-1142.034] (-1142.479) * (-1145.670) (-1144.392) (-1146.150) [-1142.607] -- 0:00:59 222000 -- (-1140.674) (-1147.993) [-1145.729] (-1149.005) * (-1142.807) [-1142.581] (-1141.848) (-1141.769) -- 0:00:59 222500 -- [-1142.391] (-1140.104) (-1143.520) (-1142.760) * (-1141.845) (-1141.749) [-1143.530] (-1145.158) -- 0:00:59 223000 -- (-1143.117) (-1143.589) (-1144.610) [-1140.608] * (-1141.835) (-1141.940) (-1143.100) [-1140.045] -- 0:00:59 223500 -- (-1140.323) [-1139.044] (-1147.905) (-1140.509) * [-1145.718] (-1146.560) (-1144.351) (-1143.555) -- 0:00:59 224000 -- (-1139.752) (-1141.796) [-1140.889] (-1140.110) * (-1143.794) (-1145.414) (-1145.507) [-1139.851] -- 0:00:58 224500 -- (-1140.591) [-1140.085] (-1140.065) (-1147.158) * (-1141.058) [-1144.772] (-1143.849) (-1139.369) -- 0:00:58 225000 -- [-1140.869] (-1145.997) (-1141.977) (-1144.046) * (-1144.899) (-1142.593) [-1144.677] (-1141.980) -- 0:00:58 Average standard deviation of split frequencies: 0.020974 225500 -- (-1139.835) (-1142.551) (-1142.421) [-1144.135] * (-1143.347) [-1143.315] (-1143.888) (-1146.346) -- 0:00:58 226000 -- [-1142.942] (-1139.635) (-1139.786) (-1143.246) * [-1147.795] (-1142.978) (-1144.274) (-1140.943) -- 0:00:58 226500 -- (-1143.674) [-1140.013] (-1141.243) (-1146.160) * (-1145.488) (-1141.428) (-1143.119) [-1141.336] -- 0:00:58 227000 -- (-1141.186) (-1139.788) [-1140.817] (-1147.502) * (-1144.360) (-1142.348) (-1142.242) [-1140.056] -- 0:00:57 227500 -- [-1141.384] (-1143.644) (-1141.767) (-1143.350) * (-1144.848) (-1143.054) [-1140.869] (-1141.986) -- 0:00:57 228000 -- (-1143.140) (-1145.073) (-1140.318) [-1143.980] * (-1143.550) (-1145.212) (-1145.734) [-1141.911] -- 0:00:57 228500 -- (-1139.920) (-1143.257) [-1142.189] (-1143.109) * (-1141.483) [-1140.876] (-1140.304) (-1144.081) -- 0:00:57 229000 -- (-1139.805) (-1141.823) (-1141.536) [-1143.806] * [-1141.551] (-1141.223) (-1144.872) (-1142.065) -- 0:00:57 229500 -- [-1139.031] (-1144.040) (-1144.452) (-1142.336) * (-1147.689) (-1142.670) [-1140.942] (-1141.642) -- 0:00:57 230000 -- (-1143.245) (-1141.878) (-1140.363) [-1144.155] * (-1144.106) [-1143.920] (-1142.714) (-1145.106) -- 0:00:56 Average standard deviation of split frequencies: 0.020891 230500 -- (-1142.002) (-1142.950) (-1143.777) [-1143.134] * (-1140.464) (-1141.727) (-1143.436) [-1140.454] -- 0:00:56 231000 -- (-1140.635) (-1144.995) (-1143.480) [-1141.474] * (-1139.758) [-1142.767] (-1141.419) (-1139.305) -- 0:00:56 231500 -- [-1142.284] (-1142.745) (-1149.684) (-1146.408) * (-1143.414) (-1144.741) (-1144.314) [-1142.314] -- 0:00:56 232000 -- (-1140.710) [-1139.797] (-1142.403) (-1146.893) * [-1141.585] (-1144.205) (-1143.539) (-1148.455) -- 0:00:56 232500 -- (-1142.132) (-1143.447) [-1142.801] (-1143.327) * (-1143.503) [-1141.132] (-1143.416) (-1145.319) -- 0:00:56 233000 -- (-1142.625) (-1145.619) [-1142.028] (-1145.286) * (-1140.132) (-1143.499) [-1140.989] (-1142.428) -- 0:00:59 233500 -- [-1141.150] (-1145.359) (-1142.140) (-1145.269) * [-1140.969] (-1142.918) (-1143.290) (-1141.211) -- 0:00:59 234000 -- (-1146.788) (-1146.816) [-1144.807] (-1140.789) * (-1141.518) (-1145.541) (-1145.254) [-1141.780] -- 0:00:58 234500 -- (-1146.934) [-1143.244] (-1146.092) (-1141.649) * [-1140.001] (-1141.339) (-1145.088) (-1146.821) -- 0:00:58 235000 -- [-1140.968] (-1143.974) (-1144.933) (-1144.462) * (-1143.314) (-1143.948) [-1143.869] (-1144.216) -- 0:00:58 Average standard deviation of split frequencies: 0.021306 235500 -- (-1141.457) (-1143.441) (-1143.209) [-1143.499] * (-1143.408) (-1145.250) (-1145.499) [-1140.630] -- 0:00:58 236000 -- [-1138.886] (-1142.782) (-1143.115) (-1143.860) * (-1139.895) (-1144.790) [-1144.026] (-1141.617) -- 0:00:58 236500 -- (-1141.294) [-1143.693] (-1143.144) (-1140.168) * (-1143.741) [-1146.527] (-1142.025) (-1143.318) -- 0:00:58 237000 -- (-1142.324) (-1144.727) (-1144.761) [-1142.515] * (-1141.510) (-1144.766) (-1141.906) [-1144.850] -- 0:00:57 237500 -- (-1143.822) (-1143.447) [-1142.538] (-1141.947) * (-1143.001) [-1146.453] (-1141.457) (-1146.321) -- 0:00:57 238000 -- (-1143.895) (-1146.083) (-1141.765) [-1141.461] * (-1144.045) (-1142.526) [-1141.371] (-1144.845) -- 0:00:57 238500 -- (-1143.845) (-1142.323) [-1142.477] (-1141.883) * [-1144.237] (-1150.747) (-1145.458) (-1144.645) -- 0:00:57 239000 -- (-1141.934) (-1143.922) [-1141.444] (-1141.687) * [-1144.906] (-1144.165) (-1142.343) (-1145.318) -- 0:00:57 239500 -- (-1141.142) (-1142.535) (-1139.901) [-1144.090] * (-1143.739) (-1146.082) [-1140.826] (-1143.518) -- 0:00:57 240000 -- [-1141.308] (-1142.045) (-1140.378) (-1141.898) * (-1142.721) (-1144.265) (-1141.642) [-1143.639] -- 0:00:56 Average standard deviation of split frequencies: 0.020240 240500 -- (-1143.288) (-1146.100) [-1140.092] (-1141.476) * [-1140.143] (-1143.646) (-1144.249) (-1141.599) -- 0:00:56 241000 -- [-1140.705] (-1144.661) (-1142.474) (-1146.345) * [-1140.977] (-1142.557) (-1142.936) (-1144.081) -- 0:00:56 241500 -- (-1143.829) (-1147.831) (-1142.114) [-1144.431] * (-1142.081) (-1141.605) [-1145.164] (-1143.367) -- 0:00:56 242000 -- (-1141.583) (-1147.602) (-1142.556) [-1143.583] * (-1139.971) (-1146.798) (-1143.788) [-1143.386] -- 0:00:56 242500 -- (-1141.851) [-1144.185] (-1141.656) (-1141.800) * [-1146.891] (-1142.799) (-1142.259) (-1144.481) -- 0:00:56 243000 -- (-1144.248) (-1145.728) (-1144.299) [-1142.811] * [-1141.836] (-1142.326) (-1140.911) (-1143.539) -- 0:00:56 243500 -- (-1146.183) (-1142.520) [-1143.449] (-1144.567) * [-1143.386] (-1144.395) (-1140.728) (-1142.778) -- 0:00:55 244000 -- (-1142.563) (-1146.729) [-1140.326] (-1143.961) * [-1140.335] (-1148.965) (-1144.630) (-1145.634) -- 0:00:55 244500 -- [-1140.566] (-1146.956) (-1142.401) (-1143.077) * (-1143.371) (-1146.035) [-1142.317] (-1142.114) -- 0:00:55 245000 -- (-1143.003) (-1144.007) (-1140.959) [-1141.533] * (-1141.004) (-1143.292) (-1146.851) [-1142.080] -- 0:00:55 Average standard deviation of