--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:37:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1338/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1804.91         -1807.85
2      -1804.94         -1808.54
--------------------------------------
TOTAL    -1804.93         -1808.26
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.882124    0.086611    0.375603    1.462350    0.855037   1055.09   1182.91    1.000
r(A<->C){all}   0.170575    0.020664    0.000152    0.466533    0.131635    118.86    201.29    1.003
r(A<->G){all}   0.175119    0.021323    0.000032    0.470596    0.138373    276.58    280.50    1.000
r(A<->T){all}   0.162405    0.017986    0.000008    0.423730    0.129349    203.03    256.85    1.000
r(C<->G){all}   0.171053    0.019421    0.000082    0.448186    0.139461    142.01    184.44    1.001
r(C<->T){all}   0.162380    0.018621    0.000055    0.432988    0.124956    129.25    167.13    1.000
r(G<->T){all}   0.158467    0.018202    0.000020    0.424273    0.120951    214.33    234.68    1.002
pi(A){all}      0.180568    0.000113    0.158359    0.200711    0.180311   1293.05   1314.20    1.000
pi(C){all}      0.312742    0.000161    0.288174    0.338000    0.312717   1343.22   1379.82    1.000
pi(G){all}      0.276475    0.000147    0.253122    0.300659    0.276131   1272.07   1309.42    1.000
pi(T){all}      0.230215    0.000131    0.208055    0.252683    0.229821   1061.76   1281.38    1.000
alpha{1,2}      0.433198    0.232046    0.000150    1.428973    0.256123   1286.94   1361.38    1.000
alpha{3}        0.451813    0.245589    0.000265    1.438120    0.295531   1294.76   1335.16    1.001
pinvar{all}     0.998864    0.000002    0.996427    1.000000    0.999305    892.07   1027.27    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1716.263807
Model 2: PositiveSelection	-1716.263807
Model 0: one-ratio	-1716.264015
Model 7: beta	-1716.263807
Model 8: beta&w>1	-1716.263807


Model 0 vs 1	4.1599999985919567E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C2
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C3
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C4
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C5
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C6
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=440 

C1              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C2              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C3              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C4              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C5              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C6              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
                **************************************************

C1              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C2              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C3              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C4              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C5              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C6              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
                **************************************************

C1              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C2              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C3              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C4              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C5              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C6              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
                **************************************************

C1              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C2              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C3              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C4              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C5              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C6              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
                **************************************************

C1              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C2              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C3              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C4              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C5              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C6              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
                **************************************************

C1              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C2              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C3              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C4              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C5              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C6              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
                **************************************************

C1              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C2              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C3              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C4              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C5              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C6              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
                **************************************************

C1              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C2              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C3              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C4              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C5              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C6              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
                **************************************************

C1              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C2              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C3              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C4              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C5              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C6              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
                ****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  440 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  440 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13200]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [13200]--->[13200]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.544 Mb, Max= 31.028 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C2              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C3              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C4              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C5              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
C6              VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
                **************************************************

C1              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C2              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C3              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C4              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C5              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
C6              HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
                **************************************************

C1              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C2              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C3              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C4              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C5              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
C6              TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
                **************************************************

C1              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C2              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C3              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C4              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C5              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
C6              LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
                **************************************************

C1              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C2              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C3              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C4              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C5              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
C6              GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
                **************************************************

C1              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C2              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C3              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C4              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C5              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
C6              MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
                **************************************************

C1              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C2              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C3              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C4              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C5              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
C6              LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
                **************************************************

C1              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C2              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C3              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C4              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C5              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
C6              VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
                **************************************************

C1              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C2              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C3              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C4              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C5              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
C6              IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
                ****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
C2              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
C3              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
C4              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
C5              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
C6              GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
                **************************************************

C1              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
C2              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
C3              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
C4              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
C5              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
C6              CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
                **************************************************

C1              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
C2              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
C3              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
C4              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
C5              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
C6              CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
                **************************************************

C1              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
C2              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
C3              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
C4              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
C5              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
C6              CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
                **************************************************

C1              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
C2              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
C3              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
C4              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
C5              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
C6              ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
                **************************************************

C1              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
C2              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
C3              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
C4              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
C5              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
C6              ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
                **************************************************

C1              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
C2              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
C3              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
C4              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
C5              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
C6              ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
                **************************************************

C1              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
C2              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
C3              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
C4              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
C5              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
C6              TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
                **************************************************

C1              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
C2              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
C3              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
C4              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
C5              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
C6              TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
                **************************************************

C1              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
C2              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
C3              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
C4              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
C5              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
C6              CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
                **************************************************

C1              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
C2              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
C3              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
C4              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
C5              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
C6              CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
                **************************************************

C1              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
C2              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
C3              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
C4              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
C5              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
C6              TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
                **************************************************

C1              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
C2              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
C3              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
C4              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
C5              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
C6              GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
                **************************************************

C1              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
C2              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
C3              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
C4              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
C5              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
C6              GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
                **************************************************

C1              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
C2              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
C3              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
C4              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
C5              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
C6              CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
                **************************************************

C1              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
C2              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
C3              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
C4              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
C5              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
C6              ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
                **************************************************

C1              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
C2              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
C3              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
C4              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
C5              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
C6              CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
                **************************************************

C1              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
C2              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
C3              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
C4              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
C5              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
C6              GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
                **************************************************

C1              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
C2              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
C3              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
C4              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
C5              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
C6              TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
                **************************************************

C1              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
C2              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
C3              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
C4              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
C5              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
C6              CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
                **************************************************

C1              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
C2              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
C3              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
C4              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
C5              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
C6              TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
                **************************************************

C1              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
C2              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
C3              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
C4              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
C5              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
C6              GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
                **************************************************

C1              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
C2              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
C3              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
C4              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
C5              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
C6              CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
                **************************************************

C1              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
C2              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
C3              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
C4              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
C5              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
C6              GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
                **************************************************

C1              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
C2              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
C3              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
C4              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
C5              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
C6              ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
                **************************************************

C1              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
C2              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
C3              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
C4              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
C5              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
C6              AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
                **************************************************

C1              AGCGCGCTAGCGTGAACGCA
C2              AGCGCGCTAGCGTGAACGCA
C3              AGCGCGCTAGCGTGAACGCA
C4              AGCGCGCTAGCGTGAACGCA
C5              AGCGCGCTAGCGTGAACGCA
C6              AGCGCGCTAGCGTGAACGCA
                ********************



>C1
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C2
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C3
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C4
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C5
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C6
GTGTACGGTGCGCTGGTGACAGCAGCTGACTCGACTCAAACCGGCTTGCG
CAATTGGTTGCTAGCCGTATTCCATCCCCGCACCCACACACCGAGCACGG
CGACAATCGTGCGGTCAGCATTGTGGCCAGCGGCCATTCTTTCGGTGCTG
CACCGCAGCACCGTGATCACGACCAATGGCAACATTACCGACGATTTCAA
ACCGGTCTACCGCGCGGTGCTGAACTTTCGGCACGGCTGGGACATCTACA
ATGAGCACTTCGACTACGTAGACCCGCACTACCTTTACCCACCCGGCGGC
ACACTGCTGATGGCGCCGTTCGGATATCTCCCATTTGCACCGTCACGCTA
TCTGTTCATCCTGATCAACACCGGAGCCATCCTGATCGCCTGGTACCTGA
TCCTGCGGTTGTTCAAGTACACATTGTCCTCGGTGGCTGCACCCACCCTG
CTGCTGGCTATGTTCTGCACCGAGACCGTGACCAGCACGCTGGTGTTCAC
CAACATCAACGGCTGCATAATGCTGCTGGAAGTGCTGTTTTTGTGGTGGC
TGATCAACGGCTCCGAACCCAAGACGGTCAGCCAGCAGTGGTGGGCTGGC
GGCGCGATCGGGTTGACACTGGTGCTCAAACCGCTGCTCGGTCCCCTATT
GTGCCTGCCACTGCTGAATCGTCAGTGGCAGGCACTAGTGCCTGCCATCG
CACTGCCCGTGGTCATCAACCTCGCCGCGCTGCCGTTGGTGAGCCATCCG
ATGGACTTCTTCACGCGCACAGTGCCCTACATCCTGGGCACCCGTGACTA
CTTCAACAGCTCAATCGAAGGCAACGGAGTCTACTTCGGCCTGCCCACTT
GGCTGATCGTGTTCCTGCGGCTGCTGTTCACAGTTTTGGCCATCTGCAGC
TTGTGGCTGCTAAACCGCTACTACCGCACCCGCGATCCACTGTTCTGGTT
CACCTGCTCGACGGGCGTGTTGCTGCTGTGGTCGTGGCTGGTGCTGCCGC
TAGCGCAGGGATACTACTCGATGATGCTGTTCCCGTTCCTGATGACGGTG
GTGCTACCGAACTCCCTGATCCGCAACTGGCCAGCTTGGCTGGGAATCTA
CGGCTTTTTGACGCTGGACCGCTGGCTGCTGTTCAACTGGATGCGCTATG
GCCGGGCGCTGGAATATCTGAAAATCACCTACGGCTGGTCACTGCTGCTG
ATCGTGGTGTCCACAGTGCTGTGCTTCCGCTATCTAGACGCCAAAGCCGA
AAATCGGCTGGATCACGGAATTGATCCGGCATGGCTGACGGCAGAGCGGG
AGCGCGCTAGCGTGAACGCA
>C1
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C2
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C3
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C4
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C5
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA
>C6
VYGALVTAADSTQTGLRNWLLAVFHPRTHTPSTATIVRSALWPAAILSVL
HRSTVITTNGNITDDFKPVYRAVLNFRHGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFILINTGAILIAWYLILRLFKYTLSSVAAPTL
LLAMFCTETVTSTLVFTNINGCIMLLEVLFLWWLINGSEPKTVSQQWWAG
GAIGLTLVLKPLLGPLLCLPLLNRQWQALVPAIALPVVINLAALPLVSHP
MDFFTRTVPYILGTRDYFNSSIEGNGVYFGLPTWLIVFLRLLFTVLAICS
LWLLNRYYRTRDPLFWFTCSTGVLLLWSWLVLPLAQGYYSMMLFPFLMTV
VLPNSLIRNWPAWLGIYGFLTLDRWLLFNWMRYGRALEYLKITYGWSLLL
IVVSTVLCFRYLDAKAENRLDHGIDPAWLTAERERASVNA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1320 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858545
      Setting output file names to "/data/6res/ML1338/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1665582803
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5590559836
      Seed = 1400979658
      Swapseed = 1579858545
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2954.223282 -- -24.965149
         Chain 2 -- -2954.223282 -- -24.965149
         Chain 3 -- -2954.223282 -- -24.965149
         Chain 4 -- -2954.223112 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2954.223112 -- -24.965149
         Chain 2 -- -2954.223282 -- -24.965149
         Chain 3 -- -2954.223112 -- -24.965149
         Chain 4 -- -2954.223282 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2954.223] (-2954.223) (-2954.223) (-2954.223) * [-2954.223] (-2954.223) (-2954.223) (-2954.223) 
        500 -- (-1830.093) (-1835.666) (-1814.827) [-1820.498] * (-1830.653) (-1830.579) [-1822.253] (-1818.726) -- 0:00:00
       1000 -- (-1827.990) [-1813.164] (-1816.075) (-1815.491) * (-1814.599) (-1815.163) (-1818.318) [-1810.160] -- 0:00:00
       1500 -- (-1817.527) (-1811.281) (-1814.460) [-1809.406] * (-1816.722) [-1811.941] (-1820.662) (-1811.958) -- 0:00:00
       2000 -- (-1817.589) (-1814.979) (-1810.117) [-1817.416] * [-1812.333] (-1817.155) (-1812.566) (-1812.961) -- 0:00:00
       2500 -- (-1816.366) (-1819.457) (-1810.566) [-1810.749] * [-1812.307] (-1817.626) (-1819.187) (-1819.347) -- 0:00:00
       3000 -- [-1812.983] (-1816.040) (-1820.808) (-1814.572) * (-1815.335) [-1815.415] (-1818.663) (-1811.792) -- 0:00:00
       3500 -- (-1818.809) (-1808.266) (-1812.372) [-1817.986] * (-1813.262) (-1819.277) [-1816.313] (-1818.930) -- 0:00:00
       4000 -- [-1815.865] (-1811.594) (-1813.191) (-1822.247) * (-1817.138) [-1814.976] (-1809.534) (-1814.567) -- 0:00:00
       4500 -- (-1813.723) (-1813.642) [-1816.495] (-1813.969) * (-1821.653) (-1819.599) (-1813.572) [-1812.437] -- 0:00:00
       5000 -- (-1815.493) (-1811.696) (-1820.669) [-1814.178] * (-1821.277) (-1815.127) [-1818.617] (-1816.125) -- 0:00:00

      Average standard deviation of split frequencies: 0.117851

       5500 -- (-1808.060) [-1816.716] (-1816.333) (-1813.098) * (-1812.359) (-1823.378) (-1815.902) [-1815.500] -- 0:00:00
       6000 -- (-1812.844) [-1813.944] (-1811.273) (-1813.657) * (-1816.892) (-1820.853) (-1816.698) [-1811.291] -- 0:00:00
       6500 -- (-1825.178) [-1813.555] (-1817.813) (-1815.848) * [-1809.702] (-1822.004) (-1815.964) (-1818.955) -- 0:00:00
       7000 -- [-1809.074] (-1825.723) (-1817.350) (-1811.400) * (-1814.102) (-1814.713) (-1817.346) [-1814.083] -- 0:02:21
       7500 -- (-1808.408) [-1810.011] (-1810.856) (-1813.209) * (-1812.505) (-1816.462) (-1816.144) [-1812.019] -- 0:02:12
       8000 -- (-1806.236) [-1814.484] (-1813.431) (-1811.168) * (-1817.303) (-1813.014) (-1819.698) [-1811.590] -- 0:02:04
       8500 -- (-1806.023) [-1815.127] (-1817.436) (-1815.976) * (-1815.785) (-1816.205) (-1812.908) [-1809.811] -- 0:01:56
       9000 -- (-1806.535) (-1818.216) [-1815.957] (-1806.863) * (-1812.110) (-1810.678) (-1810.821) [-1814.205] -- 0:01:50
       9500 -- (-1805.877) (-1811.819) [-1811.957] (-1808.399) * (-1818.084) (-1811.686) (-1812.769) [-1813.953] -- 0:01:44
      10000 -- (-1806.723) (-1810.564) [-1813.136] (-1815.729) * (-1810.536) [-1811.877] (-1817.681) (-1815.492) -- 0:01:39

      Average standard deviation of split frequencies: 0.081759

      10500 -- (-1808.393) [-1810.825] (-1816.713) (-1820.697) * (-1818.451) (-1820.553) [-1811.756] (-1817.801) -- 0:01:34
      11000 -- (-1808.012) (-1814.609) (-1814.735) [-1812.369] * (-1822.804) (-1818.944) [-1810.944] (-1813.951) -- 0:01:29
      11500 -- [-1806.513] (-1812.749) (-1814.183) (-1822.233) * (-1819.801) [-1810.050] (-1811.944) (-1815.589) -- 0:01:25
      12000 -- [-1807.286] (-1813.562) (-1814.126) (-1814.806) * [-1812.711] (-1811.197) (-1816.089) (-1815.918) -- 0:01:22
      12500 -- [-1809.092] (-1818.451) (-1816.409) (-1815.775) * (-1810.138) (-1814.812) [-1810.436] (-1814.452) -- 0:01:19
      13000 -- (-1808.485) (-1815.246) [-1810.822] (-1815.709) * (-1812.901) (-1809.549) (-1819.680) [-1812.012] -- 0:01:15
      13500 -- (-1807.358) [-1809.684] (-1809.824) (-1814.845) * (-1815.866) [-1812.077] (-1813.252) (-1821.794) -- 0:01:13
      14000 -- (-1804.763) [-1816.375] (-1811.879) (-1817.959) * (-1814.403) [-1810.138] (-1822.089) (-1820.659) -- 0:01:10
      14500 -- (-1803.849) (-1813.917) (-1817.923) [-1812.963] * (-1815.966) (-1820.944) [-1815.829] (-1816.252) -- 0:01:07
      15000 -- [-1808.215] (-1814.867) (-1815.968) (-1810.302) * [-1813.274] (-1813.267) (-1813.827) (-1812.077) -- 0:01:05

      Average standard deviation of split frequencies: 0.065128

      15500 -- [-1805.465] (-1812.986) (-1815.660) (-1812.878) * (-1811.634) (-1813.139) [-1810.139] (-1811.050) -- 0:01:03
      16000 -- (-1807.618) (-1815.718) (-1808.835) [-1811.747] * (-1811.061) (-1819.320) [-1812.563] (-1815.109) -- 0:01:01
      16500 -- (-1809.801) (-1812.355) (-1824.565) [-1814.727] * [-1815.203] (-1821.833) (-1815.920) (-1813.062) -- 0:00:59
      17000 -- (-1804.692) (-1813.185) (-1820.527) [-1812.916] * [-1819.255] (-1817.866) (-1814.849) (-1819.009) -- 0:00:57
      17500 -- (-1804.792) (-1815.859) [-1806.805] (-1816.337) * (-1811.772) [-1816.954] (-1813.193) (-1815.485) -- 0:00:56
      18000 -- (-1806.332) [-1818.042] (-1822.806) (-1810.582) * (-1814.990) (-1809.317) (-1814.669) [-1813.326] -- 0:00:54
      18500 -- (-1806.275) [-1815.982] (-1817.012) (-1810.731) * [-1810.757] (-1809.038) (-1816.214) (-1813.053) -- 0:00:53
      19000 -- (-1805.702) [-1814.353] (-1806.924) (-1820.095) * (-1814.249) (-1826.143) (-1817.739) [-1818.457] -- 0:00:51
      19500 -- [-1806.195] (-1823.952) (-1820.375) (-1814.332) * [-1818.324] (-1810.898) (-1822.461) (-1816.903) -- 0:00:50
      20000 -- (-1806.830) (-1817.598) (-1810.597) [-1813.936] * (-1813.708) [-1812.691] (-1814.320) (-1818.877) -- 0:01:38

      Average standard deviation of split frequencies: 0.037569

      20500 -- [-1805.045] (-1809.613) (-1811.466) (-1813.063) * (-1814.052) (-1812.673) [-1807.623] (-1818.064) -- 0:01:35
      21000 -- [-1806.537] (-1819.586) (-1813.623) (-1814.211) * [-1809.767] (-1808.768) (-1811.513) (-1817.114) -- 0:01:33
      21500 -- (-1805.244) (-1815.522) [-1812.860] (-1814.999) * (-1818.704) (-1825.792) [-1814.059] (-1820.758) -- 0:01:31
      22000 -- (-1805.267) [-1810.599] (-1817.764) (-1825.498) * (-1815.114) [-1814.305] (-1809.589) (-1817.052) -- 0:01:28
      22500 -- (-1808.873) (-1819.538) (-1806.716) [-1811.784] * [-1823.157] (-1808.530) (-1818.921) (-1819.922) -- 0:01:26
      23000 -- (-1807.345) (-1816.576) [-1804.461] (-1811.473) * [-1818.721] (-1811.069) (-1817.883) (-1810.786) -- 0:01:24
      23500 -- [-1807.305] (-1821.265) (-1805.234) (-1814.585) * (-1819.194) [-1812.888] (-1815.935) (-1819.019) -- 0:01:23
      24000 -- (-1805.169) (-1817.374) [-1805.033] (-1815.487) * (-1813.290) [-1819.546] (-1810.798) (-1822.826) -- 0:01:21
      24500 -- (-1808.920) (-1817.812) (-1804.728) [-1808.595] * (-1812.245) (-1815.364) [-1817.792] (-1819.318) -- 0:01:19
      25000 -- (-1809.690) (-1812.623) (-1805.451) [-1813.300] * [-1807.363] (-1813.077) (-1820.864) (-1816.598) -- 0:01:18

