--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:39:14 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1339/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2120.34 -2123.28 2 -2120.36 -2125.44 -------------------------------------- TOTAL -2120.35 -2124.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899146 0.088910 0.378539 1.497152 0.862669 832.77 1140.49 1.001 r(A<->C){all} 0.157979 0.017199 0.000122 0.431004 0.123115 167.27 201.42 1.005 r(A<->G){all} 0.180790 0.021744 0.000161 0.482132 0.144867 152.98 223.34 1.007 r(A<->T){all} 0.166610 0.020798 0.000075 0.459213 0.126558 217.92 230.07 1.002 r(C<->G){all} 0.166227 0.019595 0.000144 0.452034 0.130329 102.13 138.86 1.010 r(C<->T){all} 0.159234 0.017823 0.000030 0.423067 0.126687 288.98 314.71 1.001 r(G<->T){all} 0.169161 0.021391 0.000060 0.473843 0.125348 129.16 144.76 1.001 pi(A){all} 0.195992 0.000100 0.176050 0.215564 0.195966 1119.70 1229.60 1.000 pi(C){all} 0.348534 0.000133 0.326733 0.371374 0.348518 1367.55 1383.97 1.002 pi(G){all} 0.286474 0.000125 0.265396 0.309250 0.286409 1341.25 1374.00 1.000 pi(T){all} 0.169000 0.000096 0.150566 0.188426 0.168907 1055.70 1116.64 1.000 alpha{1,2} 0.438335 0.254580 0.000109 1.417447 0.260389 1294.41 1337.33 1.000 alpha{3} 0.450780 0.240929 0.000217 1.442928 0.286566 645.12 967.68 1.000 pinvar{all} 0.999019 0.000001 0.996851 0.999998 0.999367 1018.68 1041.59 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2047.531568 Model 2: PositiveSelection -2047.531581 Model 0: one-ratio -2047.531592 Model 7: beta -2047.531552 Model 8: beta&w>1 -2047.531509 Model 0 vs 1 4.799999987881165E-5 Model 2 vs 1 2.5999999706982635E-5 Model 8 vs 7 8.600000001024455E-5
>C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=525 C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA ************************************************** C1 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C2 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C3 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C4 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C5 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C6 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL ************************************************** C1 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C2 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C3 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C4 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C5 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C6 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS ************************************************** C1 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C2 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C3 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C4 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C5 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C6 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN ************************************************** C1 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C2 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C3 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C4 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C5 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C6 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG ************************************************** C1 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C2 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C3 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C4 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C5 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C6 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF ************************************************** C1 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C2 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C3 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C4 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C5 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C6 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF ************************************************** C1 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C2 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C3 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C4 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C5 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C6 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ************************************************** C1 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C2 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C3 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C4 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C5 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C6 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL ************************************************** C1 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C2 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C3 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C4 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C5 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C6 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ************************************************** C1 ACAVPPIIGYLTSGKLPATDTYCPA C2 ACAVPPIIGYLTSGKLPATDTYCPA C3 ACAVPPIIGYLTSGKLPATDTYCPA C4 ACAVPPIIGYLTSGKLPATDTYCPA C5 ACAVPPIIGYLTSGKLPATDTYCPA C6 ACAVPPIIGYLTSGKLPATDTYCPA ************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] Relaxation Summary: [15750]--->[15750] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.567 Mb, Max= 31.129 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA ************************************************** C1 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C2 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C3 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C4 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C5 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C6 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL ************************************************** C1 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C2 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C3 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C4 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C5 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C6 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS ************************************************** C1 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C2 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C3 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C4 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C5 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C6 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN ************************************************** C1 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C2 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C3 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C4 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C5 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C6 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG ************************************************** C1 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C2 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C3 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C4 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C5 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C6 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF ************************************************** C1 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C2 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C3 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C4 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C5 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C6 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF ************************************************** C1 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C2 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C3 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C4 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C5 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C6 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ************************************************** C1 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C2 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C3 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C4 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C5 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C6 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL ************************************************** C1 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C2 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C3 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C4 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C5 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C6 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ************************************************** C1 ACAVPPIIGYLTSGKLPATDTYCPA C2 ACAVPPIIGYLTSGKLPATDTYCPA C3 ACAVPPIIGYLTSGKLPATDTYCPA C4 ACAVPPIIGYLTSGKLPATDTYCPA C5 ACAVPPIIGYLTSGKLPATDTYCPA C6 ACAVPPIIGYLTSGKLPATDTYCPA ************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C2 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C3 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C4 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C5 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C6 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT ************************************************** C1 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C2 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C3 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C4 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C5 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C6 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ************************************************** C1 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C2 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C3 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C4 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C5 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C6 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ************************************************** C1 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C2 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C3 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C4 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C5 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C6 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA ************************************************** C1 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C2 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C3 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C4 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C5 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C6 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG ************************************************** C1 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C2 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C3 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C4 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C5 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C6 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC ************************************************** C1 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C2 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C3 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C4 