split frequencies: 0.020121 245500 -- (-1140.146) [-1148.688] (-1142.123) (-1141.780) * [-1142.513] (-1147.376) (-1142.201) (-1144.610) -- 0:00:55 246000 -- (-1140.970) (-1142.555) (-1140.365) [-1146.272] * (-1140.854) (-1141.293) (-1141.735) [-1142.684] -- 0:00:55 246500 -- [-1142.039] (-1146.368) (-1142.984) (-1146.563) * [-1143.388] (-1146.767) (-1140.570) (-1143.141) -- 0:00:55 247000 -- (-1143.664) [-1142.048] (-1140.419) (-1145.080) * [-1143.270] (-1148.163) (-1143.063) (-1141.769) -- 0:00:57 247500 -- [-1142.971] (-1140.884) (-1141.878) (-1143.710) * (-1141.908) (-1142.998) [-1144.285] (-1142.614) -- 0:00:57 248000 -- (-1145.479) (-1143.123) [-1142.033] (-1144.969) * (-1143.235) (-1143.902) [-1144.663] (-1142.366) -- 0:00:57 248500 -- (-1141.478) (-1146.491) [-1143.237] (-1154.796) * [-1140.835] (-1145.891) (-1144.744) (-1142.252) -- 0:00:57 249000 -- [-1143.804] (-1143.783) (-1142.766) (-1141.870) * [-1142.295] (-1148.392) (-1142.683) (-1140.914) -- 0:00:57 249500 -- (-1140.212) (-1143.468) [-1139.339] (-1142.011) * (-1143.419) [-1141.894] (-1145.196) (-1147.434) -- 0:00:57 250000 -- (-1144.078) (-1144.224) [-1140.843] (-1142.590) * [-1146.315] (-1143.129) (-1146.954) (-1143.620) -- 0:00:57 Average standard deviation of split frequencies: 0.019015 250500 -- (-1140.744) (-1150.078) [-1140.580] (-1144.100) * [-1147.239] (-1143.238) (-1148.257) (-1141.397) -- 0:00:56 251000 -- [-1142.248] (-1144.056) (-1138.497) (-1141.223) * (-1145.147) (-1143.049) (-1144.231) [-1140.086] -- 0:00:56 251500 -- (-1144.976) [-1146.992] (-1142.150) (-1141.918) * (-1140.291) (-1148.275) (-1146.164) [-1140.357] -- 0:00:56 252000 -- (-1142.206) (-1143.655) [-1142.077] (-1142.369) * (-1145.375) (-1148.470) (-1144.662) [-1147.204] -- 0:00:56 252500 -- (-1144.929) (-1143.335) [-1142.615] (-1144.644) * (-1140.304) [-1142.749] (-1144.100) (-1144.353) -- 0:00:56 253000 -- (-1143.371) (-1142.437) [-1140.853] (-1140.226) * (-1142.047) [-1139.876] (-1146.747) (-1142.832) -- 0:00:56 253500 -- [-1141.044] (-1145.984) (-1141.070) (-1142.264) * (-1142.530) [-1140.167] (-1145.694) (-1141.827) -- 0:00:55 254000 -- [-1141.129] (-1141.943) (-1141.616) (-1145.887) * (-1142.010) (-1142.479) [-1149.123] (-1140.052) -- 0:00:55 254500 -- (-1142.390) (-1143.983) [-1142.372] (-1143.957) * (-1139.914) (-1143.110) (-1149.500) [-1146.680] -- 0:00:55 255000 -- [-1144.746] (-1145.224) (-1142.575) (-1147.228) * (-1142.333) (-1147.447) [-1146.229] (-1148.724) -- 0:00:55 Average standard deviation of split frequencies: 0.019437 255500 -- (-1144.128) (-1149.732) [-1140.558] (-1140.773) * (-1142.737) [-1141.598] (-1153.172) (-1144.492) -- 0:00:55 256000 -- (-1140.033) [-1147.544] (-1142.474) (-1143.524) * (-1141.792) [-1145.193] (-1149.769) (-1145.074) -- 0:00:55 256500 -- (-1153.230) (-1145.026) (-1142.542) [-1140.863] * (-1144.182) (-1141.690) [-1145.128] (-1148.249) -- 0:00:55 257000 -- (-1142.082) (-1145.273) [-1141.186] (-1141.261) * (-1141.075) (-1143.256) (-1147.001) [-1141.385] -- 0:00:54 257500 -- (-1142.695) [-1145.712] (-1146.750) (-1141.387) * (-1141.810) [-1141.554] (-1143.370) (-1145.487) -- 0:00:54 258000 -- (-1144.272) (-1143.226) (-1143.040) [-1142.363] * [-1141.547] (-1142.681) (-1140.927) (-1142.197) -- 0:00:54 258500 -- [-1141.791] (-1143.613) (-1146.450) (-1143.997) * (-1140.405) (-1142.306) (-1146.373) [-1143.909] -- 0:00:54 259000 -- (-1145.945) (-1142.372) (-1142.798) [-1144.173] * (-1140.916) [-1144.216] (-1142.788) (-1144.563) -- 0:00:54 259500 -- (-1146.229) (-1144.752) [-1143.078] (-1143.860) * [-1139.971] (-1145.313) (-1144.115) (-1144.139) -- 0:00:54 260000 -- (-1144.812) (-1143.168) [-1139.829] (-1140.650) * (-1144.792) (-1143.560) (-1142.525) [-1142.673] -- 0:00:54 Average standard deviation of split frequencies: 0.018486 260500 -- (-1144.313) [-1141.824] (-1144.372) (-1145.384) * (-1148.492) (-1146.532) [-1140.008] (-1143.133) -- 0:00:53 261000 -- (-1143.906) [-1144.306] (-1146.076) (-1147.706) * (-1142.025) (-1146.151) [-1143.209] (-1142.558) -- 0:00:53 261500 -- (-1146.050) (-1141.610) [-1141.420] (-1141.014) * [-1144.356] (-1147.468) (-1141.808) (-1143.012) -- 0:00:56 262000 -- [-1145.292] (-1144.203) (-1143.539) (-1142.860) * (-1143.490) [-1143.053] (-1140.399) (-1147.201) -- 0:00:56 262500 -- (-1147.181) [-1144.977] (-1140.262) (-1143.205) * (-1144.972) (-1144.188) [-1141.107] (-1143.544) -- 0:00:56 263000 -- [-1141.055] (-1144.060) (-1142.423) (-1142.261) * [-1142.209] (-1141.504) (-1144.093) (-1143.831) -- 0:00:56 263500 -- (-1140.667) (-1142.382) [-1144.060] (-1143.236) * (-1142.908) (-1141.555) (-1141.446) [-1140.419] -- 0:00:55 264000 -- (-1140.751) (-1142.018) [-1144.261] (-1142.856) * (-1140.846) (-1144.759) [-1141.743] (-1143.951) -- 0:00:55 264500 -- (-1141.272) (-1147.823) [-1143.872] (-1141.072) * (-1144.178) (-1144.296) [-1139.971] (-1141.945) -- 0:00:55 265000 -- (-1144.874) (-1149.180) [-1143.253] (-1142.160) * (-1140.622) (-1143.711) (-1141.248) [-1142.101] -- 0:00:55 Average standard deviation of split frequencies: 0.018017 265500 -- (-1139.633) (-1145.275) (-1143.265) [-1144.459] * (-1142.080) (-1139.912) [-1142.344] (-1146.153) -- 0:00:55 266000 -- [-1140.915] (-1147.971) (-1147.228) (-1148.425) * (-1141.895) (-1140.805) (-1146.404) [-1143.065] -- 0:00:55 266500 -- [-1140.547] (-1147.191) (-1143.398) (-1149.085) * [-1139.981] (-1141.835) (-1143.512) (-1147.619) -- 0:00:55 267000 -- [-1143.003] (-1143.948) (-1143.469) (-1145.697) * (-1141.346) (-1145.021) [-1140.186] (-1150.175) -- 0:00:54 267500 -- (-1140.591) [-1146.271] (-1143.790) (-1146.382) * (-1140.962) (-1141.717) [-1140.459] (-1147.824) -- 0:00:54 268000 -- [-1140.391] (-1142.894) (-1142.882) (-1144.084) * (-1145.130) (-1146.098) [-1147.054] (-1144.782) -- 0:00:54 268500 -- (-1144.419) (-1146.516) [-1141.890] (-1142.017) * (-1145.166) (-1145.947) (-1144.119) [-1143.124] -- 0:00:54 269000 -- (-1142.535) [-1143.227] (-1141.252) (-1140.706) * (-1140.458) (-1146.024) (-1145.398) [-1143.986] -- 