      Average standard deviation of split frequencies: 0.043896

      25500 -- (-1807.173) (-1820.127) [-1806.137] (-1813.514) * (-1814.968) (-1813.481) [-1819.400] (-1813.523) -- 0:01:16
      26000 -- (-1808.008) [-1814.335] (-1805.942) (-1817.943) * (-1815.904) (-1820.383) (-1818.990) [-1813.675] -- 0:01:14
      26500 -- (-1809.983) (-1814.503) [-1804.664] (-1805.322) * (-1812.155) (-1812.743) (-1811.988) [-1814.063] -- 0:01:13
      27000 -- [-1805.455] (-1810.871) (-1806.187) (-1804.974) * [-1815.126] (-1817.137) (-1812.750) (-1815.084) -- 0:01:12
      27500 -- (-1807.724) (-1816.388) (-1807.571) [-1805.509] * (-1811.767) (-1811.631) [-1811.645] (-1828.252) -- 0:01:10
      28000 -- (-1805.615) [-1810.598] (-1808.914) (-1805.532) * [-1818.471] (-1814.191) (-1814.471) (-1808.812) -- 0:01:09
      28500 -- (-1806.001) [-1814.142] (-1808.668) (-1806.491) * (-1816.539) (-1812.109) (-1819.117) [-1813.145] -- 0:01:08
      29000 -- (-1805.686) [-1818.450] (-1810.483) (-1808.938) * [-1813.173] (-1815.482) (-1813.224) (-1813.432) -- 0:01:06
      29500 -- (-1810.189) (-1817.308) [-1806.225] (-1809.491) * [-1813.407] (-1810.210) (-1814.087) (-1818.368) -- 0:01:05
      30000 -- (-1805.326) (-1809.388) [-1805.529] (-1806.991) * [-1810.841] (-1823.645) (-1809.893) (-1813.523) -- 0:01:04

      Average standard deviation of split frequencies: 0.036124

      30500 -- (-1808.776) [-1808.488] (-1806.835) (-1809.185) * [-1808.531] (-1811.297) (-1813.664) (-1809.794) -- 0:01:03
      31000 -- [-1805.652] (-1810.548) (-1805.527) (-1808.346) * [-1810.257] (-1815.672) (-1818.380) (-1815.229) -- 0:01:02
      31500 -- (-1804.938) [-1807.841] (-1806.042) (-1808.491) * (-1812.715) (-1814.441) [-1810.491] (-1820.863) -- 0:01:01
      32000 -- [-1803.627] (-1804.906) (-1807.411) (-1808.618) * (-1818.784) (-1810.489) [-1811.553] (-1820.267) -- 0:01:00
      32500 -- [-1804.360] (-1806.287) (-1805.815) (-1807.338) * (-1825.777) [-1811.046] (-1817.748) (-1815.202) -- 0:00:59
      33000 -- [-1804.167] (-1804.766) (-1808.880) (-1808.751) * (-1825.950) (-1812.677) [-1811.154] (-1810.873) -- 0:01:27
      33500 -- [-1805.425] (-1806.202) (-1805.691) (-1808.095) * (-1815.786) (-1816.717) [-1822.829] (-1814.254) -- 0:01:26
      34000 -- (-1806.561) [-1807.363] (-1806.178) (-1807.456) * (-1819.963) (-1808.838) (-1811.874) [-1812.173] -- 0:01:25
      34500 -- (-1805.092) (-1808.538) [-1807.165] (-1807.980) * (-1812.090) [-1814.116] (-1813.366) (-1818.600) -- 0:01:23
      35000 -- (-1805.426) (-1807.681) (-1806.219) [-1804.915] * (-1813.324) (-1817.445) [-1811.784] (-1817.914) -- 0:01:22

      Average standard deviation of split frequencies: 0.039284

      35500 -- [-1804.479] (-1809.272) (-1808.682) (-1806.765) * (-1811.704) (-1824.243) (-1812.257) [-1821.768] -- 0:01:21
      36000 -- (-1803.875) (-1807.404) [-1806.246] (-1807.475) * (-1814.574) [-1812.629] (-1825.975) (-1818.878) -- 0:01:20
      36500 -- [-1803.859] (-1812.343) (-1805.824) (-1807.987) * (-1820.936) (-1807.457) (-1819.133) [-1815.173] -- 0:01:19
      37000 -- [-1804.979] (-1809.257) (-1805.951) (-1805.640) * (-1818.011) (-1806.286) [-1809.887] (-1812.436) -- 0:01:18
      37500 -- [-1803.845] (-1809.011) (-1808.559) (-1805.510) * (-1815.078) (-1806.190) (-1812.068) [-1819.637] -- 0:01:17
      38000 -- (-1804.512) [-1806.592] (-1807.787) (-1807.185) * [-1813.039] (-1809.058) (-1824.809) (-1814.229) -- 0:01:15
      38500 -- (-1804.503) [-1806.471] (-1806.023) (-1805.610) * (-1813.840) (-1810.082) [-1813.209] (-1816.643) -- 0:01:14
      39000 -- (-1805.662) (-1805.830) [-1805.836] (-1805.038) * [-1814.166] (-1808.474) (-1818.057) (-1812.035) -- 0:01:13
      39500 -- (-1804.679) (-1807.023) (-1805.101) [-1805.070] * (-1811.644) (-1811.464) [-1811.007] (-1810.769) -- 0:01:12
      40000 -- (-1808.357) [-1810.893] (-1806.001) (-1805.728) * [-1812.402] (-1807.836) (-1814.392) (-1819.051) -- 0:01:12

      Average standard deviation of split frequencies: 0.043317

      40500 -- [-1807.898] (-1810.395) (-1804.775) (-1806.133) * (-1817.005) (-1804.522) (-1807.467) [-1818.531] -- 0:01:11
      41000 -- (-1805.830) (-1804.690) (-1805.028) [-1805.115] * (-1815.010) [-1804.346] (-1807.908) (-1812.344) -- 0:01:10
      41500 -- (-1806.030) (-1805.382) (-1805.159) [-1807.126] * (-1822.241) (-1805.199) (-1804.920) [-1818.310] -- 0:01:09
      42000 -- (-1804.012) [-1805.818] (-1804.920) (-1805.320) * (-1817.589) (-1804.795) (-1806.572) [-1812.834] -- 0:01:08
      42500 -- (-1805.305) (-1805.844) [-1805.060] (-1805.692) * [-1815.190] (-1805.247) (-1805.312) (-1812.124) -- 0:01:07
      43000 -- (-1805.090) (-1807.937) [-1804.655] (-1807.773) * [-1809.493] (-1805.274) (-1805.530) (-1823.622) -- 0:01:06
      43500 -- [-1807.349] (-1805.713) (-1803.968) (-1807.214) * (-1814.206) (-1805.448) (-1803.550) [-1813.018] -- 0:01:05
      44000 -- [-1805.224] (-1805.978) (-1803.902) (-1810.552) * [-1818.871] (-1806.667) (-1803.364) (-1820.988) -- 0:01:05
      44500 -- (-1806.363) [-1805.141] (-1805.458) (-1805.395) * (-1820.866) (-1807.098) (-1803.364) [-1818.644] -- 0:01:04
      45000 -- (-1806.680) (-1807.875) [-1804.851] (-1805.421) * [-1818.169] (-1806.627) (-1803.671) (-1814.406) -- 0:01:03

      Average standard deviation of split frequencies: 0.040504

      45500 -- [-1804.554] (-1810.502) (-1803.892) (-1807.097) * (-1811.918) [-1806.392] (-1805.022) (-1818.178) -- 0:01:02
      46000 -- [-1805.378] (-1809.919) (-1803.798) (-1805.799) * (-1811.107) (-1806.098) (-1805.025) [-1815.841] -- 0:01:02
      46500 -- [-1804.916] (-1805.673) (-1806.376) (-1805.577) * (-1811.614) (-1805.873) [-1804.600] (-1812.867) -- 0:01:22
      47000 -- (-1804.142) (-1807.489) (-1805.422) [-1806.878] * (-1829.166) (-1805.960) [-1806.254] (-1813.805) -- 0:01:21
      47500 -- (-1803.686) (-1807.063) (-1807.585) [-1806.892] * (-1823.729) [-1803.795] (-1807.012) (-1808.913) -- 0:01:20
      48000 -- (-1804.002) [-1808.146] (-1807.106) (-1805.803) * [-1805.526] (-1805.369) (-1809.601) (-1816.300) -- 0:01:19
      48500 -- [-1804.348] (-1809.199) (-1805.215) (-1805.403) * [-1804.814] (-1807.032) (-1807.849) (-1813.555) -- 0:01:18
      49000 -- [-1805.629] (-1808.006) (-1805.209) (-1805.299) * (-1804.651) [-1809.835] (-1806.450) (-1813.866) -- 0:01:17
      49500 -- (-1804.993) (-1809.942) (-1805.204) [-1804.369] * (-1804.461) (-1811.208) (-1805.039) [-1821.996] -- 0:01:16
      50000 -- (-1804.258) (-1804.853) [-1805.955] (-1807.851) * [-1805.558] (-1809.491) (-1807.842) (-1822.497) -- 0:01:16

      Average standard deviation of split frequencies: 0.037216

      50500 -- (-1805.360) [-1803.660] (-1806.826) (-1806.067) * (-1805.459) (-1812.418) (-1807.719) [-1818.710] -- 0:01:15
      51000 -- [-1806.488] (-1803.743) (-1807.652) (-1804.896) * (-1810.509) [-1807.003] (-1804.889) (-1816.699) -- 0:01:14
      51500 -- (-1804.799) [-1804.854] (-1805.457) (-1806.184) * (-1807.565) (-1807.012) (-1805.110) [-1811.878] -- 0:01:13
      52000 -- (-1804.711) (-1805.699) [-1804.303] (-1805.961) * (-1806.406) (-1809.006) (-1804.114) [-1817.101] -- 0:01:12
      52500 -- (-1805.454) (-1805.588) [-1804.580] (-1805.353) * (-1805.131) (-1806.651) [-1809.084] (-1812.133) -- 0:01:12
      53000 -- (-1805.780) (-1805.905) (-1808.307) [-1806.283] * [-1805.314] (-1809.214) (-1806.366) (-1808.520) -- 0:01:11
      53500 -- (-1805.625) (-1806.419) [-1804.942] (-1805.739) * [-1805.202] (-1807.271) (-1804.538) (-1815.458) -- 0:01:10
      54000 -- (-1804.341) (-1807.713) (-1803.668) [-1808.172] * [-1804.954] (-1804.940) (-1810.231) (-1818.391) -- 0:01:10
      54500 -- (-1804.873) (-1808.830) [-1805.453] (-1805.429) * [-1806.743] (-1805.959) (-1806.335) (-1814.428) -- 0:01:09
      55000 -- [-1806.256] (-1806.292) (-1805.835) (-1804.084) * [-1806.344] (-1813.134) (-1805.860) (-1818.084) -- 0:01:08

      Average standard deviation of split frequencies: 0.031567

      55500 -- (-1807.363) (-1809.932) [-1805.757] (-1810.142) * (-1805.455) [-1810.878] (-1805.750) (-1816.457) -- 0:01:08
      56000 -- [-1805.563] (-1810.440) (-1806.431) (-1806.631) * [-1806.780] (-1807.855) (-1805.035) (-1808.923) -- 0:01:07
      56500 -- (-1805.650) [-1805.830] (-1805.534) (-1807.612) * (-1806.484) [-1806.465] (-1806.304) (-1820.259) -- 0:01:06
      57000 -- (-1807.272) (-1805.555) (-1803.985) [-1805.660] * (-1807.589) [-1807.413] (-1805.831) (-1819.643) -- 0:01:06
      57500 -- [-1803.562] (-1807.539) (-1804.553) (-1807.209) * (-1807.717) [-1807.556] (-1805.602) (-1808.325) -- 0:01:05
      58000 -- [-1804.640] (-1806.304) (-1804.876) (-1807.857) * (-1808.604) (-1808.847) (-1808.487) [-1809.402] -- 0:01:04
      58500 -- (-1805.445) (-1805.165) (-1804.874) [-1805.607] * [-1804.935] (-1803.846) (-1805.933) (-1816.492) -- 0:01:04
      59000 -- (-1803.425) (-1805.009) [-1805.505] (-1805.251) * [-1805.881] (-1806.726) (-1805.644) (-1812.010) -- 0:01:03
      59500 -- (-1804.968) (-1807.394) (-1807.598) [-1804.696] * (-1806.473) (-1806.901) [-1805.889] (-1820.835) -- 0:01:03
      60000 -- [-1805.255] (-1805.038) (-1804.484) (-1809.180) * [-1804.565] (-1811.834) (-1806.449) (-1816.521) -- 0:01:02

      Average standard deviation of split frequencies: 0.034190

      60500 -- (-1808.599) [-1804.842] (-1805.866) (-1809.781) * (-1805.048) (-1807.037) (-1805.560) [-1814.858] -- 0:01:17
      61000 -- (-1805.684) (-1804.774) [-1805.838] (-1808.061) * (-1809.569) (-1804.326) (-1806.497) [-1811.801] -- 0:01:16
      61500 -- [-1806.479] (-1806.729) (-1806.766) (-1805.714) * [-1806.842] (-1805.786) (-1806.196) (-1820.156) -- 0:01:16
      62000 -- (-1805.835) (-1805.188) [-1803.996] (-1804.999) * [-1806.175] (-1805.654) (-1807.468) (-1811.131) -- 0:01:15
      62500 -- (-1806.037) (-1805.318) [-1804.151] (-1805.418) * (-1807.548) (-1803.440) (-1810.830) [-1810.015] -- 0:01:15
      63000 -- [-1805.750] (-1806.130) (-1804.240) (-1812.260) * (-1806.619) [-1803.835] (-1809.212) (-1818.688) -- 0:01:14
      63500 -- (-1807.076) (-1805.890) (-1804.660) [-1809.022] * (-1809.284) (-1806.540) (-1808.465) [-1809.888] -- 0:01:13
      64000 -- [-1805.062] (-1806.385) (-1804.208) (-1808.570) * (-1806.771) [-1803.746] (-1808.464) (-1813.627) -- 0:01:13
      64500 -- (-1804.589) (-1805.091) [-1804.143] (-1804.734) * [-1805.609] (-1804.547) (-1807.197) (-1815.804) -- 0:01:12
      65000 -- (-1807.316) (-1808.387) (-1806.501) [-1808.822] * (-1807.031) (-1804.056) (-1806.680) [-1812.626] -- 0:01:11

      Average standard deviation of split frequencies: 0.033849

      65500 -- (-1809.841) (-1811.182) (-1804.803) [-1808.185] * (-1806.070) (-1806.884) [-1806.090] (-1811.874) -- 0:01:11
      66000 -- (-1805.407) [-1806.097] (-1804.707) (-1808.809) * (-1806.463) (-1804.825) (-1806.967) [-1814.159] -- 0:01:10
      66500 -- (-1809.115) [-1805.757] (-1806.820) (-1806.480) * [-1803.668] (-1808.819) (-1806.569) (-1813.071) -- 0:01:10
      67000 -- (-1807.827) [-1804.964] (-1804.450) (-1806.242) * [-1805.097] (-1809.062) (-1805.405) (-1813.935) -- 0:01:09
      67500 -- (-1806.978) (-1805.533) [-1804.156] (-1806.127) * (-1806.776) [-1804.612] (-1805.857) (-1814.774) -- 0:01:09
      68000 -- (-1808.498) [-1805.617] (-1806.084) (-1806.214) * (-1807.787) [-1807.679] (-1804.847) (-1819.095) -- 0:01:08
      68500 -- (-1808.765) [-1804.322] (-1805.720) (-1805.351) * (-1808.349) (-1808.212) (-1805.861) [-1817.601] -- 0:01:07
      69000 -- (-1806.833) [-1805.699] (-1808.961) (-1808.532) * (-1805.810) (-1806.439) (-1807.067) [-1813.046] -- 0:01:07
      69500 -- (-1806.859) [-1805.731] (-1808.028) (-1805.364) * (-1806.750) (-1806.965) (-1806.749) [-1820.631] -- 0:01:06
      70000 -- (-1803.546) [-1806.850] (-1808.378) (-1805.989) * (-1806.456) [-1805.047] (-1812.381) (-1810.439) -- 0:01:06

      Average standard deviation of split frequencies: 0.035355

      70500 -- [-1804.067] (-1805.413) (-1804.178) (-1806.321) * (-1806.688) [-1804.861] (-1806.231) (-1809.758) -- 0:01:05
      71000 -- (-1804.047) (-1808.862) [-1804.022] (-1808.191) * (-1806.636) (-1804.875) [-1805.090] (-1810.803) -- 0:01:05
      71500 -- [-1803.863] (-1806.880) (-1804.046) (-1804.802) * [-1808.672] (-1805.686) (-1804.560) (-1809.914) -- 0:01:04
      72000 -- (-1805.576) [-1807.935] (-1803.745) (-1807.067) * (-1807.462) [-1805.516] (-1805.755) (-1815.791) -- 0:01:04
      72500 -- (-1805.336) (-1804.183) [-1804.133] (-1804.993) * (-1806.966) [-1805.232] (-1807.036) (-1809.695) -- 0:01:03
      73000 -- [-1804.108] (-1805.254) (-1805.022) (-1806.133) * [-1806.271] (-1804.617) (-1805.996) (-1805.197) -- 0:01:03
      73500 -- (-1804.306) (-1804.475) [-1804.556] (-1812.013) * (-1805.184) [-1806.761] (-1807.307) (-1805.165) -- 0:01:03
      74000 -- (-1804.483) [-1804.348] (-1808.435) (-1807.827) * (-1805.183) [-1804.581] (-1804.119) (-1804.913) -- 0:01:02
      74500 -- (-1805.932) (-1805.906) [-1809.383] (-1807.807) * (-1805.546) (-1807.669) [-1804.223] (-1806.906) -- 0:01:02
      75000 -- [-1804.692] (-1805.249) (-1810.296) (-1804.230) * (-1805.510) (-1809.320) [-1810.996] (-1807.030) -- 0:01:01

      Average standard deviation of split frequencies: 0.031944

      75500 -- [-1804.442] (-1805.363) (-1810.048) (-1804.547) * (-1806.714) (-1807.927) (-1812.857) [-1803.574] -- 0:01:01
      76000 -- (-1804.421) (-1805.439) [-1805.023] (-1806.160) * [-1804.625] (-1808.529) (-1808.490) (-1803.574) -- 0:01:12
      76500 -- (-1806.894) (-1807.220) [-1805.448] (-1804.398) * [-1803.951] (-1805.546) (-1807.552) (-1808.640) -- 0:01:12
      77000 -- (-1805.949) [-1804.650] (-1807.297) (-1804.198) * (-1804.638) (-1806.687) (-1806.328) [-1805.306] -- 0:01:11
      77500 -- (-1806.840) (-1805.473) (-1809.129) [-1804.198] * [-1803.651] (-1807.575) (-1806.888) (-1807.707) -- 0:01:11
      78000 -- (-1806.739) (-1805.473) (-1809.285) [-1805.443] * (-1804.312) (-1808.498) (-1807.659) [-1808.383] -- 0:01:10
      78500 -- (-1808.876) (-1806.363) [-1807.752] (-1804.132) * [-1805.434] (-1808.103) (-1807.519) (-1809.454) -- 0:01:10
      79000 -- (-1807.078) (-1805.450) [-1809.181] (-1804.048) * (-1803.455) [-1806.700] (-1804.736) (-1804.617) -- 0:01:09
      79500 -- (-1806.221) (-1807.297) [-1810.105] (-1807.135) * (-1805.264) (-1805.492) (-1805.590) [-1805.425] -- 0:01:09
      80000 -- (-1806.558) (-1803.622) (-1806.824) [-1805.698] * (-1805.914) (-1806.183) [-1804.418] (-1806.086) -- 0:01:09

      Average standard deviation of split frequencies: 0.031372

      80500 -- (-1808.117) [-1804.376] (-1804.571) (-1808.811) * [-1804.653] (-1803.731) (-1804.682) (-1805.453) -- 0:01:08
      81000 -- (-1806.121) [-1803.405] (-1806.921) (-1808.953) * [-1805.313] (-1805.580) (-1805.109) (-1805.537) -- 0:01:08
      81500 -- (-1804.349) (-1805.235) (-1805.456) [-1804.915] * (-1806.757) (-1805.500) (-1804.691) [-1804.753] -- 0:01:07
      82000 -- (-1804.435) [-1805.354] (-1806.926) (-1805.158) * (-1804.540) [-1805.242] (-1804.900) (-1804.215) -- 0:01:07
      82500 -- [-1806.576] (-1807.414) (-1807.341) (-1805.952) * (-1804.610) (-1807.146) (-1806.825) [-1804.215] -- 0:01:06
      83000 -- (-1805.932) (-1805.375) (-1803.834) [-1805.953] * (-1805.871) (-1804.274) [-1805.328] (-1804.170) -- 0:01:06
      83500 -- (-1806.136) [-1803.593] (-1805.066) (-1805.161) * (-1805.933) [-1805.321] (-1805.015) (-1803.754) -- 0:01:05
      84000 -- (-1807.286) [-1803.590] (-1805.037) (-1807.556) * (-1804.163) (-1806.320) (-1804.310) [-1804.089] -- 0:01:05
      84500 -- (-1807.156) (-1804.418) [-1805.193] (-1806.523) * (-1804.652) (-1803.838) [-1806.500] (-1803.591) -- 0:01:05
      85000 -- (-1807.632) (-1806.603) [-1804.474] (-1807.982) * (-1806.287) (-1803.870) (-1804.872) [-1804.417] -- 0:01:04

      Average standard deviation of split frequencies: 0.030801

      85500 -- (-1808.277) (-1805.277) [-1805.067] (-1806.418) * (-1804.459) (-1803.975) [-1804.380] (-1807.269) -- 0:01:04
      86000 -- (-1807.463) [-1804.680] (-1806.002) (-1806.185) * (-1805.886) [-1803.917] (-1804.566) (-1804.524) -- 0:01:03
      86500 -- [-1804.210] (-1806.900) (-1811.209) (-1808.649) * (-1806.077) (-1807.909) [-1804.513] (-1804.912) -- 0:01:03
      87000 -- (-1805.598) [-1804.279] (-1804.243) (-1809.052) * [-1804.002] (-1809.804) (-1804.534) (-1804.441) -- 0:01:02
      87500 -- (-1805.624) (-1805.164) [-1806.625] (-1813.687) * (-1804.162) [-1804.605] (-1804.436) (-1804.761) -- 0:01:02
      88000 -- (-1804.802) (-1806.303) [-1804.991] (-1808.150) * (-1803.532) [-1806.619] (-1804.365) (-1804.459) -- 0:01:02
      88500 -- (-1804.230) (-1805.548) (-1805.010) [-1809.494] * (-1803.532) [-1807.312] (-1804.631) (-1806.099) -- 0:01:01
      89000 -- (-1807.965) (-1804.702) [-1805.053] (-1806.759) * (-1803.532) [-1803.844] (-1804.767) (-1811.048) -- 0:01:01
      89500 -- [-1804.805] (-1804.428) (-1804.566) (-1803.763) * [-1804.836] (-1804.150) (-1804.974) (-1807.303) -- 0:01:01
      90000 -- (-1803.896) [-1804.513] (-1804.507) (-1804.475) * [-1805.560] (-1804.473) (-1804.975) (-1805.677) -- 0:01:00

      Average standard deviation of split frequencies: 0.028307

      90500 -- (-1804.284) [-1804.514] (-1805.763) (-1807.300) * (-1809.232) [-1806.130] (-1804.975) (-1805.308) -- 0:01:00
      91000 -- (-1803.483) [-1806.623] (-1804.646) (-1807.663) * (-1806.665) (-1806.356) [-1805.216] (-1807.493) -- 0:00:59
      91500 -- (-1804.464) (-1807.009) (-1804.774) [-1803.817] * (-1806.052) [-1807.521] (-1805.210) (-1808.418) -- 0:01:09
      92000 -- (-1805.612) (-1806.831) (-1804.931) [-1807.666] * (-1806.394) [-1805.557] (-1804.718) (-1805.499) -- 0:01:09
      92500 -- (-1805.808) (-1805.739) [-1804.866] (-1807.560) * (-1804.050) (-1804.372) [-1805.334] (-1808.105) -- 0:01:08
      93000 -- [-1805.681] (-1806.130) (-1805.316) (-1808.053) * (-1803.643) [-1805.972] (-1804.883) (-1808.089) -- 0:01:08
      93500 -- (-1806.903) (-1804.574) (-1805.493) [-1804.831] * [-1803.771] (-1806.791) (-1804.759) (-1808.085) -- 0:01:07
      94000 -- (-1805.940) (-1804.924) (-1804.513) [-1806.116] * (-1803.862) (-1803.976) [-1804.761] (-1809.445) -- 0:01:07
      94500 -- (-1804.182) (-1804.998) [-1805.596] (-1806.271) * (-1805.665) (-1806.159) [-1803.859] (-1805.761) -- 0:01:07
      95000 -- (-1805.668) (-1805.842) (-1805.424) [-1806.257] * [-1808.824] (-1809.291) (-1804.113) (-1807.634) -- 0:01:06

      Average standard deviation of split frequencies: 0.029174

      95500 -- (-1806.095) (-1805.864) [-1808.534] (-1807.412) * (-1805.258) (-1804.454) [-1804.438] (-1805.962) -- 0:01:06
      96000 -- (-1806.256) (-1805.885) (-1803.916) [-1805.851] * (-1807.644) [-1803.620] (-1807.874) (-1804.971) -- 0:01:05
      96500 -- (-1805.549) (-1805.352) [-1804.260] (-1803.594) * (-1808.363) [-1803.851] (-1805.529) (-1804.972) -- 0:01:05
      97000 -- (-1805.167) [-1805.352] (-1804.937) (-1807.353) * [-1808.383] (-1805.707) (-1805.545) (-1809.230) -- 0:01:05
      97500 -- (-1806.137) (-1804.478) [-1807.335] (-1808.805) * (-1806.542) (-1807.731) (-1804.619) [-1805.604] -- 0:01:04
      98000 -- (-1805.011) (-1803.762) [-1804.499] (-1808.033) * (-1806.388) (-1807.862) (-1805.239) [-1805.440] -- 0:01:04
      98500 -- (-1805.202) [-1804.620] (-1807.357) (-1807.962) * (-1809.866) (-1809.882) [-1805.149] (-1806.529) -- 0:01:04
      99000 -- (-1806.376) [-1804.615] (-1805.721) (-1812.131) * [-1804.403] (-1810.986) (-1807.340) (-1804.869) -- 0:01:03
      99500 -- [-1806.704] (-1806.850) (-1807.847) (-1804.312) * (-1804.820) (-1807.137) [-1804.789] (-1808.007) -- 0:01:03
      100000 -- (-1804.788) [-1805.675] (-1809.679) (-1807.719) * (-1807.705) (-1807.183) [-1804.593] (-1807.282) -- 0:01:02

      Average standard deviation of split frequencies: 0.026995

      100500 -- (-1804.310) (-1804.030) [-1809.576] (-1804.204) * [-1804.712] (-1808.052) (-1804.634) (-1806.085) -- 0:01:02
      101000 -- (-1805.031) (-1804.646) [-1804.498] (-1804.813) * (-1804.831) [-1809.013] (-1808.601) (-1805.129) -- 0:01:02
      101500 -- (-1806.065) (-1805.076) (-1804.397) [-1804.416] * (-1804.859) (-1809.076) [-1809.434] (-1804.821) -- 0:01:01
      102000 -- [-1804.333] (-1810.509) (-1804.716) (-1805.247) * (-1804.866) [-1808.769] (-1807.182) (-1806.791) -- 0:01:01
      102500 -- (-1806.771) [-1805.854] (-1806.247) (-1806.577) * (-1804.751) [-1804.715] (-1808.093) (-1806.202) -- 0:01:01
      103000 -- [-1806.219] (-1804.921) (-1803.762) (-1804.251) * (-1806.014) [-1804.731] (-1808.008) (-1803.717) -- 0:01:00
      103500 -- [-1806.487] (-1807.094) (-1803.785) (-1804.528) * (-1805.773) [-1804.352] (-1804.690) (-1803.863) -- 0:01:00
      104000 -- (-1806.651) (-1805.763) [-1804.083] (-1804.477) * [-1806.293] (-1804.534) (-1809.688) (-1804.111) -- 0:01:00
      104500 -- [-1806.665] (-1808.222) (-1803.992) (-1805.727) * (-1804.902) (-1808.974) (-1808.576) [-1805.675] -- 0:00:59
      105000 -- (-1804.776) (-1804.221) [-1804.212] (-1806.144) * (-1804.716) (-1810.127) [-1805.854] (-1806.833) -- 0:00:59

      Average standard deviation of split frequencies: 0.022660

      105500 -- (-1806.777) [-1804.280] (-1805.238) (-1807.642) * (-1809.028) (-1809.171) (-1803.941) [-1806.518] -- 0:01:07
      106000 -- (-1806.777) [-1804.772] (-1804.102) (-1808.542) * (-1806.570) (-1808.044) [-1805.548] (-1806.517) -- 0:01:07
      106500 -- (-1808.912) (-1804.231) (-1804.976) [-1804.500] * (-1805.353) [-1806.604] (-1804.749) (-1807.153) -- 0:01:07
      107000 -- (-1806.346) [-1806.390] (-1804.543) (-1804.639) * [-1805.858] (-1804.207) (-1804.536) (-1806.833) -- 0:01:06
      107500 -- [-1806.847] (-1812.317) (-1805.162) (-1807.845) * [-1805.722] (-1803.742) (-1805.545) (-1805.102) -- 0:01:06
      108000 -- [-1806.002] (-1811.370) (-1804.082) (-1804.992) * (-1805.626) (-1804.406) [-1804.047] (-1804.789) -- 0:01:06
      108500 -- [-1804.639] (-1809.299) (-1806.552) (-1806.183) * [-1805.630] (-1805.095) (-1806.231) (-1805.076) -- 0:01:05
      109000 -- [-1808.377] (-1809.709) (-1804.343) (-1805.652) * [-1803.744] (-1807.783) (-1804.189) (-1805.883) -- 0:01:05
      109500 -- (-1804.458) (-1806.004) (-1807.736) [-1804.377] * (-1805.869) (-1808.654) [-1804.108] (-1806.722) -- 0:01:05
      110000 -- (-1804.563) [-1805.637] (-1809.179) (-1805.945) * [-1805.754] (-1808.290) (-1806.223) (-1805.973) -- 0:01:04

      Average standard deviation of split frequencies: 0.022802

      110500 -- (-1804.035) [-1805.660] (-1805.877) (-1806.762) * (-1805.983) (-1810.815) (-1806.872) [-1805.603] -- 0:01:04
      111000 -- [-1804.412] (-1810.290) (-1805.638) (-1804.615) * (-1806.090) (-1808.674) (-1804.992) [-1807.005] -- 0:01:04
      111500 -- (-1804.649) (-1807.176) [-1805.775] (-1804.805) * (-1804.789) (-1810.613) (-1804.855) [-1805.136] -- 0:01:03
      112000 -- (-1808.390) (-1807.229) [-1806.546] (-1813.318) * (-1805.364) [-1805.241] (-1807.969) (-1804.030) -- 0:01:03
      112500 -- (-1806.720) [-1807.649] (-1804.336) (-1811.739) * [-1805.035] (-1807.447) (-1806.378) (-1805.493) -- 0:01:03
      113000 -- (-1805.448) [-1805.660] (-1803.854) (-1809.657) * (-1804.794) (-1804.535) [-1809.593] (-1805.317) -- 0:01:02
      113500 -- (-1805.846) [-1806.447] (-1805.483) (-1808.847) * (-1804.432) (-1805.630) [-1805.802] (-1805.482) -- 0:01:02
      114000 -- (-1806.753) (-1806.354) (-1804.472) [-1804.689] * (-1804.293) (-1807.842) [-1805.715] (-1805.308) -- 0:01:02
      114500 -- (-1805.467) (-1804.962) [-1806.623] (-1804.262) * (-1804.013) (-1805.857) (-1805.362) [-1805.643] -- 0:01:01
      115000 -- (-1803.930) (-1805.685) (-1808.781) [-1804.784] * [-1804.198] (-1809.314) (-1804.842) (-1804.778) -- 0:01:01

      Average standard deviation of split frequencies: 0.024811

      115500 -- (-1804.151) [-1804.027] (-1804.729) (-1804.145) * (-1804.326) (-1808.412) [-1804.277] (-1803.872) -- 0:01:01
      116000 -- (-1805.809) (-1804.701) (-1804.798) [-1804.600] * (-1806.746) (-1808.528) [-1806.118] (-1804.501) -- 0:01:00
      116500 -- (-1805.965) [-1804.660] (-1805.278) (-1806.330) * (-1805.311) (-1804.898) [-1804.441] (-1804.608) -- 0:01:00
      117000 -- (-1810.929) (-1804.478) (-1805.519) [-1806.381] * (-1804.804) [-1804.134] (-1804.792) (-1805.187) -- 0:01:00
      117500 -- (-1807.239) [-1803.410] (-1805.333) (-1806.589) * (-1806.400) (-1805.640) [-1804.835] (-1804.560) -- 0:01:00
      118000 -- (-1805.287) [-1803.424] (-1805.649) (-1804.354) * (-1805.929) (-1808.898) [-1803.864] (-1807.671) -- 0:00:59
      118500 -- (-1808.085) (-1803.325) [-1805.153] (-1805.417) * [-1806.410] (-1804.529) (-1806.559) (-1806.660) -- 0:00:59
      119000 -- (-1806.605) (-1804.641) (-1813.914) [-1808.891] * (-1806.518) [-1806.742] (-1803.774) (-1804.478) -- 0:00:59
      119500 -- (-1805.500) [-1804.937] (-1809.825) (-1810.509) * (-1807.536) [-1812.020] (-1803.708) (-1807.626) -- 0:00:58
      120000 -- (-1810.342) [-1804.697] (-1808.633) (-1804.464) * (-1808.798) (-1809.543) (-1804.464) [-1804.646] -- 0:00:58

      Average standard deviation of split frequencies: 0.022854

      120500 -- (-1810.232) (-1806.207) [-1808.666] (-1804.845) * (-1807.268) (-1806.635) (-1804.812) [-1804.472] -- 0:01:05
      121000 -- (-1804.693) [-1804.006] (-1806.271) (-1805.830) * (-1807.313) (-1805.527) (-1806.548) [-1804.457] -- 0:01:05
      121500 -- (-1805.832) [-1803.997] (-1807.635) (-1804.885) * [-1806.081] (-1807.342) (-1805.666) (-1807.793) -- 0:01:05
      122000 -- (-1805.426) (-1804.044) (-1808.095) [-1806.750] * (-1807.468) (-1808.140) (-1808.281) [-1807.206] -- 0:01:04
      122500 -- [-1804.699] (-1805.948) (-1806.098) (-1809.339) * (-1807.208) (-1808.736) [-1808.415] (-1804.650) -- 0:01:04
      123000 -- (-1804.673) (-1803.888) [-1803.984] (-1806.532) * (-1807.029) (-1805.930) [-1807.643] (-1804.321) -- 0:01:04
      123500 -- (-1804.477) (-1803.888) (-1803.995) [-1805.450] * (-1807.701) (-1805.731) (-1807.337) [-1804.357] -- 0:01:03
      124000 -- (-1803.691) (-1804.995) (-1804.700) [-1805.009] * [-1805.331] (-1805.923) (-1808.687) (-1804.382) -- 0:01:03
      124500 -- [-1804.380] (-1805.592) (-1805.764) (-1804.918) * (-1805.629) (-1804.787) [-1805.480] (-1804.433) -- 0:01:03
      125000 -- (-1805.535) (-1805.416) (-1805.384) [-1805.713] * (-1805.645) (-1808.646) [-1806.418] (-1805.262) -- 0:01:03

      Average standard deviation of split frequencies: 0.023196

      125500 -- (-1804.878) [-1806.203] (-1803.713) (-1806.108) * (-1805.501) (-1805.743) (-1805.895) [-1804.731] -- 0:01:02
      126000 -- (-1803.958) (-1805.895) [-1805.705] (-1805.558) * [-1806.369] (-1804.269) (-1806.510) (-1804.334) -- 0:01:02
      126500 -- (-1804.394) [-1806.598] (-1804.939) (-1804.974) * (-1805.561) [-1804.768] (-1808.866) (-1804.387) -- 0:01:02
      127000 -- (-1804.612) (-1808.656) (-1804.556) [-1804.003] * (-1806.055) (-1804.677) (-1807.818) [-1806.545] -- 0:01:01
      127500 -- (-1805.736) (-1804.795) [-1804.528] (-1803.709) * [-1804.701] (-1805.275) (-1808.868) (-1803.692) -- 0:01:01
      128000 -- (-1806.467) (-1805.601) (-1806.363) [-1807.381] * (-1805.398) (-1805.448) (-1808.947) [-1805.774] -- 0:01:01
      128500 -- (-1807.350) (-1805.714) [-1805.434] (-1804.192) * (-1805.564) (-1804.991) (-1808.655) [-1806.783] -- 0:01:01
      129000 -- [-1809.567] (-1806.002) (-1805.497) (-1803.389) * (-1805.324) (-1809.624) (-1807.109) [-1806.954] -- 0:01:00
      129500 -- (-1807.471) (-1806.148) [-1804.896] (-1804.320) * (-1806.510) [-1808.155] (-1806.298) (-1810.208) -- 0:01:00
      130000 -- [-1804.860] (-1805.366) (-1804.769) (-1805.053) * [-1808.508] (-1810.343) (-1804.711) (-1806.785) -- 0:01:00

      Average standard deviation of split frequencies: 0.022785

      130500 -- (-1807.184) (-1805.173) (-1807.927) [-1805.764] * [-1807.938] (-1804.948) (-1806.349) (-1804.813) -- 0:00:59
      131000 -- (-1805.682) [-1805.905] (-1808.351) (-1804.536) * (-1807.159) (-1804.771) [-1806.025] (-1807.872) -- 0:00:59
      131500 -- (-1803.737) (-1806.918) (-1810.728) [-1804.379] * (-1804.922) [-1805.252] (-1809.111) (-1805.062) -- 0:00:59
      132000 -- (-1807.441) (-1807.174) (-1803.956) [-1804.491] * (-1804.267) (-1804.993) [-1806.245] (-1805.299) -- 0:00:59
      132500 -- (-1807.409) [-1806.839] (-1805.644) (-1805.259) * (-1803.852) (-1805.272) (-1806.901) [-1805.304] -- 0:00:58
      133000 -- (-1808.971) [-1807.877] (-1804.217) (-1804.551) * (-1803.989) (-1804.721) [-1806.415] (-1805.085) -- 0:00:58
      133500 -- (-1807.946) (-1807.446) (-1805.355) [-1805.561] * [-1804.043] (-1805.170) (-1805.859) (-1805.356) -- 0:00:58
      134000 -- (-1806.142) (-1807.034) (-1807.842) [-1805.949] * (-1804.049) [-1805.839] (-1807.752) (-1805.259) -- 0:00:58
      134500 -- [-1806.151] (-1806.999) (-1804.390) (-1804.658) * (-1805.100) [-1804.279] (-1808.248) (-1807.172) -- 0:00:57
      135000 -- (-1808.892) [-1805.078] (-1805.550) (-1805.196) * (-1804.752) [-1804.673] (-1808.998) (-1804.693) -- 0:00:57