0:00:54 269500 -- (-1140.106) [-1141.745] (-1142.223) (-1139.362) * (-1142.668) (-1142.876) [-1142.304] (-1141.778) -- 0:00:54 270000 -- [-1141.591] (-1143.748) (-1143.169) (-1140.235) * (-1138.856) (-1142.116) [-1142.788] (-1144.386) -- 0:00:54 Average standard deviation of split frequencies: 0.018384 270500 -- (-1144.739) [-1141.061] (-1141.741) (-1140.737) * [-1143.413] (-1144.940) (-1143.294) (-1143.663) -- 0:00:53 271000 -- (-1144.723) [-1140.661] (-1142.948) (-1144.838) * (-1139.968) [-1143.249] (-1141.479) (-1148.171) -- 0:00:53 271500 -- (-1140.319) [-1141.945] (-1144.743) (-1143.921) * (-1142.253) (-1142.130) [-1141.516] (-1145.128) -- 0:00:53 272000 -- (-1141.778) (-1145.031) (-1143.093) [-1140.741] * (-1141.994) [-1142.630] (-1139.273) (-1141.583) -- 0:00:53 272500 -- (-1145.866) (-1142.554) [-1140.150] (-1142.896) * [-1142.316] (-1143.729) (-1138.589) (-1141.287) -- 0:00:53 273000 -- [-1143.602] (-1139.583) (-1142.781) (-1140.201) * [-1143.353] (-1153.760) (-1141.079) (-1142.969) -- 0:00:53 273500 -- (-1144.156) (-1142.000) [-1145.999] (-1140.026) * [-1144.819] (-1144.022) (-1140.359) (-1149.606) -- 0:00:53 274000 -- (-1144.994) (-1140.772) (-1150.213) [-1140.363] * (-1147.643) (-1144.177) [-1139.658] (-1144.722) -- 0:00:52 274500 -- (-1145.282) (-1144.221) (-1143.485) [-1140.787] * (-1143.345) [-1142.214] (-1140.998) (-1141.400) -- 0:00:52 275000 -- (-1142.205) (-1141.550) (-1144.623) [-1141.131] * (-1142.977) [-1139.641] (-1143.228) (-1142.042) -- 0:00:52 Average standard deviation of split frequencies: 0.018219 275500 -- (-1145.275) (-1152.046) (-1142.947) [-1142.964] * [-1143.762] (-1141.946) (-1146.951) (-1143.400) -- 0:00:52 276000 -- [-1142.848] (-1145.957) (-1146.755) (-1141.262) * (-1150.116) (-1141.447) (-1139.684) [-1145.197] -- 0:00:55 276500 -- (-1143.511) (-1145.338) [-1142.662] (-1143.529) * (-1143.901) (-1141.806) (-1140.101) [-1145.930] -- 0:00:54 277000 -- (-1143.488) (-1142.391) [-1140.308] (-1144.558) * (-1146.207) (-1140.585) [-1144.033] (-1145.173) -- 0:00:54 277500 -- (-1144.142) (-1141.926) (-1142.856) [-1143.963] * [-1149.959] (-1142.364) (-1144.329) (-1144.589) -- 0:00:54 278000 -- (-1143.920) [-1142.500] (-1142.223) (-1143.655) * (-1141.712) [-1143.162] (-1141.828) (-1142.613) -- 0:00:54 278500 -- (-1143.399) (-1143.167) (-1141.316) [-1140.629] * (-1143.399) (-1146.310) (-1145.919) [-1141.006] -- 0:00:54 279000 -- (-1146.823) (-1146.297) (-1141.890) [-1141.263] * (-1141.443) (-1141.771) [-1144.587] (-1143.716) -- 0:00:54 279500 -- [-1144.117] (-1139.448) (-1144.498) (-1141.358) * (-1142.561) [-1139.466] (-1146.457) (-1146.129) -- 0:00:54 280000 -- [-1146.109] (-1140.690) (-1140.886) (-1144.653) * (-1144.676) [-1140.135] (-1147.663) (-1143.455) -- 0:00:53 Average standard deviation of split frequencies: 0.017857 280500 -- (-1143.787) (-1142.699) (-1144.233) [-1141.526] * (-1144.666) [-1141.272] (-1150.340) (-1142.575) -- 0:00:53 281000 -- (-1141.167) [-1144.003] (-1145.120) (-1145.565) * (-1141.373) (-1141.450) (-1140.074) [-1142.134] -- 0:00:53 281500 -- [-1139.430] (-1142.243) (-1145.461) (-1141.529) * (-1144.640) [-1141.297] (-1140.446) (-1143.868) -- 0:00:53 282000 -- (-1142.516) [-1141.111] (-1143.165) (-1143.877) * [-1143.490] (-1141.697) (-1141.798) (-1143.427) -- 0:00:53 282500 -- [-1139.667] (-1139.645) (-1142.533) (-1142.162) * (-1141.463) (-1141.339) [-1141.018] (-1143.909) -- 0:00:53 283000 -- (-1147.774) (-1143.802) [-1141.494] (-1140.733) * [-1145.257] (-1141.586) (-1140.331) (-1141.546) -- 0:00:53 283500 -- (-1145.685) (-1144.248) (-1139.968) [-1142.363] * (-1146.551) (-1143.199) (-1140.457) [-1143.660] -- 0:00:53 284000 -- [-1138.885] (-1141.744) (-1141.174) (-1143.953) * (-1152.866) (-1142.162) [-1142.660] (-1142.309) -- 0:00:52 284500 -- [-1139.865] (-1140.551) (-1145.005) (-1141.437) * (-1149.065) (-1142.002) (-1144.016) [-1138.718] -- 0:00:52 285000 -- (-1139.803) (-1140.220) (-1144.238) [-1142.972] * (-1145.375) (-1143.568) [-1140.250] (-1140.882) -- 0:00:52 Average standard deviation of split frequencies: 0.018680 285500 -- (-1141.774) (-1143.718) (-1141.885) [-1146.225] * (-1143.359) [-1140.901] (-1140.870) (-1141.748) -- 0:00:52 286000 -- (-1143.618) [-1139.240] (-1144.777) (-1139.858) * (-1144.060) (-1140.963) (-1140.656) [-1140.206] -- 0:00:52 286500 -- (-1142.267) (-1142.705) [-1143.934] (-1144.509) * (-1142.280) (-1140.011) (-1141.549) [-1140.307] -- 0:00:52 287000 -- (-1142.020) [-1142.059] (-1142.503) (-1140.597) * (-1142.025) [-1141.899] (-1143.347) (-1141.931) -- 0:00:52 287500 -- [-1144.272] (-1141.528) (-1143.269) (-1145.069) * (-1143.027) (-1141.730) [-1143.616] (-1140.500) -- 0:00:52 288000 -- (-1146.481) (-1140.511) (-1145.451) [-1142.638] * (-1142.772) (-1143.647) (-1140.465) [-1142.350] -- 0:00:51 288500 -- (-1145.531) (-1140.782) (-1142.053) [-1143.714] * (-1142.123) [-1141.194] (-1143.830) (-1142.106) -- 0:00:51 289000 -- (-1142.621) (-1141.693) [-1140.474] (-1144.152) * (-1143.321) (-1140.933) (-1141.732) [-1139.785] -- 0:00:51 289500 -- (-1146.376) [-1142.747] (-1140.631) (-1144.016) * (-1141.843) [-1142.012] (-1142.230) (-1140.492) -- 0:00:53 290000 -- [-1143.075] (-1142.290) (-1140.616) (-1145.177) * (-1140.553) (-1147.807) [-1141.415] (-1140.196) -- 0:00:53 Average standard deviation of split frequencies: 0.018471 290500 -- (-1143.828) (-1142.083) [-1139.988] (-1143.025) * (-1142.894) (-1141.806) (-1149.919) [-1143.526] -- 0:00:53 291000 -- (-1141.828) [-1140.981] (-1141.184) (-1146.686) * [-1141.693] (-1141.249) (-1143.836) (-1143.425) -- 0:00:53 291500 -- [-1141.771] (-1144.647) (-1140.685) (-1145.222) * (-1144.306) (-1141.212) [-1145.430] (-1143.321) -- 0:00:53 292000 -- [-1145.035] (-1145.058) (-1142.483) (-1148.174) * (-1144.249) [-1143.989] (-1148.500) (-1144.645) -- 0:00:53 292500 -- (-1145.806) (-1144.806) (-1146.648) [-1141.968] * (-1142.522) [-1143.049] (-1144.882) (-1140.542) -- 0:00:53 293000 -- (-1144.638) [-1142.329] (-1141.014) (-1139.592) * [-1142.886] (-1142.198) (-1142.399) (-1144.335) -- 0:00:53 293500 -- (-1139.514) (-1144.426) (-1143.433) [-1140.355] * (-1142.819) [-1140.137] (-1143.729) (-1142.427) -- 0:00:52 294000 -- (-1144.012) (-1144.467) [-1141.806] (-1140.791) * (-1142.836) (-1143.886) [-1143.859] (-1143.555) -- 0:00:52 294500 -- (-1140.588) (-1142.010) (-1144.584) [-1141.282] * (-1143.843) [-1142.954] (-1143.276) (-1144.228) -- 0:00:52 295000 -- (-1141.841) (-1142.098) (-1146.830) [-1143.537] * (-1141.995) (-1140.402) (-1148.440) [-1144.669] -- 0:00:52 Average standard deviation of split frequencies: 0.018757 295500 -- (-1143.579) [-1143.285] (-1142.867) (-1141.179) * (-1141.227) [-1140.447] (-1145.985) (-1141.902) -- 0:00:52 296000 -- (-1146.360) (-1141.857) [-1142.142] (-1141.934) * (-1140.892) (-1144.549) [-1143.917] (-1145.602) -- 0:00:52 296500 -- (-1142.445) (-1146.881) [-1143.143] (-1141.298) * (-1141.108) (-1144.187) [-1142.301] (-1142.826) -- 0:00:52 297000 -- [-1140.395] (-1141.087) (-1144.499) (-1140.320) * (-1143.678) (-1141.402) (-1142.923) [-1140.930] -- 0:00:52 297500 -- (-1143.815) [-1140.574] (-1144.113) (-1144.944) * [-1141.110] (-1139.932) (-1140.552) (-1141.498) -- 0:00:51 298000 -- (-1141.706) [-1142.503] (-1141.153) (-1145.126) * [-1142.209] (-1142.219) (-1141.373) (-1146.915) -- 0:00:51 298500 -- (-1143.188) (-1148.189) [-1139.493] (-1139.197) * (-1141.815) (-1140.858) [-1142.390] (-1142.065) -- 0:00:51 299000 -- (-1140.749) (-1143.076) [-1140.084] (-1142.193) * [-1140.559] (-1141.635) (-1143.803) (-1143.719) -- 0:00:51 299500 -- (-1143.162) (-1140.984) (-1139.172) [-1140.117] * [-1146.303] (-1144.118) (-1146.390) (-1143.077) -- 0:00:51 300000 -- (-1146.379) [-1142.400] (-1141.049) (-1142.604) * (-1144.671) (-1140.434) (-1142.836) [-1140.642] -- 0:00:51 Average standard deviation of split frequencies: 0.018118 300500 -- (-1140.527) [-1140.563] (-1140.594) (-1141.986) * [-1141.613] (-1141.412) (-1141.109) (-1141.627) -- 0:00:51 301000 -- (-1143.850) [-1142.978] (-1142.999) (-1143.592) * (-1144.020) [-1145.609] (-1141.390) (-1142.830) -- 0:00:51 301500 -- [-1141.187] (-1144.839) (-1141.250) (-1143.093) * (-1149.039) [-1140.525] (-1146.352) (-1145.728) -- 0:00:50 302000 -- (-1141.159) (-1142.820) [-1138.997] (-1140.016) * (-1145.493) [-1140.084] (-1144.066) (-1141.936) -- 0:00:50 302500 -- (-1141.286) (-1140.798) (-1140.357) [-1140.768] * [-1142.097] (-1141.252) (-1143.856) (-1141.692) -- 0:00:50 303000 -- [-1142.355] (-1144.237) (-1140.396) (-1142.333) * [-1143.386] (-1140.090) (-1142.801) (-1142.472) -- 0:00:50 303500 -- (-1140.830) [-1145.673] (-1141.120) (-1144.802) * (-1141.851) [-1141.044] (-1142.185) (-1146.141) -- 0:00:50 304000 -- (-1142.663) (-1146.780) [-1145.785] (-1140.813) * (-1142.275) [-1142.482] (-1144.566) (-1152.226) -- 0:00:52 304500 -- (-1141.100) (-1143.476) (-1141.505) [-1141.106] * (-1139.512) (-1142.597) [-1143.346] (-1149.832) -- 0:00:52 305000 -- (-1139.670) (-1144.377) [-1141.632] (-1145.297) * (-1139.505) [-1141.217] (-1145.089) (-1146.718) -- 0:00:52 Average standard deviation of split frequencies: 0.017545 305500 -- (-1141.378) (-1143.301) [-1141.911] (-1142.992) * (-1145.251) (-1141.691) [-1143.440] (-1142.025) -- 0:00:52 306000 -- (-1145.138) (-1148.432) [-1142.478] (-1140.992) * (-1146.904) (-1140.868) [-1143.867] (-1141.115) -- 0:00:52 306500 -- (-1143.497) (-1142.525) (-1141.087) [-1140.024] * [-1143.364] (-1142.028) (-1142.055) (-1143.609) -- 0:00:52 307000 -- (-1142.957) (-1147.113) [-1142.076] (-1145.068) * (-1140.314) (-1144.545) [-1140.850] (-1141.600) -- 0:00:51 307500 -- (-1144.024) [-1144.967] (-1143.524) (-1142.699) * (-1145.809) (-1142.243) [-1143.214] (-1140.130) -- 0:00:51 308000 -- (-1144.049) (-1144.041) [-1140.629] (-1145.974) * (-1142.788) (-1145.388) [-1141.015] (-1143.188) -- 0:00:51 308500 -- [-1144.978] (-1143.942) (-1144.946) (-1141.697) * [-1142.375] (-1142.452) (-1141.139) (-1140.327) -- 0:00:51 309000 -- [-1144.855] (-1145.216) (-1141.488) (-1143.161) * (-1142.281) [-1141.690] (-1144.111) (-1140.825) -- 0:00:51 309500 -- (-1142.456) (-1147.559) [-1138.941] (-1141.708) * (-1141.415) (-1144.364) (-1144.524) [-1139.983] -- 0:00:51 310000 -- (-1144.974) (-1143.245) (-1142.399) [-1144.257] * (-1145.876) (-1146.850) [-1146.860] (-1141.175) -- 0:00:51 Average standard deviation of split frequencies: 0.017619 310500 -- (-1147.586) (-1141.516) [-1141.949] (-1145.679) * [-1142.651] (-1140.963) (-1143.615) (-1142.729) -- 0:00:51 311000 -- (-1156.282) (-1143.550) (-1147.427) [-1142.290] * [-1152.339] (-1140.670) (-1143.005) (-1140.854) -- 0:00:50 311500 -- (-1140.979) (-1141.725) [-1141.216] (-1143.888) * (-1142.508) (-1140.787) (-1140.609) [-1140.577] -- 0:00:50 312000 -- (-1141.911) (-1144.507) [-1141.648] (-1141.104) * (-1149.830) [-1140.908] (-1142.773) (-1141.783) -- 0:00:50 312500 -- (-1141.545) (-1144.442) [-1140.256] (-1146.612) * (-1139.203) [-1141.946] (-1142.150) (-1145.901) -- 0:00:50 313000 -- (-1141.312) (-1142.292) [-1143.355] (-1144.649) * (-1139.619) [-1139.667] (-1146.496) (-1142.569) -- 0:00:50 313500 -- (-1142.815) (-1146.311) [-1144.146] (-1141.477) * (-1141.207) (-1141.253) [-1143.551] (-1145.472) -- 0:00:50 314000 -- (-1139.084) [-1146.032] (-1145.601) (-1144.490) * (-1141.500) [-1145.383] (-1142.838) (-1143.848) -- 0:00:50 314500 -- [-1140.287] (-1143.312) (-1149.924) (-1143.621) * (-1139.980) [-1143.480] (-1141.846) (-1141.156) -- 0:00:50 315000 -- [-1141.644] (-1142.970) (-1148.537) (-1145.362) * (-1140.806) (-1142.330) [-1140.886] (-1144.210) -- 0:00:50 Average standard deviation of split frequencies: 0.015415 315500 -- (-1140.824) (-1141.556) [-1147.113] (-1146.387) * [-1140.232] (-1141.091) (-1141.560) (-1141.308) -- 0:00:49 316000 -- (-1145.244) [-1144.044] (-1140.581) (-1147.216) * [-1139.473] (-1142.606) (-1142.786) (-1141.377) -- 0:00:49 316500 -- (-1144.772) (-1141.285) (-1143.063) [-1142.782] * [-1140.330] (-1143.722) (-1141.599) (-1146.471) -- 0:00:49 317000 -- (-1139.674) (-1142.980) (-1139.279) [-1142.226] * (-1141.565) [-1139.412] (-1143.810) (-1140.073) -- 0:00:49 317500 -- (-1143.601) (-1141.141) [-1140.389] (-1141.240) * (-1142.882) (-1142.196) (-1140.330) [-1141.382] -- 0:00:49 318000 -- (-1143.852) (-1145.185) (-1140.882) [-1142.014] * (-1145.085) (-1141.641) (-1143.761) [-1141.151] -- 0:00:49 318500 -- [-1144.184] (-1139.837) (-1142.760) (-1144.384) * (-1144.828) (-1144.964) [-1142.693] (-1149.381) -- 0:00:49 319000 -- (-1146.563) [-1142.584] (-1143.049) (-1142.350) * (-1145.258) (-1145.776) (-1145.275) [-1139.507] -- 0:00:51 319500 -- (-1141.901) (-1143.133) (-1141.356) [-1142.546] * (-1141.258) (-1144.921) (-1150.911) [-1142.790] -- 0:00:51 320000 -- (-1139.818) (-1145.902) [-1140.885] (-1147.487) * [-1140.751] (-1145.573) (-1147.768) (-1143.229) -- 0:00:50 Average standard deviation of split frequencies: 0.015629 320500 -- (-1142.044) [-1141.629] (-1142.136) (-1143.482) * [-1144.402] (-1143.658) (-1142.458) (-1143.472) -- 0:00:50 321000 -- (-1143.782) (-1143.405) [-1144.584] (-1143.995) * (-1142.146) (-1142.816) (-1144.767) [-1143.267] -- 0:00:50 321500 -- (-1142.473) (-1144.515) (-1144.833) [-1143.918] * (-1143.534) [-1142.423] (-1145.498) (-1143.218) -- 0:00:50 322000 -- (-1141.443) [-1143.238] (-1142.948) (-1141.466) * (-1140.896) (-1143.148) (-1143.657) [-1140.308] -- 0:00:50 322500 -- (-1140.208) (-1142.526) (-1144.593) [-1141.159] * (-1143.981) (-1144.182) [-1143.312] (-1146.370) -- 0:00:50 323000 -- (-1143.269) (-1140.551) [-1145.560] (-1144.866) * (-1142.882) [-1142.829] (-1142.533) (-1141.118) -- 0:00:50 323500 -- (-1144.306) [-1143.109] (-1140.773) (-1141.807) * [-1140.298] (-1144.818) (-1142.469) (-1146.565) -- 0:00:50 324000 -- (-1141.710) (-1144.366) [-1141.370] (-1143.519) * (-1140.042) [-1146.575] (-1141.440) (-1144.136) -- 0:00:50 324500 -- [-1144.848] (-1147.375) (-1140.664) (-1143.141) * (-1143.205) [-1144.709] (-1143.551) (-1141.425) -- 0:00:49 325000 -- (-1143.546) [-1145.128] (-1141.168) (-1147.184) * [-1140.745] (-1144.561) (-1152.708) (-1142.009) -- 0:00:49 Average standard deviation of split frequencies: 0.015982 325500 -- [-1143.607] (-1142.085) (-1145.252) (-1145.156) * (-1140.865) [-1143.693] (-1152.870) (-1141.530) -- 0:00:49 326000 -- (-1144.506) [-1145.210] (-1142.344) (-1140.464) * (-1144.973) [-1143.121] (-1140.416) (-1139.277) -- 0:00:49 326500 -- [-1145.158] (-1142.441) (-1142.575) (-1141.114) * (-1141.744) [-1140.950] (-1142.178) (-1140.838) -- 0:00:49 327000 -- (-1145.790) [-1142.950] (-1141.936) (-1145.967) * (-1142.026) [-1143.059] (-1141.194) (-1139.958) -- 0:00:49 327500 -- (-1146.590) (-1142.101) (-1140.855) [-1144.203] * (-1140.772) (-1141.144) [-1143.721] (-1143.880) -- 0:00:49 328000 -- (-1145.466) (-1139.552) [-1143.728] (-1146.902) * (-1142.429) [-1140.805] (-1142.426) (-1141.031) -- 0:00:49 328500 -- [-1145.472] (-1143.737) (-1144.231) (-1149.906) * (-1143.064) (-1147.202) (-1142.278) [-1140.496] -- 0:00:49 329000 -- (-1146.677) (-1144.773) (-1150.489) [-1143.088] * (-1146.608) (-1146.241) (-1141.730) [-1141.395] -- 0:00:48 329500 -- (-1144.493) (-1144.825) [-1143.208] (-1148.063) * (-1143.525) (-1143.505) [-1143.312] (-1144.008) -- 0:00:48 330000 -- (-1143.723) (-1143.609) [-1140.698] (-1142.813) * (-1139.856) (-1144.308) (-1144.142) [-1142.609] -- 0:00:48 Average standard deviation of split frequencies: 0.016432 330500 -- (-1144.105) (-1142.966) (-1143.481) [-1143.992] * (-1141.864) (-1142.209) [-1141.263] (-1144.772) -- 0:00:48 331000 -- (-1145.118) (-1145.645) [-1142.211] (-1140.116) * (-1141.886) (-1142.249) (-1140.997) [-1142.321] -- 0:00:48 331500 -- (-1139.599) (-1146.320) [-1141.190] (-1141.431) * [-1140.063] (-1142.144) (-1141.714) (-1142.971) -- 0:00:48 332000 -- (-1142.195) (-1140.814) [-1142.210] (-1141.105) * (-1143.859) (-1143.147) [-1146.874] (-1145.709) -- 0:00:48 332500 -- (-1141.872) (-1144.399) (-1144.481) [-1145.579] * (-1141.841) [-1142.122] (-1145.132) (-1144.586) -- 0:00:48 333000 -- [-1141.055] (-1143.462) (-1142.022) (-1144.211) * (-1139.983) (-1144.337) (-1142.444) [-1140.539] -- 0:00:48 333500 -- (-1141.721) (-1148.202) (-1144.482) [-1141.337] * (-1140.142) (-1145.290) (-1141.521) [-1141.494] -- 0:00:47 334000 -- (-1143.837) (-1147.180) (-1139.917) [-1139.394] * (-1145.296) (-1144.882) (-1142.287) [-1141.456] -- 0:00:49 334500 -- (-1145.166) (-1145.143) (-1139.919) [-1140.955] * (-1140.175) (-1142.619) (-1141.133) [-1143.354] -- 0:00:49 335000 -- [-1141.286] (-1144.350) (-1147.242) (-1146.407) * [-1142.749] (-1143.771) (-1141.085) (-1141.756) -- 0:00:49 Average standard deviation of split frequencies: 0.016688 335500 -- [-1142.417] (-1146.029) (-1140.502) (-1146.501) * (-1146.048) (-1145.272) (-1143.885) [-1143.740] -- 0:00:49 336000 -- [-1141.765] (-1145.002) (-1140.489) (-1141.682) * [-1140.057] (-1142.306) (-1143.639) (-1141.750) -- 0:00:49 336500 -- (-1141.657) (-1140.933) (-1145.348) [-1140.193] * [-1141.038] (-1144.397) (-1142.748) (-1141.894) -- 0:00:49 337000 -- (-1140.439) (-1145.175) (-1141.392) [-1139.394] * (-1142.574) (-1144.160) [-1144.250] (-1144.574) -- 0:00:49 337500 -- (-1142.425) (-1144.646) [-1141.815] (-1139.512) * (-1149.152) [-1143.458] (-1143.945) (-1142.313) -- 0:00:49 338000 -- (-1143.497) [-1144.155] (-1139.759) (-1139.883) * (-1143.698) (-1142.341) [-1145.441] (-1147.092) -- 0:00:48 338500 -- (-1143.758) [-1141.284] (-1141.061) (-1141.288) * (-1142.552) (-1144.021) [-1145.046] (-1142.581) -- 0:00:48 339000 -- (-1140.346) (-1141.449) (-1145.776) [-1141.607] * (-1141.207) (-1143.450) [-1139.980] (-1145.191) -- 0:00:48 339500 -- [-1144.467] (-1143.186) (-1141.975) (-1142.014) * (-1145.220) (-1145.823) (-1143.862) [-1145.463] -- 0:00:48 340000 -- (-1140.969) (-1144.423) (-1143.126) [-1142.335] * (-1146.936) (-1144.646) [-1143.652] (-1141.070) -- 0:00:48 Average standard deviation of split frequencies: 0.016280 340500 -- [-1141.693] (-1141.314) (-1141.456) (-1142.409) * (-1146.167) (-1146.220) (-1140.971) [-1142.847] -- 0:00:48 341000 -- [-1140.782] (-1143.164) (-1143.746) (-1144.683) * (-1146.706) [-1142.639] (-1141.388) (-1144.138) -- 0:00:48 341500 -- (-1141.577) [-1142.601] (-1143.890) (-1141.053) * (-1143.233) (-1145.038) [-1146.606] (-1143.275) -- 0:00:48 342000 -- (-1145.381) [-1141.355] (-1143.280) (-1141.707) * (-1147.440) [-1143.010] (-1145.952) (-1140.470) -- 0:00:48 342500 -- (-1139.836) (-1145.403) (-1144.716) [-1140.253] * (-1145.639) (-1143.800) (-1148.125) [-1143.799] -- 0:00:47 343000 -- [-1140.111] (-1143.711) (-1143.348) (-1140.116) * (-1143.481) (-1146.962) (-1141.060) [-1143.845] -- 0:00:47 343500 -- (-1142.775) (-1144.535) (-1142.186) [-1142.026] * (-1144.350) (-1141.869) (-1141.875) [-1143.388] -- 0:00:47 344000 -- (-1144.442) (-1146.372) [-1143.353] (-1141.071) * [-1144.271] (-1145.822) (-1139.752) (-1140.686) -- 0:00:47 344500 -- (-1143.233) (-1143.254) [-1145.866] (-1141.826) * [-1146.093] (-1142.629) (-1141.349) (-1144.118) -- 0:00:47 345000 -- (-1140.168) [-1141.009] (-1143.539) (-1140.555) * (-1142.389) (-1145.078) [-1142.581] (-1145.037) -- 0:00:47 Average standard deviation of split frequencies: 0.015895 345500 -- [-1141.635] (-1140.727) (-1145.751) (-1143.840) * [-1145.054] (-1143.212) (-1141.592) (-1140.303) -- 0:00:47 346000 -- (-1145.217) (-1143.008) (-1147.498) [-1142.832] * (-1142.058) [-1140.691] (-1143.435) (-1140.052) -- 0:00:47 346500 -- [-1143.035] (-1144.312) (-1141.908) (-1144.971) * (-1145.990) (-1143.048) (-1143.737) [-1143.534] -- 0:00:47 347000 -- [-1143.611] (-1142.543) (-1140.738) (-1143.336) * [-1140.325] (-1142.143) (-1144.333) (-1143.601) -- 0:00:47 347500 -- (-1140.942) (-1145.105) (-1142.375) [-1143.405] * (-1148.674) (-1142.575) [-1140.057] (-1143.604) -- 0:00:46 348000 -- [-1138.477] (-1144.503) (-1141.910) (-1140.026) * (-1140.880) [-1145.112] (-1143.096) (-1144.498) -- 0:00:46 348500 -- (-1141.775) (-1143.551) [-1141.422] (-1141.145) * [-1143.066] (-1145.919) (-1140.425) (-1145.724) -- 0:00:46 349000 -- [-1141.965] (-1143.889) (-1145.332) (-1141.315) * (-1143.378) (-1140.950) [-1140.798] (-1143.962) -- 0:00:48 349500 -- (-1141.007) [-1138.789] (-1144.292) (-1143.738) * (-1145.555) (-1142.176) (-1141.986) [-1144.359] -- 0:00:48 350000 -- (-1140.269) (-1141.657) (-1143.388) [-1143.610] * (-1139.746) (-1143.259) [-1145.400] (-1144.106) -- 0:00:48 Average standard deviation of split frequencies: 0.016281 350500 -- (-1141.108) [-1140.741] (-1142.871) (-1145.098) * (-1146.960) (-1141.637) [-1146.328] (-1144.073) -- 0:00:48 351000 -- (-1149.126) [-1141.463] (-1143.813) (-1141.885) * [-1144.653] (-1141.097) (-1143.123) (-1142.026) -- 0:00:48 351500 -- (-1149.212) [-1140.547] (-1143.751) (-1139.581) * [-1144.031] (-1142.567) (-1142.169) (-1144.464) -- 0:00:47 352000 -- (-1144.570) (-1141.857) [-1143.691] (-1142.222) * [-1141.587] (-1144.008) (-1141.362) (-1143.726) -- 0:00:47 352500 -- (-1140.434) (-1142.041) (-1141.073) [-1139.341] * (-1143.464) (-1145.158) [-1142.763] (-1142.025) -- 0:00:47 353000 -- (-1141.022) (-1141.131) (-1143.226) [-1141.474] * (-1142.326) [-1141.754] (-1145.267) (-1146.269) -- 0:00:47 353500 -- (-1140.622) (-1139.236) [-1143.812] (-1146.061) * (-1144.562) (-1141.364) [-1141.931] (-1142.602) -- 0:00:47 354000 -- (-1145.268) (-1140.202) [-1142.491] (-1145.883) * (-1145.859) (-1140.951) (-1142.518) [-1140.466] -- 0:00:47 354500 -- [-1140.262] (-1141.198) (-1142.805) (-1142.429) * [-1143.060] (-1142.007) (-1142.673) (-1139.664) -- 0:00:47 355000 -- (-1144.511) (-1141.617) (-1144.632) [-1141.099] * (-1144.531) (-1142.864) (-1145.152) [-1140.931] -- 0:00:47 Average standard deviation of split frequencies: 0.015656 355500 -- (-1143.472) (-1142.332) [-1143.134] (-1142.841) * (-1142.803) [-1140.616] (-1141.357) (-1140.160) -- 0:00:47 356000 -- (-1142.654) (-1141.196) (-1143.595) [-1142.946] * (-1141.760) (-1142.460) [-1143.014] (-1141.097) -- 0:00:47 356500 -- (-1143.561) (-1144.717) (-1156.729) [-1141.863] * (-1142.448) (-1144.504) [-1148.947] (-1143.603) -- 0:00:46 357000 -- [-1140.790] (-1146.517) (-1148.565) (-1141.897) * (-1141.691) [-1142.479] (-1144.284) (-1147.704) -- 0:00:46 357500 -- (-1143.086) (-1144.165) (-1141.296) [-1143.540] * (-1144.443) [-1141.687] (-1143.048) (-1143.114) -- 0:00:46 358000 -- (-1147.067) (-1143.638) (-1140.478) [-1145.511] * (-1144.787) (-1142.363) (-1141.952) [-1143.609] -- 0:00:46 358500 -- (-1141.278) (-1138.909) (-1144.608) [-1145.895] * (-1142.287) [-1142.449] (-1142.530) (-1142.034) -- 0:00:46 359000 -- (-1141.335) (-1142.479) (-1143.774) [-1141.768] * (-1142.924) (-1142.118) (-1141.436) [-1143.239] -- 0:00:46 359500 -- (-1141.784) [-1140.675] (-1141.392) (-1143.663) * (-1140.808) [-1143.579] (-1146.505) (-1145.507) -- 0:00:46 360000 -- (-1141.260) (-1142.069) [-1142.069] (-1141.122) * [-1140.912] (-1149.284) (-1145.545) (-1139.825) -- 0:00:46 Average standard deviation of split frequencies: 0.016223 360500 -- (-1140.737) (-1141.220) (-1143.499) [-1142.719] * (-1149.361) (-1145.629) [-1143.898] (-1147.644) -- 0:00:46 361000 -- [-1141.129] (-1141.178) (-1141.257) (-1147.762) * [-1142.459] (-1144.076) (-1141.520) (-1142.359) -- 0:00:46 361500 -- [-1141.147] (-1142.490) (-1146.137) (-1145.842) * (-1148.349) [-1140.001] (-1143.357) (-1141.824) -- 0:00:45 362000 -- (-1142.857) [-1143.468] (-1142.425) (-1145.103) * [-1147.074] (-1145.970) (-1147.755) (-1139.824) -- 0:00:45 362500 -- (-1140.450) (-1141.013) [-1143.115] (-1144.694) * (-1143.909) (-1141.017) (-1144.047) [-1139.271] -- 0:00:45 363000 -- (-1144.276) (-1140.728) (-1146.326) [-1142.918] * (-1142.669) [-1145.194] (-1144.048) (-1142.969) -- 0:00:45 363500 -- (-1141.394) [-1142.788] (-1145.755) (-1141.795) * (-1146.093) [-1143.055] (-1149.380) (-1141.486) -- 0:00:45 364000 -- (-1142.093) (-1141.004) (-1145.059) [-1140.880] * (-1147.039) (-1142.544) (-1145.841) [-1141.720] -- 0:00:45 