      Average standard deviation of split frequencies: 0.021760

      135500 -- (-1805.285) (-1804.955) (-1806.517) [-1804.075] * [-1805.329] (-1805.046) (-1805.883) (-1805.378) -- 0:00:57
      136000 -- (-1808.014) [-1804.554] (-1807.022) (-1805.703) * (-1806.766) (-1807.160) (-1807.104) [-1804.143] -- 0:01:03
      136500 -- (-1806.851) [-1804.671] (-1810.963) (-1806.624) * (-1806.530) (-1806.405) (-1806.324) [-1803.829] -- 0:01:03
      137000 -- (-1810.202) [-1805.297] (-1806.022) (-1808.122) * (-1806.441) (-1806.643) (-1807.016) [-1804.657] -- 0:01:02
      137500 -- (-1807.685) [-1806.242] (-1805.040) (-1808.107) * (-1804.307) (-1805.740) (-1808.493) [-1805.181] -- 0:01:02
      138000 -- (-1807.681) (-1808.187) [-1804.412] (-1805.921) * (-1804.190) [-1809.255] (-1806.053) (-1804.900) -- 0:01:02
      138500 -- [-1809.552] (-1808.118) (-1804.482) (-1805.160) * [-1806.357] (-1805.090) (-1806.292) (-1804.844) -- 0:01:02
      139000 -- [-1804.240] (-1805.305) (-1805.711) (-1804.457) * (-1807.326) (-1805.186) (-1806.780) [-1805.145] -- 0:01:01
      139500 -- (-1804.372) (-1804.748) [-1805.323] (-1803.941) * (-1806.282) [-1805.164] (-1804.894) (-1805.068) -- 0:01:01
      140000 -- (-1804.286) (-1805.410) (-1805.179) [-1803.942] * (-1809.451) (-1803.871) (-1808.412) [-1804.430] -- 0:01:01

      Average standard deviation of split frequencies: 0.021783

      140500 -- [-1804.690] (-1803.604) (-1805.180) (-1806.588) * [-1805.861] (-1805.343) (-1812.793) (-1804.608) -- 0:01:01
      141000 -- (-1808.782) [-1805.703] (-1805.972) (-1805.197) * (-1807.160) [-1805.918] (-1810.771) (-1807.008) -- 0:01:00
      141500 -- (-1804.755) (-1805.648) (-1805.970) [-1806.578] * (-1805.383) [-1805.040] (-1804.487) (-1804.967) -- 0:01:00
      142000 -- (-1804.134) (-1806.414) [-1804.497] (-1804.553) * [-1806.682] (-1805.390) (-1806.128) (-1804.409) -- 0:01:00
      142500 -- [-1803.713] (-1806.608) (-1803.331) (-1805.988) * (-1803.757) (-1805.925) (-1810.360) [-1804.712] -- 0:01:00
      143000 -- (-1804.573) (-1806.201) (-1807.463) [-1805.019] * (-1807.089) (-1805.445) [-1806.033] (-1804.131) -- 0:00:59
      143500 -- [-1804.743] (-1806.269) (-1807.216) (-1804.668) * (-1806.724) [-1806.676] (-1806.570) (-1807.923) -- 0:00:59
      144000 -- (-1803.670) [-1804.690] (-1805.411) (-1811.252) * (-1806.403) (-1803.479) (-1806.045) [-1805.909] -- 0:00:59
      144500 -- (-1804.402) (-1804.972) [-1804.872] (-1805.440) * [-1805.790] (-1804.319) (-1805.069) (-1805.908) -- 0:00:59
      145000 -- (-1806.076) (-1806.432) (-1804.001) [-1803.784] * (-1804.663) [-1804.078] (-1804.291) (-1806.115) -- 0:00:58

      Average standard deviation of split frequencies: 0.021149

      145500 -- [-1804.958] (-1805.027) (-1807.247) (-1803.681) * (-1808.146) (-1804.300) [-1804.267] (-1804.062) -- 0:00:58
      146000 -- [-1805.012] (-1805.027) (-1806.983) (-1804.370) * (-1804.247) [-1806.251] (-1804.799) (-1804.323) -- 0:00:58
      146500 -- (-1805.293) (-1804.017) (-1809.275) [-1805.333] * [-1804.831] (-1805.423) (-1806.301) (-1807.741) -- 0:00:58
      147000 -- (-1805.883) (-1804.017) [-1806.283] (-1804.536) * (-1804.058) (-1805.361) (-1806.983) [-1806.581] -- 0:00:58
      147500 -- (-1804.899) [-1804.263] (-1804.184) (-1805.385) * (-1804.058) (-1805.842) (-1808.687) [-1805.092] -- 0:00:57
      148000 -- (-1805.751) (-1803.813) [-1807.027] (-1806.466) * [-1804.481] (-1803.789) (-1809.352) (-1804.057) -- 0:00:57
      148500 -- (-1805.412) (-1803.813) (-1806.103) [-1806.976] * (-1804.495) (-1807.594) [-1806.462] (-1804.057) -- 0:00:57
      149000 -- [-1806.909] (-1804.435) (-1808.413) (-1808.932) * (-1804.060) (-1806.438) [-1804.880] (-1805.793) -- 0:00:57
      149500 -- (-1804.180) (-1805.091) [-1808.523] (-1810.845) * [-1804.933] (-1805.361) (-1804.539) (-1804.161) -- 0:00:56
      150000 -- (-1805.521) (-1805.797) (-1806.183) [-1808.756] * (-1804.993) (-1804.865) (-1805.447) [-1805.927] -- 0:00:56

      Average standard deviation of split frequencies: 0.018443

      150500 -- (-1807.700) [-1803.864] (-1804.196) (-1807.990) * (-1805.849) (-1806.405) [-1808.346] (-1805.275) -- 0:00:56
      151000 -- (-1804.645) (-1803.854) [-1804.273] (-1805.064) * [-1805.322] (-1803.898) (-1805.799) (-1804.859) -- 0:00:56
      151500 -- (-1804.934) (-1804.956) [-1808.531] (-1805.402) * (-1804.223) [-1803.602] (-1806.851) (-1804.475) -- 0:01:01
      152000 -- (-1805.676) (-1807.653) (-1811.515) [-1805.828] * (-1804.402) (-1804.250) (-1804.744) [-1806.704] -- 0:01:01
      152500 -- [-1805.961] (-1804.847) (-1810.865) (-1807.229) * (-1809.770) (-1807.422) [-1804.870] (-1806.567) -- 0:01:01
      153000 -- (-1804.450) (-1804.633) (-1804.142) [-1806.166] * [-1808.387] (-1807.802) (-1804.473) (-1805.357) -- 0:01:00
      153500 -- (-1805.168) (-1804.425) [-1808.213] (-1806.099) * [-1807.675] (-1807.754) (-1803.973) (-1811.380) -- 0:01:00
      154000 -- (-1807.748) (-1806.854) [-1806.241] (-1808.319) * (-1808.519) [-1807.931] (-1803.426) (-1809.200) -- 0:01:00
      154500 -- (-1805.965) (-1804.352) (-1806.025) [-1808.225] * [-1804.754] (-1805.452) (-1803.426) (-1807.624) -- 0:01:00
      155000 -- (-1809.211) (-1804.374) (-1806.905) [-1806.697] * (-1810.128) (-1805.405) (-1805.149) [-1807.708] -- 0:00:59

      Average standard deviation of split frequencies: 0.020649

      155500 -- (-1813.561) [-1805.465] (-1806.765) (-1806.138) * (-1809.455) (-1806.369) [-1805.121] (-1806.098) -- 0:00:59
      156000 -- (-1808.009) (-1804.919) [-1807.350] (-1803.724) * (-1809.047) [-1804.507] (-1804.980) (-1808.908) -- 0:00:59
      156500 -- (-1806.064) (-1804.629) [-1807.689] (-1805.235) * [-1807.909] (-1804.507) (-1804.015) (-1807.555) -- 0:00:59
      157000 -- [-1805.571] (-1807.842) (-1806.187) (-1804.725) * [-1809.912] (-1803.622) (-1806.982) (-1803.544) -- 0:00:59
      157500 -- (-1806.475) [-1804.750] (-1805.951) (-1807.848) * (-1807.722) (-1805.909) (-1806.312) [-1803.986] -- 0:00:58
      158000 -- (-1806.496) (-1809.011) (-1806.119) [-1806.801] * (-1807.426) (-1805.726) (-1806.507) [-1804.314] -- 0:00:58
      158500 -- [-1805.082] (-1806.797) (-1805.159) (-1810.264) * [-1807.647] (-1805.223) (-1806.132) (-1804.700) -- 0:00:58
      159000 -- [-1804.830] (-1806.367) (-1807.684) (-1804.843) * (-1804.819) (-1804.459) [-1808.092] (-1805.357) -- 0:00:58
      159500 -- [-1805.629] (-1806.008) (-1805.716) (-1803.588) * [-1806.818] (-1804.735) (-1808.388) (-1804.625) -- 0:00:57
      160000 -- (-1810.020) (-1808.619) (-1806.910) [-1804.763] * [-1804.826] (-1804.727) (-1807.684) (-1804.705) -- 0:00:57

      Average standard deviation of split frequencies: 0.020384

      160500 -- (-1805.646) [-1805.119] (-1805.217) (-1804.637) * (-1804.579) (-1805.174) (-1808.112) [-1807.135] -- 0:00:57
      161000 -- (-1804.904) (-1805.000) [-1806.798] (-1803.767) * (-1804.649) (-1805.518) (-1808.274) [-1804.442] -- 0:00:57
      161500 -- (-1804.869) (-1804.086) [-1805.714] (-1805.028) * (-1804.215) [-1805.736] (-1808.136) (-1805.632) -- 0:00:57
      162000 -- [-1804.758] (-1803.540) (-1804.508) (-1807.364) * (-1803.951) (-1803.910) [-1807.294] (-1804.724) -- 0:00:56
      162500 -- (-1805.609) [-1804.976] (-1804.578) (-1811.085) * [-1803.977] (-1805.120) (-1807.198) (-1805.335) -- 0:00:56
      163000 -- (-1805.352) (-1805.377) (-1806.353) [-1811.868] * [-1804.127] (-1805.485) (-1806.813) (-1805.339) -- 0:00:56
      163500 -- (-1805.186) (-1806.918) [-1804.622] (-1806.692) * (-1805.297) (-1805.419) (-1806.318) [-1807.294] -- 0:00:56
      164000 -- (-1805.507) (-1805.072) [-1804.168] (-1806.064) * (-1805.814) [-1807.637] (-1809.240) (-1808.075) -- 0:00:56
      164500 -- (-1806.777) (-1805.316) [-1804.349] (-1806.254) * (-1805.667) (-1805.600) [-1809.126] (-1806.287) -- 0:00:55
      165000 -- (-1805.447) (-1805.306) [-1806.323] (-1806.329) * (-1808.503) (-1806.323) [-1804.565] (-1807.039) -- 0:00:55

      Average standard deviation of split frequencies: 0.018234

      165500 -- [-1804.971] (-1805.062) (-1805.196) (-1806.578) * [-1805.633] (-1806.723) (-1805.743) (-1808.286) -- 0:00:55
      166000 -- (-1806.109) (-1804.633) (-1805.932) [-1807.314] * (-1807.227) (-1807.264) (-1805.383) [-1805.152] -- 0:00:55
      166500 -- (-1803.599) (-1803.838) (-1808.253) [-1806.211] * (-1805.312) (-1806.020) (-1807.768) [-1803.988] -- 0:01:00
      167000 -- (-1805.428) (-1806.392) [-1805.069] (-1804.260) * (-1804.897) (-1806.891) (-1805.018) [-1805.065] -- 0:00:59
      167500 -- (-1805.746) (-1805.797) (-1804.732) [-1804.563] * [-1804.520] (-1805.449) (-1808.209) (-1808.538) -- 0:00:59
      168000 -- (-1805.011) [-1804.899] (-1804.438) (-1805.285) * [-1806.549] (-1805.832) (-1805.095) (-1808.675) -- 0:00:59
      168500 -- (-1804.379) [-1805.262] (-1805.226) (-1804.422) * (-1804.752) (-1805.376) [-1805.743] (-1807.265) -- 0:00:59
      169000 -- [-1803.995] (-1804.657) (-1805.135) (-1807.028) * (-1811.766) [-1805.086] (-1805.444) (-1806.697) -- 0:00:59
      169500 -- [-1804.389] (-1805.116) (-1805.688) (-1806.198) * (-1806.705) [-1804.913] (-1804.466) (-1803.822) -- 0:00:58
      170000 -- (-1804.389) [-1804.227] (-1806.346) (-1806.489) * (-1808.332) (-1805.601) [-1806.247] (-1803.808) -- 0:00:58

      Average standard deviation of split frequencies: 0.018463

      170500 -- (-1804.365) (-1804.500) [-1810.104] (-1807.688) * (-1808.582) [-1804.912] (-1804.453) (-1804.351) -- 0:00:58
      171000 -- (-1807.877) [-1804.500] (-1811.137) (-1806.725) * (-1807.780) [-1805.292] (-1804.742) (-1804.391) -- 0:00:58
      171500 -- (-1809.182) (-1804.597) [-1805.513] (-1805.775) * [-1804.712] (-1810.736) (-1807.132) (-1806.578) -- 0:00:57
      172000 -- [-1804.224] (-1804.981) (-1805.725) (-1807.288) * (-1806.600) (-1806.246) [-1804.689] (-1804.596) -- 0:00:57
      172500 -- [-1804.821] (-1808.060) (-1807.583) (-1807.058) * (-1805.722) [-1805.443] (-1804.491) (-1806.496) -- 0:00:57
      173000 -- (-1808.705) (-1806.076) (-1807.486) [-1805.981] * (-1806.009) [-1804.803] (-1803.899) (-1806.423) -- 0:00:57
      173500 -- (-1808.571) (-1804.223) [-1804.857] (-1805.981) * (-1805.991) (-1812.356) [-1804.592] (-1806.480) -- 0:00:57
      174000 -- (-1807.556) [-1805.308] (-1808.783) (-1805.450) * [-1806.796] (-1811.650) (-1806.122) (-1806.677) -- 0:00:56
      174500 -- [-1804.802] (-1805.957) (-1809.096) (-1807.794) * (-1804.830) (-1810.385) [-1806.976] (-1805.104) -- 0:00:56
      175000 -- (-1804.487) (-1805.913) (-1807.160) [-1809.402] * (-1804.773) (-1804.716) (-1803.630) [-1805.799] -- 0:00:56

      Average standard deviation of split frequencies: 0.016916

      175500 -- (-1804.679) (-1806.525) [-1807.107] (-1808.065) * (-1807.142) [-1804.743] (-1805.505) (-1808.699) -- 0:00:56
      176000 -- (-1810.129) (-1806.013) (-1808.565) [-1805.115] * (-1807.274) [-1804.670] (-1805.263) (-1808.166) -- 0:00:56
      176500 -- (-1804.455) (-1807.545) [-1808.216] (-1805.367) * (-1805.924) (-1804.923) [-1805.515] (-1806.745) -- 0:00:55
      177000 -- (-1804.243) [-1806.075] (-1805.074) (-1804.516) * [-1806.020] (-1805.208) (-1807.029) (-1806.155) -- 0:00:55
      177500 -- (-1803.717) [-1806.549] (-1805.513) (-1805.601) * (-1804.187) [-1804.648] (-1808.393) (-1804.762) -- 0:00:55
      178000 -- (-1803.718) [-1807.684] (-1804.734) (-1808.419) * (-1806.086) (-1803.784) (-1807.169) [-1804.130] -- 0:00:55
      178500 -- [-1803.697] (-1806.721) (-1807.776) (-1807.191) * (-1805.191) (-1804.809) [-1804.805] (-1803.967) -- 0:00:59
      179000 -- (-1806.927) [-1806.768] (-1804.792) (-1805.427) * [-1804.873] (-1805.752) (-1803.661) (-1808.252) -- 0:00:59
      179500 -- (-1804.643) (-1806.836) (-1804.807) [-1807.591] * [-1804.464] (-1804.653) (-1805.206) (-1803.645) -- 0:00:59
      180000 -- (-1804.818) [-1805.733] (-1805.351) (-1808.109) * (-1804.565) (-1803.681) (-1806.394) [-1803.410] -- 0:00:59

      Average standard deviation of split frequencies: 0.014694

      180500 -- (-1810.706) (-1806.271) [-1805.664] (-1806.343) * (-1805.328) (-1805.083) (-1806.710) [-1804.088] -- 0:00:59
      181000 -- (-1805.898) (-1806.029) [-1805.843] (-1806.695) * (-1809.390) (-1805.341) [-1806.149] (-1804.326) -- 0:00:58
      181500 -- (-1807.599) (-1807.427) [-1805.623] (-1804.384) * (-1804.377) [-1805.936] (-1805.103) (-1805.053) -- 0:00:58
      182000 -- (-1806.334) (-1809.894) (-1806.378) [-1804.992] * (-1804.498) (-1805.607) (-1805.291) [-1804.951] -- 0:00:58
      182500 -- (-1806.575) [-1807.798] (-1807.486) (-1804.094) * (-1807.666) (-1806.632) [-1803.744] (-1803.903) -- 0:00:58
      183000 -- (-1804.356) (-1807.840) (-1804.901) [-1804.890] * (-1804.857) (-1804.584) [-1803.649] (-1807.307) -- 0:00:58
      183500 -- (-1804.667) (-1805.559) [-1803.807] (-1805.295) * (-1805.275) [-1807.896] (-1804.481) (-1804.502) -- 0:00:57
      184000 -- [-1804.330] (-1805.070) (-1803.618) (-1804.554) * [-1803.715] (-1806.803) (-1804.185) (-1804.433) -- 0:00:57
      184500 -- (-1805.429) (-1806.342) [-1803.939] (-1804.666) * [-1803.715] (-1809.132) (-1803.990) (-1804.052) -- 0:00:57
      185000 -- (-1810.845) (-1808.449) (-1807.350) [-1806.573] * [-1803.693] (-1804.440) (-1804.702) (-1804.338) -- 0:00:57

      Average standard deviation of split frequencies: 0.014446

      185500 -- (-1808.328) [-1806.120] (-1807.736) (-1804.683) * (-1807.428) (-1805.215) (-1803.658) [-1804.866] -- 0:00:57
      186000 -- (-1807.856) (-1806.730) (-1806.344) [-1804.464] * (-1804.474) (-1808.591) (-1806.332) [-1804.548] -- 0:00:56
      186500 -- (-1805.413) (-1809.143) [-1804.263] (-1804.280) * (-1804.748) (-1805.868) [-1806.099] (-1805.513) -- 0:00:56
      187000 -- [-1803.482] (-1810.043) (-1806.228) (-1805.165) * [-1804.748] (-1804.760) (-1803.787) (-1805.900) -- 0:00:56
      187500 -- [-1803.709] (-1807.620) (-1805.700) (-1805.214) * [-1804.165] (-1804.449) (-1805.553) (-1807.072) -- 0:00:56
      188000 -- (-1807.500) (-1805.388) (-1804.262) [-1806.208] * [-1804.642] (-1807.008) (-1806.642) (-1805.777) -- 0:00:56
      188500 -- [-1806.351] (-1809.250) (-1806.196) (-1804.015) * [-1805.694] (-1808.864) (-1804.781) (-1807.903) -- 0:00:55
      189000 -- (-1806.691) (-1805.543) (-1806.456) [-1804.913] * (-1805.053) (-1807.988) [-1813.544] (-1804.315) -- 0:00:55
      189500 -- [-1805.547] (-1805.036) (-1803.849) (-1807.396) * (-1804.888) [-1804.539] (-1812.753) (-1805.003) -- 0:00:55
      190000 -- (-1806.776) (-1807.248) [-1807.525] (-1805.454) * (-1805.862) (-1807.492) [-1804.845] (-1807.538) -- 0:00:55