364500 -- (-1141.864) [-1144.867] (-1144.273) (-1140.947) * (-1145.605) (-1142.400) [-1143.156] (-1140.322) -- 0:00:47 365000 -- (-1143.751) (-1142.067) [-1139.866] (-1140.771) * (-1142.998) (-1141.627) [-1144.970] (-1146.019) -- 0:00:46 Average standard deviation of split frequencies: 0.015742 365500 -- (-1146.111) [-1142.252] (-1143.312) (-1142.123) * (-1143.550) [-1142.054] (-1147.512) (-1142.854) -- 0:00:46 366000 -- [-1141.594] (-1140.339) (-1144.324) (-1140.659) * (-1143.477) [-1139.461] (-1145.802) (-1143.991) -- 0:00:46 366500 -- (-1142.535) (-1140.901) (-1143.983) [-1140.799] * (-1142.299) (-1140.033) [-1144.027] (-1141.809) -- 0:00:46 367000 -- (-1141.830) (-1140.646) (-1149.059) [-1142.875] * (-1144.463) [-1143.824] (-1141.526) (-1143.438) -- 0:00:46 367500 -- (-1142.262) [-1145.587] (-1141.542) (-1142.361) * [-1143.872] (-1141.863) (-1142.203) (-1142.932) -- 0:00:46 368000 -- [-1142.764] (-1141.597) (-1144.281) (-1140.596) * (-1146.347) [-1142.973] (-1141.358) (-1143.394) -- 0:00:46 368500 -- (-1143.892) [-1141.267] (-1147.790) (-1143.799) * [-1143.347] (-1141.132) (-1140.902) (-1140.834) -- 0:00:46 369000 -- (-1144.486) (-1142.037) [-1142.809] (-1146.156) * [-1143.260] (-1142.238) (-1142.175) (-1140.018) -- 0:00:46 369500 -- (-1145.525) (-1141.531) (-1144.106) [-1142.316] * (-1144.733) (-1141.341) [-1141.495] (-1139.761) -- 0:00:46 370000 -- (-1145.067) (-1143.967) (-1142.061) [-1141.250] * (-1146.567) (-1142.268) [-1145.246] (-1140.704) -- 0:00:45 Average standard deviation of split frequencies: 0.015897 370500 -- [-1146.582] (-1144.867) (-1142.877) (-1143.103) * [-1143.239] (-1139.415) (-1141.792) (-1148.112) -- 0:00:45 371000 -- [-1144.268] (-1140.071) (-1144.426) (-1140.416) * (-1144.725) [-1139.892] (-1143.784) (-1147.284) -- 0:00:45 371500 -- [-1142.691] (-1140.184) (-1143.252) (-1141.693) * (-1141.866) [-1141.884] (-1146.328) (-1147.429) -- 0:00:45 372000 -- (-1143.045) (-1141.349) (-1141.181) [-1143.159] * (-1140.748) (-1142.774) (-1148.550) [-1141.093] -- 0:00:45 372500 -- (-1145.042) (-1146.375) [-1140.670] (-1145.602) * [-1142.379] (-1145.472) (-1146.284) (-1142.810) -- 0:00:45 373000 -- [-1142.719] (-1144.627) (-1141.122) (-1143.406) * [-1144.894] (-1143.854) (-1146.154) (-1141.929) -- 0:00:45 373500 -- [-1139.566] (-1141.649) (-1142.468) (-1141.958) * (-1139.750) [-1140.875] (-1146.410) (-1141.277) -- 0:00:45 374000 -- (-1143.944) [-1142.318] (-1148.797) (-1140.986) * [-1140.796] (-1146.584) (-1141.325) (-1144.793) -- 0:00:45 374500 -- [-1141.750] (-1143.755) (-1145.376) (-1139.829) * [-1141.231] (-1143.200) (-1144.356) (-1140.372) -- 0:00:45 375000 -- [-1142.559] (-1142.639) (-1142.842) (-1142.916) * (-1142.094) (-1141.313) (-1146.844) [-1142.967] -- 0:00:45 Average standard deviation of split frequencies: 0.016594 375500 -- (-1147.002) (-1142.216) [-1142.930] (-1144.719) * (-1141.221) (-1146.837) [-1148.039] (-1140.917) -- 0:00:44 376000 -- (-1147.871) [-1145.655] (-1142.804) (-1140.881) * [-1141.046] (-1144.257) (-1144.868) (-1141.720) -- 0:00:44 376500 -- (-1144.033) (-1143.579) [-1144.716] (-1143.805) * (-1143.654) (-1143.403) (-1147.474) [-1142.399] -- 0:00:44 377000 -- (-1145.770) (-1145.729) (-1145.189) [-1140.828] * (-1144.954) (-1143.661) (-1145.438) [-1142.602] -- 0:00:44 377500 -- (-1141.309) (-1143.891) (-1138.934) [-1142.553] * (-1143.694) [-1143.998] (-1143.795) (-1142.687) -- 0:00:44 378000 -- (-1143.340) [-1142.462] (-1143.516) (-1141.740) * [-1140.809] (-1142.144) (-1143.625) (-1141.622) -- 0:00:44 378500 -- (-1145.894) [-1141.175] (-1142.938) (-1142.606) * [-1146.656] (-1140.830) (-1140.550) (-1145.849) -- 0:00:45 379000 -- (-1141.212) (-1147.124) [-1141.548] (-1145.330) * [-1143.041] (-1145.755) (-1142.794) (-1140.157) -- 0:00:45 379500 -- (-1145.082) (-1147.437) (-1142.103) [-1141.382] * [-1143.563] (-1142.594) (-1144.048) (-1140.789) -- 0:00:45 380000 -- (-1145.003) [-1147.455] (-1146.221) (-1141.181) * (-1140.126) (-1143.716) (-1141.759) [-1142.370] -- 0:00:45 Average standard deviation of split frequencies: 0.016172 380500 -- (-1145.863) (-1147.443) [-1145.242] (-1144.408) * (-1146.921) (-1143.911) [-1142.468] (-1143.115) -- 0:00:45 381000 -- (-1145.206) (-1148.986) [-1142.636] (-1145.107) * (-1149.186) [-1140.278] (-1140.550) (-1143.571) -- 0:00:45 381500 -- (-1140.562) (-1145.562) [-1143.794] (-1145.409) * (-1142.537) (-1141.108) (-1142.745) [-1143.241] -- 0:00:45 382000 -- (-1146.951) [-1142.258] (-1142.964) (-1145.214) * (-1144.465) (-1140.953) (-1141.675) [-1142.885] -- 0:00:45 382500 -- (-1143.216) [-1141.652] (-1141.167) (-1148.312) * (-1146.818) [-1141.069] (-1143.275) (-1144.052) -- 0:00:45 383000 -- (-1146.284) (-1142.800) [-1144.797] (-1142.182) * (-1144.280) (-1141.606) [-1138.830] (-1143.899) -- 0:00:45 383500 -- (-1140.853) (-1142.299) [-1141.614] (-1143.770) * (-1147.556) (-1141.035) [-1141.455] (-1145.267) -- 0:00:45 384000 -- (-1142.307) (-1142.762) [-1141.738] (-1144.439) * (-1147.095) [-1139.965] (-1144.980) (-1143.687) -- 0:00:44 384500 -- (-1143.856) [-1140.592] (-1149.652) (-1142.706) * (-1146.192) (-1142.659) (-1142.737) [-1141.956] -- 0:00:44 385000 -- [-1142.250] (-1144.433) (-1139.875) (-1146.473) * (-1143.852) (-1141.885) (-1141.546) [-1143.616] -- 0:00:44 Average standard deviation of split frequencies: 0.016738 385500 -- [-1140.481] (-1142.722) (-1142.809) (-1141.584) * (-1142.579) (-1143.314) [-1144.083] (-1142.378) -- 0:00:44 386000 -- (-1141.999) [-1141.158] (-1141.598) (-1142.131) * (-1141.242) (-1146.454) [-1140.614] (-1144.297) -- 0:00:44 386500 -- (-1142.817) (-1143.822) [-1143.313] (-1143.862) * (-1145.183) (-1145.259) (-1141.386) [-1143.080] -- 0:00:44 387000 -- (-1142.372) [-1143.139] (-1143.005) (-1145.738) * (-1142.635) [-1142.151] (-1140.847) (-1144.423) -- 0:00:44 387500 -- (-1140.682) (-1142.074) (-1143.568) [-1140.152] * (-1143.954) (-1145.822) [-1142.695] (-1143.742) -- 0:00:44 388000 -- (-1142.426) [-1143.245] (-1144.087) (-1141.324) * (-1143.261) (-1142.777) [-1141.702] (-1147.429) -- 0:00:44 388500 -- (-1143.811) [-1147.229] (-1145.076) (-1142.311) * (-1145.243) (-1147.085) (-1143.605) [-1141.866] -- 0:00:44 389000 -- (-1145.258) [-1142.432] (-1142.083) (-1142.833) * (-1143.615) [-1140.224] (-1141.419) (-1146.962) -- 0:00:43 389500 -- (-1141.791) (-1144.007) [-1144.694] (-1146.342) * (-1142.612) [-1141.271] (-1147.155) (-1142.392) -- 0:00:43 390000 -- (-1141.819) (-1142.171) (-1142.731) [-1142.271] * (-1141.662) (-1141.699) [-1140.657] (-1143.754) -- 0:00:43 Average standard deviation of split frequencies: 0.015829 390500 -- (-1145.701) [-1139.848] (-1144.327) (-1143.444) * (-1143.995) [-1143.071] (-1143.439) (-1144.645) -- 0:00:43 391000 -- (-1142.567) [-1139.946] (-1143.856) (-1140.686) * (-1141.691) (-1143.925) [-1142.765] (-1144.799) -- 0:00:43 391500 -- [-1146.832] (-1142.758) (-1144.444) (-1143.334) * (-1141.669) (-1139.014) [-1142.729] (-1140.199) -- 0:00:43 392000 -- (-1142.294) (-1141.327) (-1143.599) [-1145.317] * (-1143.223) [-1142.598] (-1140.289) (-1141.960) -- 0:00:44 392500 -- (-1143.835) (-1145.048) [-1144.609] (-1141.113) * (-1144.334) [-1142.553] (-1140.815) (-1140.439) -- 0:00:44 393000 -- [-1141.489] (-1146.794) (-1147.407) (-1142.774) * (-1142.534) [-1140.969] (-1144.009) (-1143.088) -- 0:00:44 393500 -- (-1142.623) (-1145.850) (-1141.096) [-1142.479] * [-1143.189] (-1146.360) (-1140.402) (-1143.774) -- 0:00:44 394000 -- [-1144.896] (-1146.002) (-1142.458) (-1147.583) * (-1142.492) (-1144.063) (-1142.800) [-1140.193] -- 0:00:44 394500 -- (-1140.414) (-1143.044) (-1145.913) [-1143.556] * (-1145.627) [-1140.092] (-1144.213) (-1145.259) -- 0:00:44 395000 -- [-1140.677] (-1142.984) (-1144.529) (-1142.874) * (-1140.440) (-1140.227) [-1143.940] (-1142.759) -- 0:00:44 Average standard deviation of split frequencies: 0.016456 395500 -- (-1140.081) [-1143.679] (-1144.284) (-1147.341) * (-1142.877) (-1143.603) [-1142.241] (-1142.526) -- 0:00:44 396000 -- [-1141.193] (-1142.598) (-1142.909) (-1141.016) * (-1144.324) [-1140.926] (-1145.342) (-1139.446) -- 0:00:44 396500 -- [-1139.891] (-1143.162) (-1145.420) (-1140.537) * (-1142.851) (-1141.472) (-1143.019) [-1141.786] -- 0:00:44 397000 -- (-1144.062) [-1140.995] (-1142.577) (-1144.660) * (-1146.254) (-1142.223) (-1141.458) [-1141.060] -- 0:00:44 397500 -- [-1143.056] (-1145.330) (-1147.227) (-1141.637) * (-1144.920) (-1139.928) [-1140.110] (-1144.045) -- 0:00:43 398000 -- (-1144.423) (-1143.474) (-1145.989) [-1142.344] * (-1144.409) (-1141.063) [-1140.998] (-1142.400) -- 0:00:43 398500 -- (-1140.390) (-1143.513) [-1140.163] (-1140.875) * (-1144.113) (-1141.942) [-1141.945] (-1142.391) -- 0:00:43 399000 -- [-1139.451] (-1141.179) (-1142.971) (-1144.150) * (-1141.367) (-1143.753) [-1139.763] (-1146.665) -- 0:00:43 399500 -- (-1142.321) (-1145.990) (-1147.400) [-1140.957] * (-1142.735) (-1144.411) [-1142.815] (-1146.967) -- 0:00:43 400000 -- (-1143.840) (-1147.019) (-1140.327) [-1141.578] * (-1146.690) (-1144.152) [-1141.383] (-1141.292) -- 0:00:43 Average standard deviation of split frequencies: 0.015503 400500 -- (-1141.945) (-1152.121) (-1144.952) [-1142.523] * (-1141.861) (-1141.124) (-1145.312) [-1141.896] -- 0:00:43 401000 -- (-1140.535) [-1146.859] (-1143.648) (-1143.427) * (-1141.755) (-1140.394) [-1144.184] (-1143.590) -- 0:00:43 401500 -- (-1140.465) (-1145.193) (-1144.390) [-1141.206] * (-1143.127) (-1141.641) [-1141.928] (-1144.698) -- 0:00:43 402000 -- (-1141.082) (-1145.887) [-1139.843] (-1143.134) * [-1141.667] (-1144.728) (-1140.654) (-1140.906) -- 0:00:43 402500 -- (-1141.121) [-1143.968] (-1140.548) (-1146.422) * (-1141.009) [-1144.226] (-1141.334) (-1139.357) -- 0:00:43 403000 -- (-1141.455) [-1150.209] (-1140.185) (-1142.329) * [-1143.158] (-1143.180) (-1139.749) (-1144.001) -- 0:00:42 403500 -- (-1145.552) (-1139.387) (-1139.346) [-1143.803] * (-1142.405) (-1142.536) [-1139.828] (-1141.328) -- 0:00:42 404000 -- (-1143.872) (-1143.066) [-1141.344] (-1141.603) * (-1142.346) [-1141.684] (-1143.330) (-1143.676) -- 0:00:42 404500 -- (-1152.698) (-1142.545) [-1143.144] (-1141.826) * [-1140.795] (-1140.086) (-1142.738) (-1141.543) -- 0:00:42 405000 -- (-1141.902) (-1140.813) [-1142.692] (-1140.167) * (-1140.034) (-1140.229) [-1142.616] (-1140.519) -- 0:00:42 Average standard deviation of split frequencies: 0.015288 405500 -- [-1139.890] (-1143.214) (-1141.437) (-1141.555) * (-1139.391) (-1141.602) [-1140.111] (-1142.451) -- 0:00:43 406000 -- (-1139.960) (-1144.031) (-1141.792) [-1140.947] * (-1140.107) (-1141.851) [-1142.643] (-1142.211) -- 0:00:43 406500 -- [-1140.373] (-1140.449) (-1140.313) (-1140.942) * [-1142.014] (-1145.336) (-1143.560) (-1141.230) -- 0:00:43 407000 -- [-1140.527] (-1142.508) (-1147.320) (-1144.052) * [-1144.859] (-1146.801) (-1143.372) (-1143.696) -- 0:00:43 407500 -- (-1143.245) (-1145.347) (-1145.972) [-1140.675] * [-1143.313] (-1150.515) (-1146.153) (-1145.172) -- 0:00:43 408000 -- (-1144.826) (-1143.797) [-1145.859] (-1142.436) * (-1142.692) (-1145.807) [-1145.205] (-1141.682) -- 0:00:43 408500 -- [-1144.930] (-1139.371) (-1141.807) (-1144.298) * (-1140.230) [-1142.243] (-1148.233) (-1144.226) -- 0:00:43 409000 -- (-1143.794) (-1142.221) (-1142.137) [-1143.263] * [-1139.588] (-1144.992) (-1146.845) (-1140.120) -- 0:00:43 409500 -- [-1143.130] (-1141.708) (-1144.093) (-1143.942) * (-1143.987) (-1146.737) [-1144.641] (-1139.247) -- 0:00:43 410000 -- (-1142.350) (-1145.764) [-1145.782] (-1142.259) * (-1148.619) (-1145.473) (-1144.505) [-1140.697] -- 0:00:43 Average standard deviation of split frequencies: 0.015497 410500 -- (-1146.636) [-1140.686] (-1141.365) (-1142.234) * (-1148.842) (-1144.266) [-1141.194] (-1142.969) -- 0:00:43 411000 -- (-1140.517) (-1141.675) (-1142.138) [-1142.542] * (-1140.997) [-1142.363] (-1146.879) (-1144.145) -- 0:00:42 411500 -- (-1146.305) (-1138.993) [-1141.075] (-1143.407) * (-1142.630) [-1144.964] (-1146.821) (-1143.326) -- 0