      Average standard deviation of split frequencies: 0.014093

      190500 -- [-1804.189] (-1808.763) (-1807.684) (-1804.355) * (-1808.110) (-1811.246) [-1804.382] (-1805.986) -- 0:00:55
      191000 -- [-1804.097] (-1806.339) (-1805.693) (-1804.450) * (-1805.412) (-1811.281) (-1814.739) [-1806.362] -- 0:00:55
      191500 -- [-1805.306] (-1805.305) (-1810.765) (-1805.519) * (-1806.887) (-1810.717) (-1808.254) [-1805.829] -- 0:00:59
      192000 -- (-1809.022) (-1805.304) [-1804.716] (-1806.736) * (-1809.969) (-1810.717) (-1806.367) [-1805.112] -- 0:00:58
      192500 -- (-1807.926) (-1806.742) [-1806.995] (-1805.900) * (-1804.607) (-1805.210) [-1804.877] (-1810.372) -- 0:00:58
      193000 -- (-1805.780) (-1809.927) (-1807.125) [-1806.216] * [-1803.697] (-1803.965) (-1806.386) (-1808.700) -- 0:00:58
      193500 -- (-1807.909) (-1807.854) [-1804.389] (-1803.947) * (-1806.912) (-1806.578) [-1807.247] (-1807.854) -- 0:00:58
      194000 -- (-1806.992) (-1807.145) [-1803.787] (-1803.775) * [-1804.782] (-1805.720) (-1806.414) (-1807.638) -- 0:00:58
      194500 -- (-1808.599) [-1806.853] (-1803.609) (-1803.453) * (-1804.777) (-1807.625) (-1807.275) [-1807.322] -- 0:00:57
      195000 -- (-1805.464) (-1811.271) [-1806.046] (-1806.344) * [-1803.833] (-1806.241) (-1805.549) (-1807.204) -- 0:00:57

      Average standard deviation of split frequencies: 0.012747

      195500 -- (-1805.553) (-1809.360) [-1805.530] (-1805.408) * [-1803.860] (-1805.427) (-1807.575) (-1806.217) -- 0:00:57
      196000 -- (-1804.649) [-1806.144] (-1806.589) (-1803.574) * [-1806.557] (-1805.452) (-1808.405) (-1808.073) -- 0:00:57
      196500 -- [-1804.984] (-1804.735) (-1805.304) (-1803.229) * [-1807.628] (-1805.385) (-1807.288) (-1804.773) -- 0:00:57
      197000 -- (-1807.803) (-1804.363) [-1804.561] (-1804.230) * (-1806.010) (-1805.441) (-1807.793) [-1805.128] -- 0:00:57
      197500 -- (-1808.006) [-1804.289] (-1803.962) (-1805.602) * (-1806.901) [-1803.808] (-1807.740) (-1805.575) -- 0:00:56
      198000 -- (-1807.175) (-1804.315) [-1803.838] (-1811.696) * [-1808.918] (-1805.971) (-1805.180) (-1808.657) -- 0:00:56
      198500 -- (-1808.857) (-1805.903) (-1805.062) [-1806.177] * (-1804.933) (-1804.157) (-1805.646) [-1809.937] -- 0:00:56
      199000 -- (-1804.950) (-1807.001) [-1806.477] (-1804.926) * (-1804.800) (-1810.000) [-1805.628] (-1811.869) -- 0:00:56
      199500 -- [-1804.001] (-1805.654) (-1805.049) (-1804.931) * (-1804.778) (-1810.375) [-1805.197] (-1805.390) -- 0:00:56
      200000 -- (-1804.832) (-1804.648) [-1806.068] (-1805.290) * [-1804.203] (-1806.742) (-1806.823) (-1805.093) -- 0:00:55

      Average standard deviation of split frequencies: 0.013106

      200500 -- (-1805.352) (-1805.594) [-1806.043] (-1805.740) * (-1805.034) [-1804.777] (-1807.220) (-1805.929) -- 0:00:55
      201000 -- (-1804.785) [-1804.447] (-1807.843) (-1803.962) * (-1805.235) [-1805.147] (-1810.689) (-1804.342) -- 0:00:55
      201500 -- (-1805.324) [-1805.197] (-1806.361) (-1806.069) * (-1809.371) (-1805.321) (-1807.403) [-1806.957] -- 0:00:55
      202000 -- (-1805.171) (-1804.447) (-1807.935) [-1805.002] * [-1807.857] (-1804.540) (-1806.733) (-1804.918) -- 0:00:55
      202500 -- [-1805.102] (-1804.135) (-1805.616) (-1805.522) * (-1812.201) [-1804.170] (-1806.991) (-1809.671) -- 0:00:55
      203000 -- (-1808.611) (-1804.806) (-1807.621) [-1805.843] * (-1807.450) (-1804.150) [-1807.053] (-1805.786) -- 0:00:54
      203500 -- [-1806.537] (-1805.780) (-1804.665) (-1805.448) * (-1808.143) [-1806.561] (-1807.272) (-1807.377) -- 0:00:54
      204000 -- (-1806.771) (-1807.696) [-1804.270] (-1803.438) * [-1805.029] (-1805.459) (-1810.701) (-1811.994) -- 0:00:54
      204500 -- (-1804.382) (-1807.285) (-1805.538) [-1804.377] * (-1805.462) (-1804.596) [-1804.908] (-1807.995) -- 0:00:54
      205000 -- (-1804.951) (-1804.450) (-1804.261) [-1807.626] * (-1809.989) [-1804.308] (-1806.372) (-1808.427) -- 0:00:54

      Average standard deviation of split frequencies: 0.013610

      205500 -- (-1809.071) [-1805.296] (-1804.261) (-1806.200) * (-1809.155) [-1805.093] (-1808.523) (-1805.605) -- 0:00:57
      206000 -- (-1811.107) (-1806.799) [-1805.228] (-1804.124) * (-1807.337) (-1805.470) (-1808.771) [-1809.245] -- 0:00:57
      206500 -- [-1807.753] (-1807.444) (-1803.935) (-1804.027) * (-1804.814) [-1805.840] (-1806.365) (-1806.716) -- 0:00:57
      207000 -- (-1805.331) (-1808.240) (-1803.935) [-1807.643] * (-1806.563) (-1803.911) (-1806.892) [-1806.222] -- 0:00:57
      207500 -- (-1810.403) [-1805.909] (-1807.622) (-1807.391) * (-1805.619) (-1807.912) (-1807.600) [-1805.426] -- 0:00:57
      208000 -- (-1810.466) [-1806.011] (-1809.043) (-1809.484) * [-1806.267] (-1807.068) (-1808.802) (-1806.090) -- 0:00:57
      208500 -- (-1806.078) (-1808.801) (-1808.637) [-1809.193] * [-1807.127] (-1807.106) (-1804.435) (-1805.531) -- 0:00:56
      209000 -- [-1806.059] (-1810.508) (-1807.410) (-1806.195) * (-1806.432) [-1805.804] (-1804.214) (-1807.790) -- 0:00:56
      209500 -- [-1806.061] (-1808.557) (-1809.158) (-1808.360) * (-1807.038) (-1805.772) [-1805.784] (-1806.631) -- 0:00:56
      210000 -- [-1804.253] (-1811.122) (-1809.044) (-1805.583) * (-1809.979) [-1806.200] (-1806.358) (-1805.731) -- 0:00:56

      Average standard deviation of split frequencies: 0.011306

      210500 -- (-1804.189) (-1806.170) (-1806.283) [-1806.074] * (-1810.247) [-1804.469] (-1805.405) (-1808.536) -- 0:00:56
      211000 -- (-1803.637) (-1809.247) (-1807.268) [-1804.620] * [-1807.440] (-1804.755) (-1805.925) (-1807.938) -- 0:00:56
      211500 -- (-1805.286) [-1806.741] (-1806.409) (-1804.642) * (-1804.119) [-1805.839] (-1804.935) (-1807.788) -- 0:00:55
      212000 -- [-1804.992] (-1806.288) (-1804.680) (-1804.551) * (-1804.550) (-1809.168) [-1804.423] (-1806.494) -- 0:00:55
      212500 -- (-1809.145) (-1806.245) (-1804.796) [-1806.491] * (-1805.212) (-1807.367) (-1804.476) [-1804.487] -- 0:00:55
      213000 -- (-1810.417) (-1806.257) [-1806.679] (-1806.665) * (-1812.479) (-1808.279) [-1806.087] (-1805.154) -- 0:00:55
      213500 -- [-1804.236] (-1806.883) (-1808.454) (-1803.755) * (-1806.520) (-1804.699) [-1808.957] (-1806.965) -- 0:00:55
      214000 -- (-1805.527) [-1806.205] (-1804.376) (-1804.311) * [-1805.157] (-1806.897) (-1809.572) (-1805.211) -- 0:00:55
      214500 -- [-1804.709] (-1809.397) (-1804.449) (-1804.904) * (-1806.651) (-1806.059) [-1804.165] (-1805.545) -- 0:00:54
      215000 -- [-1806.725] (-1806.173) (-1804.954) (-1806.449) * (-1806.068) (-1807.360) [-1804.478] (-1805.595) -- 0:00:54

      Average standard deviation of split frequencies: 0.012061

      215500 -- (-1804.573) [-1804.698] (-1807.355) (-1804.580) * (-1806.728) (-1805.487) [-1803.722] (-1811.991) -- 0:00:54
      216000 -- (-1804.779) (-1806.221) (-1809.309) [-1803.842] * [-1805.113] (-1805.351) (-1804.581) (-1805.028) -- 0:00:54
      216500 -- (-1806.320) [-1810.088] (-1804.447) (-1804.999) * (-1806.575) (-1808.139) (-1807.449) [-1806.621] -- 0:00:54
      217000 -- (-1807.222) (-1806.026) [-1804.447] (-1803.756) * (-1812.522) (-1809.426) [-1805.998] (-1805.740) -- 0:00:54
      217500 -- (-1807.008) (-1808.311) (-1806.559) [-1804.435] * (-1804.732) (-1806.352) [-1804.702] (-1805.958) -- 0:00:53
      218000 -- (-1807.253) [-1804.149] (-1804.708) (-1805.356) * (-1806.218) (-1804.968) [-1806.322] (-1805.515) -- 0:00:53
      218500 -- (-1806.765) (-1803.986) (-1806.992) [-1806.518] * (-1804.563) (-1804.968) [-1804.504] (-1804.421) -- 0:00:53
      219000 -- [-1805.931] (-1803.733) (-1806.785) (-1806.062) * (-1806.446) (-1805.991) [-1806.624] (-1804.899) -- 0:00:53
      219500 -- (-1805.324) [-1806.460] (-1805.218) (-1803.968) * [-1805.710] (-1808.323) (-1805.089) (-1805.770) -- 0:00:56
      220000 -- (-1804.653) (-1807.230) [-1805.347] (-1806.013) * (-1806.084) [-1805.043] (-1805.097) (-1806.611) -- 0:00:56

      Average standard deviation of split frequencies: 0.012368

      220500 -- (-1804.221) (-1804.208) (-1805.186) [-1807.183] * (-1805.555) (-1805.160) [-1804.287] (-1806.539) -- 0:00:56
      221000 -- (-1809.353) (-1804.651) [-1805.707] (-1805.706) * (-1805.255) (-1805.927) (-1804.066) [-1805.784] -- 0:00:56
      221500 -- [-1804.148] (-1804.918) (-1808.611) (-1804.145) * [-1805.197] (-1807.172) (-1803.997) (-1806.706) -- 0:00:56
      222000 -- (-1805.309) (-1810.394) [-1806.907] (-1806.763) * (-1804.802) (-1811.061) (-1803.769) [-1806.408] -- 0:00:56
      222500 -- (-1810.365) (-1807.283) (-1804.654) [-1805.931] * (-1804.062) [-1807.438] (-1804.952) (-1806.880) -- 0:00:55
      223000 -- (-1805.868) (-1811.631) [-1803.998] (-1804.322) * (-1804.692) (-1807.419) [-1803.991] (-1805.531) -- 0:00:55
      223500 -- (-1805.306) (-1809.015) [-1804.449] (-1809.697) * [-1804.875] (-1806.967) (-1807.142) (-1806.238) -- 0:00:55
      224000 -- (-1805.677) [-1804.455] (-1805.802) (-1808.615) * (-1804.092) [-1804.877] (-1806.999) (-1805.769) -- 0:00:55
      224500 -- (-1805.002) [-1807.852] (-1804.651) (-1808.035) * (-1804.453) (-1805.348) [-1805.216] (-1804.452) -- 0:00:55
      225000 -- (-1804.941) [-1807.501] (-1804.242) (-1809.057) * (-1803.903) [-1805.563] (-1805.067) (-1803.690) -- 0:00:55

      Average standard deviation of split frequencies: 0.012515

      225500 -- (-1807.860) (-1805.466) (-1803.923) [-1805.878] * (-1804.537) [-1805.567] (-1807.013) (-1804.770) -- 0:00:54
      226000 -- (-1805.536) (-1805.923) [-1803.909] (-1805.738) * (-1804.627) [-1805.528] (-1806.226) (-1803.552) -- 0:00:54
      226500 -- [-1805.535] (-1806.606) (-1803.670) (-1806.274) * [-1806.051] (-1805.826) (-1805.017) (-1803.828) -- 0:00:54
      227000 -- (-1806.239) [-1812.401] (-1804.871) (-1806.101) * (-1805.941) (-1805.252) [-1804.458] (-1805.230) -- 0:00:54
      227500 -- (-1807.806) (-1806.291) [-1804.871] (-1806.227) * (-1804.860) [-1805.199] (-1806.156) (-1805.330) -- 0:00:54
      228000 -- (-1808.029) (-1808.119) [-1808.247] (-1805.228) * (-1804.469) [-1804.523] (-1807.271) (-1804.747) -- 0:00:54
      228500 -- (-1806.610) (-1806.549) (-1808.213) [-1807.707] * (-1805.050) (-1805.825) (-1806.396) [-1804.689] -- 0:00:54
      229000 -- [-1804.597] (-1803.678) (-1807.044) (-1804.828) * (-1806.699) (-1805.897) [-1804.825] (-1804.773) -- 0:00:53
      229500 -- (-1804.657) (-1803.917) (-1804.389) [-1804.766] * (-1807.553) (-1806.723) [-1804.808] (-1803.811) -- 0:00:53
      230000 -- (-1804.946) (-1804.466) [-1805.967] (-1808.537) * (-1805.706) (-1806.394) [-1807.895] (-1804.666) -- 0:00:53

      Average standard deviation of split frequencies: 0.012047

      230500 -- [-1804.182] (-1805.534) (-1805.545) (-1805.550) * (-1804.309) [-1808.282] (-1807.004) (-1805.980) -- 0:00:53
      231000 -- [-1805.738] (-1807.117) (-1808.454) (-1804.543) * (-1805.257) [-1807.857] (-1805.259) (-1804.135) -- 0:00:53
      231500 -- (-1807.060) (-1806.815) [-1805.510] (-1806.316) * [-1805.011] (-1807.255) (-1805.697) (-1804.554) -- 0:00:56
      232000 -- (-1807.040) (-1805.659) (-1806.149) [-1806.509] * [-1807.195] (-1805.853) (-1805.882) (-1804.507) -- 0:00:56
      232500 -- (-1806.698) [-1806.103] (-1804.499) (-1807.017) * (-1804.865) [-1807.249] (-1806.928) (-1805.280) -- 0:00:56
      233000 -- (-1807.827) (-1805.324) [-1804.356] (-1804.692) * (-1808.480) (-1805.127) (-1807.435) [-1804.222] -- 0:00:55
      233500 -- (-1806.974) (-1804.974) [-1805.107] (-1808.903) * [-1804.975] (-1803.434) (-1806.783) (-1807.367) -- 0:00:55
      234000 -- [-1806.986] (-1806.997) (-1805.492) (-1805.051) * (-1805.000) (-1807.130) (-1806.363) [-1808.312] -- 0:00:55
      234500 -- (-1807.025) (-1806.547) (-1805.146) [-1805.519] * (-1805.576) (-1806.200) (-1806.020) [-1805.604] -- 0:00:55
      235000 -- (-1804.443) (-1805.365) [-1804.466] (-1805.521) * (-1809.382) [-1804.278] (-1804.204) (-1807.815) -- 0:00:55

      Average standard deviation of split frequencies: 0.012195

      235500 -- (-1804.414) [-1804.869] (-1803.802) (-1806.814) * (-1808.458) (-1803.813) (-1807.946) [-1804.497] -- 0:00:55
      236000 -- (-1805.879) (-1810.750) [-1803.604] (-1807.286) * [-1809.708] (-1805.069) (-1804.547) (-1805.835) -- 0:00:55
      236500 -- (-1806.296) (-1807.046) (-1804.409) [-1804.131] * [-1804.841] (-1805.189) (-1807.606) (-1804.293) -- 0:00:54
      237000 -- [-1804.560] (-1805.320) (-1804.446) (-1807.396) * (-1805.968) (-1805.018) (-1808.098) [-1804.391] -- 0:00:54
      237500 -- (-1806.291) (-1806.025) (-1805.642) [-1808.095] * (-1807.234) [-1805.672] (-1807.720) (-1805.174) -- 0:00:54
      238000 -- [-1805.558] (-1805.648) (-1805.167) (-1805.475) * (-1807.412) (-1805.584) [-1804.076] (-1804.551) -- 0:00:54
      238500 -- (-1806.544) (-1805.993) (-1805.498) [-1804.167] * (-1807.026) [-1806.997] (-1806.187) (-1807.016) -- 0:00:54
      239000 -- (-1805.511) (-1805.007) [-1808.698] (-1804.273) * (-1806.117) (-1806.797) [-1804.671] (-1804.191) -- 0:00:54
      239500 -- (-1805.370) (-1805.424) (-1804.176) [-1806.298] * [-1808.184] (-1806.537) (-1805.711) (-1805.197) -- 0:00:53
      240000 -- (-1804.678) (-1807.292) (-1805.817) [-1805.732] * (-1804.948) (-1811.113) (-1804.373) [-1810.381] -- 0:00:53

      Average standard deviation of split frequencies: 0.012990

      240500 -- (-1805.392) (-1807.321) [-1804.518] (-1805.634) * (-1807.544) (-1805.972) [-1805.201] (-1806.145) -- 0:00:53
      241000 -- (-1805.743) (-1806.166) (-1807.061) [-1803.916] * [-1808.196] (-1806.655) (-1808.735) (-1808.152) -- 0:00:53
      241500 -- (-1804.750) (-1804.863) (-1809.506) [-1805.697] * [-1806.014] (-1807.783) (-1806.386) (-1807.682) -- 0:00:53
      242000 -- (-1805.446) [-1804.588] (-1805.383) (-1804.184) * [-1806.695] (-1807.924) (-1807.485) (-1808.214) -- 0:00:53
      242500 -- (-1804.757) [-1804.435] (-1803.707) (-1805.401) * (-1809.497) (-1809.555) [-1806.550] (-1809.321) -- 0:00:53
      243000 -- (-1808.684) [-1804.083] (-1804.707) (-1811.368) * (-1808.359) [-1806.119] (-1806.414) (-1811.540) -- 0:00:52
      243500 -- (-1807.359) (-1805.500) (-1806.318) [-1804.540] * (-1808.190) [-1807.958] (-1805.603) (-1809.584) -- 0:00:52
      244000 -- (-1805.019) [-1805.734] (-1807.006) (-1805.551) * [-1807.673] (-1810.587) (-1804.995) (-1809.132) -- 0:00:52
      244500 -- [-1807.084] (-1803.742) (-1805.889) (-1806.046) * (-1806.121) [-1804.722] (-1803.808) (-1806.708) -- 0:00:52
      245000 -- (-1806.638) (-1810.604) [-1807.352] (-1809.440) * [-1803.899] (-1805.315) (-1805.329) (-1811.387) -- 0:00:55

      Average standard deviation of split frequencies: 0.012910

      245500 -- [-1806.594] (-1804.513) (-1808.732) (-1812.917) * (-1804.939) [-1803.656] (-1805.569) (-1816.577) -- 0:00:55
      246000 -- (-1806.618) (-1804.549) (-1804.912) [-1807.653] * (-1805.196) (-1805.956) [-1807.419] (-1804.447) -- 0:00:55
      246500 -- (-1808.017) (-1803.870) (-1804.806) [-1805.828] * [-1803.576] (-1807.392) (-1806.531) (-1805.129) -- 0:00:55
      247000 -- [-1805.264] (-1803.795) (-1810.103) (-1804.661) * [-1804.597] (-1807.588) (-1804.703) (-1805.791) -- 0:00:54
      247500 -- (-1804.452) (-1805.579) (-1808.296) [-1804.887] * (-1805.581) (-1811.405) [-1807.160] (-1805.061) -- 0:00:54
      248000 -- (-1808.421) (-1805.857) (-1807.490) [-1804.543] * (-1804.411) (-1805.790) [-1805.895] (-1807.503) -- 0:00:54
      248500 -- (-1805.596) (-1803.794) [-1805.817] (-1803.646) * (-1807.592) (-1807.345) (-1804.960) [-1804.621] -- 0:00:54
      249000 -- (-1804.824) (-1803.850) (-1806.715) [-1804.192] * (-1805.238) (-1807.551) (-1806.896) [-1804.465] -- 0:00:54
      249500 -- (-1806.194) (-1804.327) (-1805.718) [-1804.959] * [-1805.379] (-1804.926) (-1808.671) (-1811.007) -- 0:00:54
      250000 -- [-1805.622] (-1804.327) (-1806.003) (-1807.763) * (-1805.837) (-1805.482) [-1803.919] (-1804.883) -- 0:00:54

      Average standard deviation of split frequencies: 0.011482

      250500 -- (-1805.064) (-1806.475) [-1805.831] (-1805.521) * (-1804.457) (-1806.242) [-1804.086] (-1805.413) -- 0:00:53
      251000 -- (-1805.080) [-1804.941] (-1805.238) (-1805.044) * (-1807.722) (-1807.300) [-1803.956] (-1807.109) -- 0:00:53
      251500 -- [-1805.723] (-1805.333) (-1805.176) (-1808.456) * (-1806.567) (-1803.753) [-1805.869] (-1808.753) -- 0:00:53
      252000 -- (-1805.433) (-1807.521) (-1807.228) [-1803.820] * (-1811.362) (-1804.171) (-1808.944) [-1806.133] -- 0:00:53
      252500 -- (-1804.460) (-1806.197) (-1806.100) [-1803.352] * (-1805.458) [-1806.309] (-1806.877) (-1812.973) -- 0:00:53
      253000 -- (-1805.202) [-1805.700] (-1810.014) (-1804.253) * (-1806.811) (-1806.143) [-1805.084] (-1817.171) -- 0:00:53
      253500 -- [-1804.883] (-1807.331) (-1810.136) (-1809.359) * (-1808.406) (-1806.925) (-1804.633) [-1813.878] -- 0:00:53
      254000 -- (-1804.354) (-1810.961) (-1804.180) [-1807.546] * (-1806.471) (-1805.254) (-1804.780) [-1808.796] -- 0:00:52
      254500 -- (-1805.023) [-1805.331] (-1803.819) (-1806.511) * (-1807.930) [-1806.283] (-1806.260) (-1808.066) -- 0:00:52
      255000 -- (-1803.618) (-1805.373) [-1803.807] (-1810.766) * (-1807.930) (-1806.501) [-1805.742] (-1809.194) -- 0:00:52

      Average standard deviation of split frequencies: 0.011436

      255500 -- [-1803.512] (-1804.978) (-1805.256) (-1808.498) * (-1806.552) (-1814.232) [-1804.256] (-1809.724) -- 0:00:52
      256000 -- (-1803.568) [-1804.385] (-1807.015) (-1806.674) * (-1806.315) [-1807.624] (-1804.444) (-1807.688) -- 0:00:52
      256500 -- [-1803.574] (-1804.601) (-1806.945) (-1805.024) * (-1805.554) (-1806.042) [-1804.301] (-1809.014) -- 0:00:52
      257000 -- (-1803.574) (-1806.127) [-1805.363] (-1809.654) * (-1806.954) (-1805.316) (-1805.112) [-1807.809] -- 0:00:52
      257500 -- (-1803.574) (-1807.282) [-1806.648] (-1810.218) * [-1804.837] (-1805.294) (-1804.739) (-1804.883) -- 0:00:51
      258000 -- (-1803.574) (-1809.959) [-1804.087] (-1806.264) * (-1806.820) [-1805.904] (-1808.359) (-1804.559) -- 0:00:51
      258500 -- (-1804.868) (-1805.329) (-1806.464) [-1803.710] * (-1806.096) (-1805.225) (-1807.142) [-1804.107] -- 0:00:51
      259000 -- (-1805.994) (-1804.933) (-1809.481) [-1803.576] * [-1805.008] (-1807.284) (-1808.505) (-1804.152) -- 0:00:54
      259500 -- [-1805.796] (-1809.021) (-1806.203) (-1803.777) * [-1803.813] (-1809.802) (-1809.535) (-1804.581) -- 0:00:54
      260000 -- (-1808.581) (-1808.031) [-1806.305] (-1806.585) * (-1804.838) (-1811.608) (-1804.723) [-1806.589] -- 0:00:54

      Average standard deviation of split frequencies: 0.011517

      260500 -- (-1803.789) (-1808.017) [-1806.660] (-1805.142) * (-1805.299) (-1808.633) (-1804.383) [-1805.090] -- 0:00:53
      261000 -- (-1804.369) (-1807.460) [-1805.406] (-1806.446) * (-1805.364) (-1809.321) (-1806.421) [-1805.247] -- 0:00:53
      261500 -- (-1804.913) (-1811.927) [-1808.292] (-1803.698) * (-1804.334) (-1810.931) (-1805.638) [-1804.714] -- 0:00:53
      262000 -- (-1805.876) [-1807.876] (-1812.833) (-1803.656) * (-1803.684) (-1808.381) [-1806.591] (-1805.654) -- 0:00:53
      262500 -- (-1804.214) [-1808.315] (-1808.851) (-1803.691) * (-1804.775) (-1807.411) (-1805.087) [-1808.601] -- 0:00:53
      263000 -- (-1804.591) [-1806.178] (-1805.878) (-1807.883) * (-1804.291) (-1805.567) [-1805.015] (-1807.972) -- 0:00:53
      263500 -- (-1805.787) (-1806.294) [-1805.478] (-1803.540) * (-1806.439) [-1806.909] (-1807.755) (-1806.303) -- 0:00:53
      264000 -- (-1805.415) (-1806.951) (-1805.683) [-1803.457] * (-1808.924) [-1806.613] (-1806.601) (-1807.281) -- 0:00:52
      264500 -- (-1804.377) (-1807.374) [-1805.804] (-1803.248) * (-1806.787) (-1806.924) (-1806.796) [-1807.539] -- 0:00:52
      265000 -- (-1808.314) (-1805.234) (-1808.759) [-1804.534] * (-1805.983) (-1805.955) [-1805.076] (-1806.880) -- 0:00:52

      Average standard deviation of split frequencies: 0.011566

      265500 -- (-1808.496) (-1807.972) [-1807.770] (-1805.056) * (-1808.208) (-1807.775) (-1813.417) [-1807.095] -- 0:00:52
      266000 -- [-1805.928] (-1805.256) (-1806.153) (-1804.682) * [-1812.280] (-1806.936) (-1808.288) (-1806.674) -- 0:00:52
      266500 -- (-1807.634) [-1805.017] (-1809.299) (-1804.656) * [-1807.846] (-1806.686) (-1807.516) (-1810.238) -- 0:00:52
      267000 -- (-1806.168) (-1805.814) [-1806.029] (-1807.106) * [-1809.212] (-1806.790) (-1807.957) (-1804.853) -- 0:00:52
      267500 -- (-1806.264) (-1806.051) (-1808.578) [-1805.677] * (-1808.515) (-1811.102) (-1811.896) [-1804.156] -- 0:00:52
      268000 -- (-1806.200) [-1805.157] (-1804.084) (-1809.554) * [-1805.993] (-1807.438) (-1806.674) (-1812.870) -- 0:00:51
      268500 -- (-1806.228) (-1808.711) (-1804.815) [-1807.560] * (-1804.841) (-1806.667) [-1805.977] (-1815.953) -- 0:00:51
      269000 -- (-1810.162) [-1805.218] (-1805.142) (-1805.288) * [-1804.021] (-1803.653) (-1807.786) (-1809.540) -- 0:00:51
      269500 -- (-1809.239) (-1804.932) [-1805.111] (-1810.478) * (-1805.135) (-1803.747) (-1807.183) [-1805.166] -- 0:00:51
      270000 -- (-1804.369) [-1806.120] (-1805.026) (-1813.372) * (-1804.670) [-1803.938] (-1804.320) (-1804.388) -- 0:00:51

      Average standard deviation of split frequencies: 0.011417

      270500 -- (-1804.193) (-1806.115) [-1810.835] (-1808.185) * [-1807.304] (-1803.459) (-1804.865) (-1804.338) -- 0:00:51
      271000 -- [-1804.759] (-1804.049) (-1806.640) (-1807.857) * (-1805.293) (-1805.697) [-1804.285] (-1804.905) -- 0:00:51
      271500 -- [-1806.106] (-1805.443) (-1806.084) (-1807.509) * (-1807.944) (-1805.962) [-1804.567] (-1804.414) -- 0:00:50
      272000 -- (-1805.081) (-1807.276) [-1806.833] (-1808.367) * (-1808.853) (-1807.750) [-1804.680] (-1806.051) -- 0:00:50
      272500 -- [-1804.949] (-1805.599) (-1805.055) (-1808.262) * [-1805.061] (-1808.118) (-1804.281) (-1807.582) -- 0:00:50
      273000 -- (-1805.649) (-1806.053) [-1806.860] (-1806.315) * (-1804.994) (-1807.925) (-1805.334) [-1809.482] -- 0:00:53
      273500 -- [-1803.922] (-1807.859) (-1806.839) (-1806.292) * (-1804.876) (-1806.215) [-1804.337] (-1807.412) -- 0:00:53
      274000 -- (-1805.679) (-1806.110) [-1804.786] (-1805.294) * (-1804.685) [-1809.861] (-1806.345) (-1804.358) -- 0:00:52
      274500 -- (-1805.511) (-1805.055) [-1804.026] (-1804.993) * [-1804.843] (-1808.783) (-1805.156) (-1804.195) -- 0:00:52
      275000 -- (-1808.200) (-1805.468) (-1805.129) [-1804.572] * (-1806.389) (-1803.607) [-1803.755] (-1808.382) -- 0:00:52

      Average standard deviation of split frequencies: 0.011237

      275500 -- (-1806.360) (-1805.483) [-1804.598] (-1807.277) * (-1805.440) (-1807.257) [-1804.665] (-1808.371) -- 0:00:52
      276000 -- (-1805.337) (-1807.624) [-1804.598] (-1805.932) * (-1806.584) [-1804.675] (-1803.920) (-1808.148) -- 0:00:52
      276500 -- (-1805.492) (-1806.344) (-1804.283) [-1806.065] * (-1805.382) [-1804.984] (-1803.740) (-1806.323) -- 0:00:52
      277000 -- (-1805.863) (-1808.052) [-1803.780] (-1807.682) * [-1806.372] (-1804.551) (-1803.433) (-1803.674) -- 0:00:52
      277500 -- (-1807.189) (-1804.295) (-1808.596) [-1805.400] * [-1805.533] (-1808.723) (-1803.447) (-1804.197) -- 0:00:52
      278000 -- [-1806.665] (-1804.615) (-1804.983) (-1806.342) * (-1808.328) (-1808.067) [-1803.543] (-1806.238) -- 0:00:51
      278500 -- [-1807.738] (-1804.761) (-1805.971) (-1806.756) * (-1806.824) (-1807.260) [-1805.284] (-1805.429) -- 0:00:51
      279000 -- (-1806.317) (-1805.323) [-1809.335] (-1806.303) * [-1804.361] (-1805.591) (-1804.144) (-1805.379) -- 0:00:51
      279500 -- (-1804.582) (-1805.389) (-1809.189) [-1804.673] * (-1806.562) (-1804.781) (-1804.937) [-1803.592] -- 0:00:51
      280000 -- [-1803.798] (-1804.716) (-1807.604) (-1811.814) * (-1804.151) [-1808.915] (-1804.922) (-1803.592) -- 0:00:51

      Average standard deviation of split frequencies: 0.010824

      280500 -- (-1804.525) [-1804.135] (-1808.393) (-1807.551) * (-1804.154) (-1807.239) [-1807.557] (-1807.020) -- 0:00:51
      281000 -- (-1805.906) (-1807.163) (-1805.812) [-1808.677] * (-1804.148) (-1810.125) [-1805.531] (-1804.691) -- 0:00:51
      281500 -- (-1805.963) (-1806.922) [-1805.854] (-1808.247) * (-1804.149) [-1804.287] (-1805.007) (-1803.833) -- 0:00:51
      282000 -- (-1807.487) (-1805.989) [-1805.689] (-1809.271) * (-1804.663) [-1804.383] (-1804.469) (-1804.629) -- 0:00:50
      282500 -- (-1807.843) (-1805.923) [-1804.775] (-1808.168) * (-1805.952) (-1806.907) [-1804.314] (-1809.264) -- 0:00:50
      283000 -- [-1805.408] (-1806.543) (-1806.542) (-1807.793) * (-1805.526) (-1805.913) [-1805.720] (-1805.137) -- 0:00:50
      283500 -- (-1804.438) (-1805.393) (-1805.962) [-1807.845] * (-1807.146) (-1806.059) (-1809.163) [-1805.795] -- 0:00:50
      284000 -- (-1808.861) (-1804.133) [-1804.681] (-1805.553) * (-1807.482) [-1806.160] (-1808.860) (-1808.107) -- 0:00:50
      284500 -- (-1805.124) [-1806.353] (-1805.679) (-1804.444) * (-1806.287) [-1804.704] (-1808.708) (-1805.625) -- 0:00:50
      285000 -- (-1805.305) (-1806.775) (-1805.678) [-1807.518] * (-1803.711) (-1807.163) (-1811.598) [-1808.637] -- 0:00:50

      Average standard deviation of split frequencies: 0.011950

      285500 -- (-1804.718) (-1808.351) (-1805.086) [-1805.263] * [-1803.705] (-1804.887) (-1806.005) (-1805.219) -- 0:00:50
      286000 -- (-1804.041) (-1810.991) [-1805.839] (-1804.229) * (-1804.933) (-1806.195) [-1804.441] (-1805.386) -- 0:00:49
      286500 -- (-1804.009) (-1809.786) (-1803.631) [-1805.360] * (-1803.788) (-1807.908) [-1804.590] (-1805.322) -- 0:00:49
      287000 -- [-1804.048] (-1808.369) (-1804.672) (-1806.179) * (-1803.715) (-1810.119) [-1805.991] (-1805.549) -- 0:00:49
      287500 -- [-1804.707] (-1808.874) (-1804.074) (-1804.751) * (-1804.584) (-1807.987) (-1808.177) [-1805.858] -- 0:00:49
      288000 -- (-1805.876) [-1806.419] (-1809.052) (-1804.895) * (-1804.347) (-1804.532) (-1803.730) [-1807.220] -- 0:00:49
      288500 -- (-1805.800) [-1806.444] (-1813.705) (-1804.702) * (-1805.092) [-1804.861] (-1804.108) (-1807.122) -- 0:00:51
      289000 -- (-1807.616) [-1805.510] (-1804.840) (-1805.595) * (-1809.034) (-1804.922) (-1804.108) [-1803.906] -- 0:00:51
      289500 -- (-1804.614) (-1806.768) (-1804.852) [-1803.785] * [-1806.188] (-1804.956) (-1805.220) (-1804.000) -- 0:00:51
      290000 -- (-1806.623) (-1807.988) [-1805.499] (-1806.984) * [-1805.636] (-1804.591) (-1804.479) (-1803.666) -- 0:00:51

      Average standard deviation of split frequencies: 0.012650

      290500 -- [-1805.696] (-1806.662) (-1804.168) (-1805.796) * (-1806.799) [-1804.595] (-1805.474) (-1805.726) -- 0:00:51
      291000 -- [-1805.408] (-1804.575) (-1807.559) (-1810.193) * [-1809.636] (-1805.814) (-1807.015) (-1805.691) -- 0:00:51
      291500 -- (-1804.841) (-1804.518) [-1805.828] (-1805.255) * [-1807.105] (-1807.169) (-1805.092) (-1805.221) -- 0:00:51
      292000 -- (-1805.809) [-1804.190] (-1808.287) (-1803.782) * (-1806.917) (-1806.051) (-1803.977) [-1806.521] -- 0:00:50
      292500 -- (-1804.934) (-1805.839) [-1806.104] (-1803.786) * (-1805.691) (-1809.933) (-1804.430) [-1804.562] -- 0:00:50
      293000 -- (-1803.774) (-1807.151) [-1806.526] (-1804.152) * (-1808.393) [-1808.126] (-1804.213) (-1805.443) -- 0:00:50
      293500 -- [-1803.760] (-1806.916) (-1806.598) (-1805.051) * [-1804.703] (-1806.540) (-1804.915) (-1808.470) -- 0:00:50
      294000 -- (-1807.275) (-1806.916) (-1807.883) [-1805.242] * [-1807.864] (-1807.499) (-1807.856) (-1807.967) -- 0:00:50
      294500 -- [-1805.632] (-1809.156) (-1803.987) (-1803.658) * [-1805.325] (-1804.765) (-1808.667) (-1806.599) -- 0:00:50
      295000 -- (-1807.831) [-1808.506] (-1805.039) (-1803.645) * [-1804.485] (-1806.297) (-1807.803) (-1806.577) -- 0:00:50

      Average standard deviation of split frequencies: 0.013617

      295500 -- (-1807.166) (-1805.119) [-1803.963] (-1804.502) * (-1805.330) [-1806.185] (-1805.057) (-1805.107) -- 0:00:50
      296000 -- (-1805.779) (-1808.959) [-1805.323] (-1805.389) * [-1805.508] (-1808.313) (-1804.709) (-1808.973) -- 0:00:49
      296500 -- [-1804.812] (-1805.676) (-1806.084) (-1806.787) * (-1805.508) (-1808.043) (-1805.121) [-1806.541] -- 0:00:49
      297000 -- (-1806.171) [-1804.052] (-1805.867) (-1805.927) * (-1805.960) [-1808.702] (-1805.814) (-1805.781) -- 0:00:49
      297500 -- [-1805.455] (-1805.430) (-1806.439) (-1806.289) * [-1806.314] (-1810.606) (-1807.007) (-1805.614) -- 0:00:49
      298000 -- (-1806.251) (-1808.104) [-1805.254] (-1806.838) * (-1808.563) (-1807.424) [-1807.085] (-1803.654) -- 0:00:49
      298500 -- (-1805.459) (-1806.048) [-1804.455] (-1806.755) * (-1805.886) [-1806.151] (-1809.345) (-1804.959) -- 0:00:49
      299000 -- [-1805.936] (-1804.390) (-1804.896) (-1805.415) * [-1804.555] (-1806.470) (-1809.794) (-1805.938) -- 0:00:49
      299500 -- [-1805.387] (-1803.950) (-1807.230) (-1806.747) * (-1804.325) (-1806.551) [-1805.035] (-1805.682) -- 0:00:49
      300000 -- [-1809.147] (-1810.838) (-1805.197) (-1805.944) * [-1805.399] (-1808.158) (-1805.487) (-1806.131) -- 0:00:48

      Average standard deviation of split frequencies: 0.013562

      300500 -- (-1809.682) (-1804.938) (-1804.129) [-1804.662] * [-1803.873] (-1805.159) (-1807.550) (-1806.528) -- 0:00:48
      301000 -- (-1807.251) (-1805.254) (-1804.356) [-1805.223] * (-1803.996) (-1805.233) [-1807.719] (-1807.161) -- 0:00:48
      301500 -- (-1804.825) [-1804.371] (-1804.313) (-1805.702) * (-1804.359) (-1806.183) (-1806.463) [-1807.744] -- 0:00:48
      302000 -- (-1804.892) [-1804.944] (-1804.622) (-1803.529) * (-1805.435) (-1806.648) (-1806.926) [-1807.048] -- 0:00:48
      302500 -- [-1806.373] (-1806.112) (-1808.208) (-1805.574) * (-1808.144) [-1807.819] (-1805.229) (-1806.113) -- 0:00:48
      303000 -- (-1804.955) [-1806.899] (-1806.577) (-1805.773) * (-1806.163) (-1808.095) [-1805.181] (-1806.336) -- 0:00:48
      303500 -- (-1805.868) (-1805.877) (-1804.925) [-1804.574] * [-1806.117] (-1808.491) (-1807.435) (-1805.381) -- 0:00:48
      304000 -- (-1808.490) (-1807.119) [-1805.210] (-1806.546) * (-1805.008) (-1807.606) (-1809.142) [-1804.281] -- 0:00:50
      304500 -- (-1811.455) (-1806.801) [-1804.496] (-1805.796) * (-1803.824) (-1805.230) [-1806.086] (-1804.392) -- 0:00:50
      305000 -- (-1807.709) (-1805.670) [-1804.492] (-1810.266) * (-1803.773) [-1803.841] (-1804.941) (-1806.395) -- 0:00:50

      Average standard deviation of split frequencies: 0.013172

      305500 -- (-1803.635) [-1805.627] (-1810.456) (-1805.038) * (-1805.663) (-1806.749) [-1805.602] (-1808.913) -- 0:00:50
      306000 -- (-1804.671) (-1806.147) [-1805.469] (-1804.676) * (-1805.752) (-1805.152) (-1804.869) [-1811.061] -- 0:00:49
      306500 -- [-1804.831] (-1804.524) (-1804.620) (-1807.448) * (-1805.459) [-1804.777] (-1803.608) (-1808.528) -- 0:00:49
      307000 -- [-1805.273] (-1806.856) (-1805.044) (-1810.858) * [-1806.578] (-1804.935) (-1804.251) (-1803.588) -- 0:00:49
      307500 -- (-1806.965) (-1804.258) [-1805.679] (-1809.943) * (-1806.450) [-1804.795] (-1806.521) (-1803.593) -- 0:00:49
      308000 -- (-1804.591) [-1804.217] (-1806.112) (-1807.650) * (-1806.029) (-1804.778) (-1805.155) [-1804.240] -- 0:00:49
      308500 -- (-1803.846) [-1804.988] (-1805.610) (-1807.629) * (-1805.043) [-1806.907] (-1807.495) (-1806.322) -- 0:00:49
      309000 -- (-1805.201) (-1808.919) [-1809.399] (-1806.991) * [-1805.040] (-1806.881) (-1805.519) (-1807.813) -- 0:00:49
      309500 -- (-1805.714) [-1804.189] (-1812.433) (-1805.895) * [-1805.111] (-1807.289) (-1807.892) (-1807.851) -- 0:00:49
      310000 -- (-1805.848) (-1805.156) [-1810.400] (-1807.848) * (-1805.957) [-1804.208] (-1807.124) (-1805.678) -- 0:00:48

      Average standard deviation of split frequencies: 0.013125

      310500 -- [-1804.478] (-1803.809) (-1805.417) (-1806.517) * [-1805.934] (-1804.404) (-1804.928) (-1811.087) -- 0:00:48
      311000 -- (-1804.742) [-1805.901] (-1805.374) (-1805.504) * (-1806.553) [-1804.636] (-1808.037) (-1809.621) -- 0:00:48
      311500 -- [-1805.346] (-1803.779) (-1805.089) (-1808.597) * (-1803.896) [-1804.177] (-1805.625) (-1805.343) -- 0:00:48
      312000 -- (-1806.764) (-1810.515) (-1804.982) [-1805.179] * [-1808.102] (-1804.847) (-1805.689) (-1807.991) -- 0:00:48
      312500 -- (-1810.617) [-1805.146] (-1806.175) (-1805.345) * (-1808.414) [-1804.286] (-1806.540) (-1811.116) -- 0:00:48
      313000 -- (-1809.189) (-1804.010) [-1808.423] (-1813.167) * (-1809.554) (-1804.548) (-1807.670) [-1806.216] -- 0:00:48
      313500 -- (-1806.109) [-1805.584] (-1807.802) (-1805.399) * [-1807.797] (-1804.548) (-1807.141) (-1809.305) -- 0:00:48
      314000 -- (-1806.678) [-1804.600] (-1807.515) (-1803.514) * (-1813.996) [-1803.558] (-1806.401) (-1806.809) -- 0:00:48
      314500 -- (-1806.457) (-1804.128) (-1806.075) [-1803.462] * (-1804.573) (-1803.750) [-1809.267] (-1806.795) -- 0:00:47
      315000 -- [-1808.226] (-1804.540) (-1805.709) (-1806.816) * (-1805.285) [-1805.841] (-1807.347) (-1805.199) -- 0:00:47

      Average standard deviation of split frequencies: 0.013277

      315500 -- (-1804.607) (-1804.434) (-1808.630) [-1808.151] * (-1809.136) (-1805.848) [-1805.518] (-1807.243) -- 0:00:47
      316000 -- (-1804.467) (-1805.891) [-1804.990] (-1806.397) * [-1804.653] (-1806.911) (-1809.413) (-1804.395) -- 0:00:47
      316500 -- (-1803.922) [-1806.528] (-1805.223) (-1805.504) * (-1804.822) (-1803.861) [-1805.897] (-1804.405) -- 0:00:47
      317000 -- (-1804.359) (-1803.873) [-1804.653] (-1807.903) * (-1804.756) (-1805.752) (-1809.249) [-1803.912] -- 0:00:47
      317500 -- (-1806.282) [-1803.873] (-1807.731) (-1809.899) * (-1805.417) (-1804.897) (-1808.937) [-1809.744] -- 0:00:49
      318000 -- (-1805.507) (-1806.067) (-1807.724) [-1807.324] * (-1805.872) (-1803.483) (-1806.912) [-1803.231] -- 0:00:49
      318500 -- (-1812.124) (-1806.389) (-1809.133) [-1806.159] * (-1804.999) [-1805.679] (-1807.833) (-1805.985) -- 0:00:49
      319000 -- (-1806.614) (-1803.586) (-1806.167) [-1809.016] * [-1804.550] (-1807.390) (-1807.903) (-1805.063) -- 0:00:49
      319500 -- (-1806.143) (-1803.914) (-1806.438) [-1804.335] * [-1810.573] (-1805.953) (-1805.956) (-1807.526) -- 0:00:48
      320000 -- (-1810.274) [-1804.233] (-1806.021) (-1805.073) * (-1806.336) (-1809.906) [-1805.099] (-1808.070) -- 0:00:48

      Average standard deviation of split frequencies: 0.012790

      320500 -- (-1805.286) [-1804.561] (-1805.391) (-1808.454) * (-1805.609) (-1804.654) (-1805.557) [-1803.758] -- 0:00:48
      321000 -- (-1806.710) (-1804.567) [-1803.912] (-1805.352) * (-1804.287) (-1805.116) [-1807.677] (-1804.278) -- 0:00:48
      321500 -- (-1809.381) [-1804.842] (-1806.086) (-1804.782) * (-1804.665) [-1805.481] (-1805.132) (-1808.766) -- 0:00:48
      322000 -- [-1809.426] (-1807.716) (-1806.204) (-1804.706) * (-1804.751) (-1806.287) (-1805.776) [-1805.911] -- 0:00:48
      322500 -- (-1808.870) (-1804.525) (-1806.951) [-1804.700] * [-1804.666] (-1807.016) (-1807.958) (-1806.461) -- 0:00:48
      323000 -- [-1804.134] (-1804.372) (-1804.940) (-1806.654) * (-1804.398) (-1811.729) [-1806.030] (-1805.152) -- 0:00:48
      323500 -- [-1803.766] (-1804.270) (-1804.276) (-1804.216) * (-1804.775) (-1808.158) (-1805.033) [-1805.534] -- 0:00:48
      324000 -- (-1803.949) (-1804.770) [-1806.258] (-1809.024) * (-1805.545) (-1808.487) [-1805.219] (-1805.343) -- 0:00:47
      324500 -- [-1806.674] (-1805.302) (-1808.891) (-1805.730) * [-1805.612] (-1806.523) (-1805.503) (-1805.653) -- 0:00:47
      325000 -- (-1807.061) [-1803.982] (-1804.061) (-1806.905) * [-1805.563] (-1805.954) (-1805.524) (-1806.242) -- 0:00:47

      Average standard deviation of split frequencies: 0.011720

      325500 -- (-1804.389) (-1803.879) [-1803.257] (-1807.466) * (-1804.274) (-1805.848) (-1805.531) [-1807.282] -- 0:00:47
      326000 -- (-1810.563) (-1803.942) [-1807.745] (-1805.364) * [-1804.274] (-1805.112) (-1808.093) (-1807.683) -- 0:00:47
      326500 -- (-1806.639) (-1804.603) (-1804.433) [-1804.041] * (-1805.115) (-1807.101) [-1804.573] (-1804.084) -- 0:00:47
      327000 -- (-1807.537) [-1805.173] (-1805.988) (-1804.670) * [-1807.912] (-1807.385) (-1804.359) (-1804.576) -- 0:00:47
      327500 -- (-1804.828) [-1807.352] (-1806.434) (-1804.930) * (-1804.929) (-1807.228) (-1804.456) [-1804.376] -- 0:00:47
      328000 -- [-1805.043] (-1809.755) (-1805.502) (-1804.451) * (-1808.867) [-1803.480] (-1804.828) (-1805.399) -- 0:00:47
      328500 -- [-1803.928] (-1804.938) (-1805.346) (-1804.279) * (-1807.988) [-1803.480] (-1807.328) (-1803.879) -- 0:00:47
      329000 -- (-1805.966) [-1804.947] (-1805.012) (-1806.832) * (-1806.953) (-1803.652) (-1806.875) [-1806.507] -- 0:00:46
      329500 -- (-1806.100) (-1804.678) (-1804.529) [-1806.368] * (-1807.309) [-1804.842] (-1806.683) (-1804.454) -- 0:00:46
      330000 -- (-1806.418) (-1806.598) [-1806.440] (-1807.310) * (-1808.125) (-1806.068) (-1810.701) [-1804.596] -- 0:00:46

      Average standard deviation of split frequencies: 0.012080

      330500 -- (-1805.882) (-1806.421) (-1805.606) [-1805.909] * (-1807.254) (-1804.852) [-1806.675] (-1804.463) -- 0:00:48
      331000 -- (-1807.948) [-1805.777] (-1807.484) (-1807.083) * (-1807.604) (-1808.000) (-1804.053) [-1803.981] -- 0:00:48
      331500 -- (-1806.633) (-1805.469) (-1806.237) [-1806.147] * (-1803.918) (-1804.801) [-1803.716] (-1804.751) -- 0:00:48
      332000 -- (-1812.058) (-1808.877) (-1804.119) [-1804.789] * [-1803.918] (-1805.067) (-1803.852) (-1805.453) -- 0:00:48
      332500 -- [-1805.010] (-1804.931) (-1804.703) (-1804.546) * (-1805.507) (-1805.257) (-1803.898) [-1804.027] -- 0:00:48
      333000 -- [-1806.668] (-1805.271) (-1803.689) (-1804.687) * (-1805.485) (-1806.502) [-1804.375] (-1806.510) -- 0:00:48
      333500 -- (-1804.618) (-1805.605) (-1803.633) [-1805.377] * (-1805.479) (-1806.835) (-1806.659) [-1806.657] -- 0:00:47
      334000 -- [-1805.502] (-1805.917) (-1807.136) (-1806.114) * [-1807.514] (-1806.647) (-1808.825) (-1805.300) -- 0:00:47
      334500 -- (-1806.494) (-1806.470) [-1804.262] (-1806.737) * [-1805.264] (-1804.963) (-1805.859) (-1812.484) -- 0:00:47
      335000 -- (-1806.349) (-1805.098) [-1808.545] (-1805.961) * (-1807.752) (-1806.790) (-1808.010) [-1806.440] -- 0:00:47

      Average standard deviation of split frequencies: 0.011741

      335500 -- (-1803.704) [-1807.527] (-1806.533) (-1804.120) * (-1804.324) [-1806.793] (-1804.986) (-1807.984) -- 0:00:47
      336000 -- (-1804.644) [-1805.001] (-1807.627) (-1805.628) * (-1804.519) [-1806.046] (-1804.911) (-1810.263) -- 0:00:47
      336500 -- (-1806.538) (-1804.811) [-1805.558] (-1808.532) * (-1810.094) (-1806.852) [-1804.211] (-1806.658) -- 0:00:47
      337000 -- (-1806.087) (-1805.051) [-1805.513] (-1805.984) * [-1812.997] (-1808.341) (-1804.144) (-1807.409) -- 0:00:47
      337500 -- [-1810.060] (-1807.482) (-1807.193) (-1804.018) * (-1806.405) (-1805.194) (-1803.965) [-1807.879] -- 0:00:47
      338000 -- (-1807.431) (-1804.590) [-1806.913] (-1804.036) * (-1808.334) (-1804.839) (-1803.990) [-1806.002] -- 0:00:47
      338500 -- (-1805.904) [-1804.338] (-1807.143) (-1804.514) * (-1806.194) (-1806.034) [-1804.007] (-1805.092) -- 0:00:46
      339000 -- (-1806.024) (-1804.338) (-1808.921) [-1804.874] * [-1805.073] (-1806.028) (-1806.010) (-1806.524) -- 0:00:46
      339500 -- (-1806.661) (-1805.449) (-1807.397) [-1806.851] * (-1806.352) (-1804.564) (-1807.426) [-1805.229] -- 0:00:46
      340000 -- [-1806.626] (-1804.689) (-1804.117) (-1806.957) * (-1805.080) [-1805.940] (-1805.827) (-1805.173) -- 0:00:46

      Average standard deviation of split frequencies: 0.012672

      340500 -- (-1806.054) [-1804.048] (-1807.074) (-1805.469) * (-1803.673) (-1804.131) (-1804.129) [-1807.208] -- 0:00:46
      341000 -- (-1803.277) (-1804.312) (-1805.722) [-1805.234] * (-1806.000) [-1805.880] (-1807.052) (-1808.044) -- 0:00:46
      341500 -- [-1803.952] (-1806.491) (-1807.231) (-1803.880) * [-1805.813] (-1804.431) (-1805.760) (-1808.115) -- 0:00:46
      342000 -- (-1804.093) [-1805.179] (-1808.650) (-1803.819) * (-1807.534) (-1805.253) (-1805.171) [-1805.976] -- 0:00:46
      342500 -- (-1805.421) (-1804.726) [-1807.750] (-1807.490) * (-1806.391) (-1806.271) (-1806.106) [-1806.156] -- 0:00:46
      343000 -- (-1805.432) [-1803.796] (-1806.319) (-1806.416) * [-1804.821] (-1807.756) (-1806.108) (-1808.018) -- 0:00:45
      343500 -- (-1808.210) (-1806.203) [-1805.591] (-1805.708) * (-1804.953) [-1804.534] (-1805.454) (-1809.780) -- 0:00:45
      344000 -- (-1806.582) [-1805.969] (-1807.568) (-1805.664) * (-1804.404) [-1804.672] (-1806.005) (-1804.154) -- 0:00:45
      344500 -- [-1812.769] (-1806.535) (-1804.399) (-1805.027) * (-1804.374) (-1806.015) [-1804.484] (-1806.204) -- 0:00:45
      345000 -- (-1807.560) (-1805.664) [-1803.632] (-1804.461) * (-1804.102) (-1805.185) [-1805.662] (-1810.056) -- 0:00:45

      Average standard deviation of split frequencies: 0.012190

      345500 -- [-1806.277] (-1804.800) (-1803.703) (-1813.301) * (-1804.090) [-1804.833] (-1805.859) (-1805.809) -- 0:00:45
      346000 -- (-1805.967) (-1804.449) [-1808.248] (-1806.664) * (-1804.339) (-1804.258) [-1804.790] (-1803.788) -- 0:00:47
      346500 -- (-1807.496) (-1804.069) [-1805.151] (-1806.510) * (-1807.760) (-1806.231) (-1805.517) [-1803.797] -- 0:00:47
      347000 -- (-1805.652) (-1803.499) [-1804.912] (-1806.686) * [-1807.292] (-1809.045) (-1804.499) (-1804.440) -- 0:00:47
      347500 -- [-1806.073] (-1810.145) (-1804.022) (-1806.475) * (-1806.031) (-1805.395) [-1804.267] (-1804.622) -- 0:00:46
      348000 -- (-1805.391) (-1805.078) [-1804.379] (-1806.475) * (-1807.590) (-1804.227) (-1804.338) [-1803.773] -- 0:00:46
      348500 -- (-1806.317) (-1806.781) [-1803.929] (-1808.459) * [-1805.870] (-1806.086) (-1807.718) (-1803.673) -- 0:00:46
      349000 -- (-1805.614) (-1806.489) (-1805.912) [-1805.948] * (-1805.425) (-1806.245) [-1808.271] (-1808.509) -- 0:00:46
      349500 -- (-1804.470) [-1805.931] (-1804.311) (-1805.703) * [-1805.597] (-1810.737) (-1809.394) (-1808.078) -- 0:00:46
      350000 -- [-1807.278] (-1806.322) (-1804.075) (-1805.049) * (-1805.116) (-1808.272) [-1807.564] (-1807.073) -- 0:00:46

      Average standard deviation of split frequencies: 0.012311

      350500 -- [-1808.032] (-1807.403) (-1804.832) (-1808.836) * [-1804.604] (-1806.818) (-1806.376) (-1805.888) -- 0:00:46
      351000 -- [-1803.948] (-1806.405) (-1805.252) (-1805.804) * (-1805.104) (-1808.532) [-1805.673] (-1807.019) -- 0:00:46
      351500 -- (-1809.033) (-1808.542) [-1806.060] (-1805.903) * (-1804.624) (-1808.453) [-1806.353] (-1807.378) -- 0:00:46
      352000 -- (-1804.164) [-1804.529] (-1804.896) (-1807.781) * (-1805.298) (-1806.547) [-1811.088] (-1807.318) -- 0:00:46
      352500 -- (-1804.164) (-1803.925) [-1807.766] (-1805.241) * (-1804.820) (-1806.600) (-1807.425) [-1805.052] -- 0:00:45
      353000 -- [-1805.504] (-1805.602) (-1805.700) (-1804.795) * [-1805.530] (-1807.973) (-1805.003) (-1811.899) -- 0:00:45
      353500 -- (-1803.825) (-1804.880) (-1806.570) [-1804.877] * (-1805.064) (-1804.651) [-1803.719] (-1809.633) -- 0:00:45
      354000 -- (-1804.555) [-1806.324] (-1804.656) (-1804.699) * (-1807.001) (-1808.353) [-1803.423] (-1809.353) -- 0:00:45
      354500 -- (-1807.841) (-1807.184) [-1805.877] (-1807.836) * (-1805.527) (-1805.895) [-1803.668] (-1808.222) -- 0:00:45
      355000 -- (-1811.980) [-1806.901] (-1811.132) (-1805.203) * (-1804.693) (-1804.721) (-1804.313) [-1804.120] -- 0:00:45

      Average standard deviation of split frequencies: 0.012545

      355500 -- (-1809.259) (-1806.498) [-1807.366] (-1805.081) * (-1805.281) (-1808.183) [-1804.032] (-1806.578) -- 0:00:45
      356000 -- (-1804.878) (-1806.916) (-1807.358) [-1804.883] * (-1804.811) (-1809.390) (-1805.810) [-1804.327] -- 0:00:45
      356500 -- [-1805.936] (-1808.277) (-1809.265) (-1807.242) * [-1807.637] (-1807.200) (-1807.364) (-1805.166) -- 0:00:45
      357000 -- [-1807.769] (-1805.754) (-1811.399) (-1805.946) * (-1807.399) (-1806.153) (-1807.693) [-1804.198] -- 0:00:45
      357500 -- [-1803.928] (-1807.401) (-1807.728) (-1803.815) * [-1810.098] (-1806.062) (-1806.308) (-1805.020) -- 0:00:44
      358000 -- [-1804.250] (-1806.834) (-1805.458) (-1806.003) * (-1809.320) (-1805.974) (-1806.590) [-1804.584] -- 0:00:44
      358500 -- [-1804.398] (-1807.737) (-1805.132) (-1808.115) * (-1808.286) [-1805.995] (-1806.448) (-1804.952) -- 0:00:44
      359000 -- [-1803.768] (-1807.765) (-1805.130) (-1805.017) * (-1805.383) (-1810.744) [-1804.778] (-1809.244) -- 0:00:44
      359500 -- (-1806.357) (-1806.694) (-1806.973) [-1805.013] * (-1805.094) (-1806.039) (-1804.893) [-1804.398] -- 0:00:44
      360000 -- (-1807.112) (-1809.013) (-1810.780) [-1805.184] * [-1805.745] (-1807.863) (-1808.917) (-1805.916) -- 0:00:44

      Average standard deviation of split frequencies: 0.012589

      360500 -- (-1804.691) (-1806.642) [-1807.673] (-1805.799) * (-1806.976) [-1805.138] (-1807.764) (-1806.873) -- 0:00:44
      361000 -- [-1804.325] (-1806.767) (-1804.990) (-1807.935) * (-1804.716) (-1806.969) [-1808.828] (-1807.164) -- 0:00:46
      361500 -- (-1804.329) (-1804.240) (-1804.836) [-1806.721] * [-1803.735] (-1806.990) (-1808.384) (-1806.863) -- 0:00:45
      362000 -- (-1806.184) (-1803.443) [-1806.124] (-1806.566) * (-1808.312) (-1806.589) [-1805.686] (-1805.680) -- 0:00:45
      362500 -- (-1804.472) [-1803.602] (-1804.277) (-1807.751) * [-1805.260] (-1804.651) (-1808.922) (-1805.727) -- 0:00:45
      363000 -- (-1804.366) [-1804.530] (-1803.821) (-1806.666) * (-1805.290) [-1806.237] (-1807.430) (-1805.462) -- 0:00:45
      363500 -- (-1806.681) (-1804.359) [-1803.904] (-1806.836) * (-1807.514) (-1805.278) (-1804.161) [-1807.026] -- 0:00:45
      364000 -- (-1806.591) [-1803.741] (-1804.992) (-1805.384) * (-1805.170) [-1805.645] (-1803.613) (-1805.611) -- 0:00:45
      364500 -- [-1805.296] (-1806.651) (-1807.138) (-1804.846) * (-1807.482) (-1807.939) [-1804.403] (-1806.163) -- 0:00:45
      365000 -- (-1805.663) (-1806.872) [-1804.767] (-1806.546) * [-1809.373] (-1809.057) (-1806.407) (-1811.751) -- 0:00:45

      Average standard deviation of split frequencies: 0.012066

      365500 -- (-1804.970) (-1807.419) (-1805.782) [-1804.181] * (-1808.369) (-1807.973) (-1807.026) [-1809.099] -- 0:00:45
      366000 -- [-1805.138] (-1810.307) (-1805.561) (-1804.009) * [-1805.525] (-1806.990) (-1806.053) (-1811.201) -- 0:00:45
      366500 -- [-1804.671] (-1804.607) (-1806.397) (-1804.892) * [-1805.764] (-1807.767) (-1808.847) (-1812.088) -- 0:00:44
      367000 -- (-1804.513) [-1805.981] (-1806.064) (-1804.540) * (-1808.897) [-1804.463] (-1807.895) (-1808.806) -- 0:00:44
      367500 -- [-1805.227] (-1806.122) (-1806.064) (-1804.864) * [-1810.169] (-1803.789) (-1804.828) (-1806.337) -- 0:00:44
      368000 -- (-1808.959) (-1806.828) [-1806.905] (-1804.124) * (-1806.332) [-1803.675] (-1806.890) (-1804.087) -- 0:00:44
      368500 -- (-1805.681) (-1807.934) [-1805.460] (-1806.426) * (-1810.310) [-1805.999] (-1804.639) (-1805.334) -- 0:00:44
      369000 -- (-1812.722) (-1807.271) [-1805.381] (-1805.505) * (-1805.701) (-1808.082) [-1803.999] (-1805.791) -- 0:00:44
      369500 -- (-1807.245) (-1805.158) (-1805.775) [-1807.454] * (-1804.874) (-1808.425) (-1804.255) [-1806.015] -- 0:00:44
      370000 -- (-1810.719) [-1805.975] (-1806.204) (-1805.686) * (-1804.757) (-1805.316) (-1808.302) [-1804.109] -- 0:00:44

      Average standard deviation of split frequencies: 0.012584

      370500 -- (-1804.083) [-1804.980] (-1807.742) (-1809.355) * (-1807.647) (-1804.731) [-1805.560] (-1806.706) -- 0:00:44
      371000 -- (-1804.141) [-1804.505] (-1808.677) (-1809.177) * (-1807.822) [-1804.306] (-1807.923) (-1804.626) -- 0:00:44
      371500 -- (-1805.520) [-1805.020] (-1808.127) (-1804.395) * (-1806.779) (-1805.479) (-1807.235) [-1807.471] -- 0:00:43
      372000 -- [-1803.735] (-1805.865) (-1806.462) (-1805.109) * (-1805.614) (-1803.930) (-1806.259) [-1807.072] -- 0:00:43
      372500 -- (-1805.806) (-1807.147) (-1812.710) [-1804.972] * (-1806.038) [-1803.963] (-1805.671) (-1806.547) -- 0:00:43
      373000 -- [-1804.348] (-1804.938) (-1806.601) (-1805.445) * (-1806.756) (-1804.036) (-1806.147) [-1804.883] -- 0:00:43
      373500 -- (-1805.072) (-1807.880) (-1805.421) [-1803.365] * (-1807.592) (-1807.722) (-1806.305) [-1804.373] -- 0:00:43
      374000 -- [-1806.239] (-1807.358) (-1807.482) (-1804.468) * (-1805.906) (-1804.267) (-1807.929) [-1805.042] -- 0:00:43
      374500 -- (-1804.435) [-1805.057] (-1809.319) (-1804.591) * (-1806.628) [-1804.805] (-1806.155) (-1804.389) -- 0:00:43
      375000 -- (-1803.695) (-1804.094) (-1807.601) [-1808.022] * (-1805.965) [-1807.243] (-1804.756) (-1804.450) -- 0:00:43

      Average standard deviation of split frequencies: 0.012405

      375500 -- (-1804.451) [-1805.174] (-1807.109) (-1804.228) * (-1809.245) (-1807.699) (-1807.561) [-1804.920] -- 0:00:43
      376000 -- (-1805.831) (-1809.219) (-1808.212) [-1805.033] * [-1808.308] (-1808.608) (-1809.591) (-1804.520) -- 0:00:43
      376500 -- (-1807.164) (-1807.564) (-1806.850) [-1807.083] * (-1805.180) [-1804.799] (-1816.278) (-1805.544) -- 0:00:43
      377000 -- (-1808.241) (-1810.181) (-1806.522) [-1805.553] * (-1805.160) (-1806.366) (-1812.699) [-1804.494] -- 0:00:44
      377500 -- (-1804.364) (-1808.664) [-1806.897] (-1804.981) * [-1805.770] (-1805.694) (-1806.581) (-1804.877) -- 0:00:44
      378000 -- (-1804.360) [-1808.659] (-1808.330) (-1803.987) * (-1804.180) (-1805.902) (-1804.473) [-1804.561] -- 0:00:44
      378500 -- [-1806.378] (-1805.537) (-1809.871) (-1807.937) * (-1803.996) (-1809.275) (-1806.470) [-1806.993] -- 0:00:44
      379000 -- (-1807.057) (-1804.149) [-1807.500] (-1806.307) * (-1804.295) (-1805.514) [-1805.907] (-1807.499) -- 0:00:44
      379500 -- (-1807.383) (-1804.575) (-1806.405) [-1805.256] * (-1804.231) (-1811.628) [-1804.589] (-1809.427) -- 0:00:44
      380000 -- [-1807.593] (-1808.052) (-1805.955) (-1803.985) * (-1805.347) [-1808.259] (-1804.923) (-1807.811) -- 0:00:44

      Average standard deviation of split frequencies: 0.012840

      380500 -- (-1806.161) (-1806.102) [-1807.237] (-1803.943) * (-1804.520) (-1807.130) [-1803.987] (-1806.481) -- 0:00:43
      381000 -- (-1815.328) (-1804.518) (-1806.433) [-1805.197] * [-1804.520] (-1806.839) (-1804.091) (-1806.985) -- 0:00:43
      381500 -- (-1811.085) (-1805.569) [-1804.294] (-1804.195) * (-1804.682) [-1806.749] (-1803.428) (-1806.114) -- 0:00:43
      382000 -- (-1807.295) (-1803.978) (-1805.316) [-1804.306] * [-1809.112] (-1806.644) (-1805.071) (-1805.519) -- 0:00:43
      382500 -- (-1805.919) (-1803.989) [-1804.837] (-1805.193) * (-1809.022) (-1805.218) (-1803.822) [-1804.531] -- 0:00:43
      383000 -- (-1805.254) [-1804.274] (-1805.107) (-1803.602) * (-1804.437) (-1805.295) [-1803.681] (-1805.091) -- 0:00:43
      383500 -- (-1805.240) [-1803.541] (-1804.588) (-1804.981) * (-1805.832) (-1805.317) (-1803.971) [-1806.957] -- 0:00:43
      384000 -- [-1806.337] (-1807.344) (-1807.494) (-1804.432) * (-1808.896) (-1804.729) (-1804.740) [-1808.599] -- 0:00:43
      384500 -- [-1804.136] (-1807.469) (-1807.036) (-1804.448) * (-1808.896) (-1806.476) [-1806.902] (-1805.013) -- 0:00:43
      385000 -- (-1812.270) [-1805.887] (-1806.639) (-1806.836) * [-1808.896] (-1808.144) (-1806.349) (-1808.036) -- 0:00:43

      Average standard deviation of split frequencies: 0.013305

      385500 -- (-1805.434) [-1804.459] (-1810.232) (-1805.254) * (-1803.358) [-1804.278] (-1806.816) (-1809.168) -- 0:00:43
      386000 -- (-1803.926) (-1807.866) (-1810.856) [-1805.846] * [-1803.577] (-1809.213) (-1806.266) (-1805.122) -- 0:00:42
      386500 -- (-1803.622) (-1805.104) [-1804.022] (-1809.374) * (-1803.922) (-1805.974) [-1808.250] (-1805.167) -- 0:00:42
      387000 -- [-1805.917] (-1806.403) (-1805.191) (-1807.100) * (-1804.704) (-1806.224) [-1805.670] (-1807.329) -- 0:00:42
      387500 -- [-1804.652] (-1806.147) (-1806.745) (-1807.155) * (-1803.486) (-1810.945) [-1806.514] (-1805.847) -- 0:00:42
      388000 -- (-1804.565) [-1809.198] (-1804.677) (-1807.186) * (-1804.794) [-1804.725] (-1804.982) (-1806.158) -- 0:00:42
      388500 -- (-1805.480) (-1804.128) [-1803.767] (-1805.779) * (-1804.919) (-1805.260) [-1804.982] (-1805.907) -- 0:00:42
      389000 -- (-1804.040) [-1803.631] (-1805.318) (-1806.511) * (-1806.635) (-1806.392) (-1804.721) [-1804.704] -- 0:00:42
      389500 -- (-1805.224) [-1803.804] (-1804.416) (-1809.916) * (-1805.720) (-1808.401) [-1804.721] (-1803.698) -- 0:00:42
      390000 -- (-1807.136) (-1803.668) [-1805.287] (-1804.225) * (-1805.179) (-1807.188) (-1806.568) [-1807.513] -- 0:00:42

      Average standard deviation of split frequencies: 0.013877

      390500 -- (-1803.947) [-1804.099] (-1804.566) (-1804.304) * (-1808.955) (-1808.134) (-1805.052) [-1809.241] -- 0:00:42
      391000 -- (-1804.080) [-1805.142] (-1803.649) (-1803.799) * (-1806.901) [-1804.862] (-1805.998) (-1806.976) -- 0:00:42
      391500 -- (-1804.575) (-1804.107) [-1805.750] (-1804.837) * [-1805.550] (-1807.677) (-1805.484) (-1805.790) -- 0:00:41
      392000 -- (-1803.924) (-1803.846) [-1804.318] (-1805.493) * (-1807.815) (-1805.914) [-1804.638] (-1805.125) -- 0:00:41
      392500 -- [-1806.730] (-1803.927) (-1805.606) (-1807.576) * (-1808.085) (-1806.009) (-1805.030) [-1806.123] -- 0:00:43
      393000 -- (-1805.354) (-1804.927) (-1808.196) [-1803.700] * (-1806.377) (-1806.021) (-1805.197) [-1804.441] -- 0:00:43
      393500 -- [-1805.865] (-1804.613) (-1805.203) (-1804.856) * (-1806.985) (-1805.743) (-1806.566) [-1804.441] -- 0:00:43
      394000 -- [-1806.076] (-1805.922) (-1804.974) (-1808.445) * (-1806.843) (-1806.868) [-1806.075] (-1804.686) -- 0:00:43
      394500 -- (-1808.604) [-1809.121] (-1805.152) (-1807.434) * (-1805.279) (-1811.431) [-1805.943] (-1807.253) -- 0:00:42
      395000 -- (-1806.953) (-1805.102) [-1805.721] (-1806.208) * (-1805.616) (-1805.776) [-1803.925] (-1807.906) -- 0:00:42

      Average standard deviation of split frequencies: 0.013032

      395500 -- (-1809.790) (-1806.975) [-1807.756] (-1805.288) * [-1806.098] (-1807.694) (-1806.398) (-1805.547) -- 0:00:42
      396000 -- (-1809.260) (-1805.350) (-1806.078) [-1804.159] * [-1806.531] (-1809.284) (-1803.798) (-1812.890) -- 0:00:42
      396500 -- [-1805.216] (-1803.830) (-1807.865) (-1804.019) * [-1806.658] (-1809.355) (-1804.145) (-1805.497) -- 0:00:42
      397000 -- [-1805.303] (-1803.559) (-1808.828) (-1808.168) * (-1806.813) (-1809.045) (-1805.353) [-1806.158] -- 0:00:42
      397500 -- (-1808.539) [-1806.213] (-1804.167) (-1807.713) * (-1808.240) (-1809.495) [-1805.548] (-1803.550) -- 0:00:42
      398000 -- (-1804.724) (-1804.515) [-1808.628] (-1808.443) * (-1807.824) (-1811.128) (-1805.175) [-1805.610] -- 0:00:42
      398500 -- (-1807.288) [-1803.864] (-1807.892) (-1806.304) * (-1805.993) [-1805.376] (-1806.661) (-1803.284) -- 0:00:42
      399000 -- [-1806.435] (-1806.943) (-1805.700) (-1805.718) * [-1805.863] (-1810.584) (-1804.633) (-1804.461) -- 0:00:42
      399500 -- (-1810.820) (-1805.984) (-1808.239) [-1806.944] * (-1805.538) (-1804.753) [-1804.662] (-1804.664) -- 0:00:42
      400000 -- (-1810.126) (-1807.561) (-1804.852) [-1804.562] * (-1805.840) [-1806.592] (-1805.910) (-1803.797) -- 0:00:41

      Average standard deviation of split frequencies: 0.012942

      400500 -- (-1806.166) (-1804.118) [-1805.447] (-1807.135) * [-1805.905] (-1806.022) (-1805.276) (-1803.796) -- 0:00:41
      401000 -- (-1806.116) (-1805.924) [-1804.609] (-1807.963) * (-1805.720) (-1806.454) (-1806.024) [-1806.791] -- 0:00:41
      401500 -- (-1805.005) [-1803.632] (-1804.729) (-1809.740) * [-1804.547] (-1806.741) (-1804.915) (-1807.406) -- 0:00:41
      402000 -- (-1804.334) (-1807.002) [-1805.270] (-1806.445) * [-1803.985] (-1804.566) (-1807.569) (-1805.859) -- 0:00:41
      402500 -- (-1804.737) (-1806.057) [-1812.740] (-1807.106) * (-1803.916) (-1806.152) [-1805.632] (-1805.980) -- 0:00:41
      403000 -- (-1806.535) [-1807.273] (-1807.251) (-1808.113) * (-1805.854) [-1803.361] (-1806.088) (-1805.410) -- 0:00:41
      403500 -- [-1804.174] (-1805.247) (-1806.938) (-1807.582) * (-1807.190) [-1803.411] (-1806.174) (-1805.412) -- 0:00:41
      404000 -- (-1804.043) (-1803.714) (-1805.128) [-1804.555] * (-1804.242) (-1804.095) [-1804.546] (-1805.710) -- 0:00:41
      404500 -- [-1805.056] (-1806.748) (-1806.880) (-1804.555) * (-1804.392) [-1803.898] (-1804.845) (-1805.757) -- 0:00:41
      405000 -- (-1806.286) (-1805.909) (-1804.727) [-1804.903] * (-1810.853) (-1807.234) (-1806.514) [-1804.985] -- 0:00:41

      Average standard deviation of split frequencies: 0.012894

      405500 -- (-1807.883) (-1804.037) (-1805.182) [-1804.045] * (-1810.177) [-1807.162] (-1806.878) (-1806.134) -- 0:00:41
      406000 -- (-1805.125) (-1805.080) [-1805.505] (-1805.009) * (-1811.896) [-1806.725] (-1804.497) (-1804.998) -- 0:00:40
      406500 -- [-1803.519] (-1805.802) (-1804.061) (-1807.357) * [-1809.118] (-1805.132) (-1804.472) (-1805.335) -- 0:00:40
      407000 -- (-1806.218) [-1803.910] (-1805.219) (-1804.640) * (-1807.379) [-1804.707] (-1803.566) (-1805.423) -- 0:00:40
      407500 --