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C5 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C6 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC ************************************************** C1 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C2 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C3 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C4 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C5 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C6 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG ************************************************** C1 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C2 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C3 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C4 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C5 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C6 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG ************************************************** C1 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C2 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C3 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C4 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C5 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C6 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG ************************************************** C1 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C2 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C3 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C4 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C5 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C6 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA ************************************************** C1 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C2 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C3 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C4 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C5 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C6 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC ************************************************** C1 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C2 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C3 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C4 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C5 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C6 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ************************************************** C1 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C2 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C3 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C4 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C5 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C6 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC ************************************************** C1 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C2 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C3 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C4 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C5 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C6 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC ************************************************** C1 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C2 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C3 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C4 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C5 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C6 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT ************************************************** C1 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C2 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C3 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C4 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C5 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C6 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG ************************************************** C1 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C2 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C3 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C4 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C5 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C6 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC ************************************************** C1 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C2 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C3 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C4 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C5 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C6 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG ************************************************** C1 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C2 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C3 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C4 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C5 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C6 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG ************************************************** C1 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C2 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C3 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C4 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C5 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C6 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC ************************************************** C1 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C2 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C3 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C4 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C5 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C6 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC ************************************************** C1 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C2 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C3 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C4 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C5 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C6 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT ************************************************** C1 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C2 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C3 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C4 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C5 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C6 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC ************************************************** C1 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C2 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C3 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C4 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C5 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C6 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG ************************************************** C1 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C2 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C3 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C4 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C5 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C6 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA ************************************************** C1 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C2 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C3 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C4 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C5 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C6 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC ************************************************** C1 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C2 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C3 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C4 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C5 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C6 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT ************************************************** C1 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C2 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C3 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C4 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C5 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C6 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA ************************************************** C1 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C2 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C3 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C4 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C5 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C6 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG ************************************************** C1 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C2 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C3 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C4 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C5 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C6 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC ************************************************** C1 CGCAACTGACACCTACTGTCCCGCC C2 CGCAACTGACACCTACTGTCCCGCC C3 CGCAACTGACACCTACTGTCCCGCC C4 CGCAACTGACACCTACTGTCCCGCC C5 CGCAACTGACACCTACTGTCCCGCC C6 CGCAACTGACACCTACTGTCCCGCC ************************* >C1 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C2 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C3 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C4 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C5 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C6 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1575 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858662 Setting output file names to "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1367232649 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5937814289 Seed = 1357691827 Swapseed = 1579858662 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3524.924980 -- -24.965149 Chain 2 -- -3524.924980 -- -24.965149 Chain 3 -- -3524.925518 -- -24.965149 Chain 4 -- -3524.925518 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3524.925518 -- -24.965149 Chain 2 -- -3524.925518 -- -24.965149 Chain 3 -- -3524.925317 -- -24.965149 Chain 4 -- -3524.925518 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3524.925] (-3524.925) (-3524.926) (-3524.926) * [-3524.926] (-3524.926) (-3524.925) (-3524.926) 500 -- (-2173.726) (-2150.912) [-2138.103] (-2178.388) * (-2130.016) (-2133.516) (-2169.769) [-2135.874] -- 0:00:00 1000 -- (-2126.960) [-2131.461] (-2128.273) (-2140.681) * (-2127.988) (-2130.828) (-2153.030) [-2129.085] -- 0:00:00 1500 -- (-2126.056) [-2127.054] (-2128.615) (-2140.056) * (-2129.869) [-2128.759] (-2140.090) (-2132.646) -- 0:00:00 2000 -- [-2131.565] (-2131.500) (-2130.096) (-2131.220) * [-2133.151] (-2131.403) (-2136.567) (-2127.050) -- 0:00:00 2500 -- (-2130.620) (-2137.879) (-2127.701) [-2128.551] * (-2136.183) [-2128.298] (-2130.881) (-2135.277) -- 0:00:00 3000 -- (-2133.299) [-2124.758] (-2129.071) (-2128.866) * (-2125.879) [-2124.509] (-2126.656) (-2136.442) -- 0:00:00 3500 -- (-2136.121) (-2130.517) (-2127.373) [-2122.484] * (-2133.337) (-2132.087) [-2128.170] (-2128.240) -- 0:00:00 4000 -- (-2130.231) [-2126.409] (-2132.799) (-2128.254) * (-2132.892) (-2128.502) [-2126.877] (-2130.315) -- 0:00:00 4500 -- (-2126.841) (-2128.339) [-2126.115] (-2127.948) * [-2127.313] (-2126.247) (-2132.859) (-2129.098) -- 0:00:00 5000 -- (-2131.855) [-2127.098] (-2130.959) (-2125.104) * (-2124.237) (-2137.807) (-2134.152) [-2126.479] -- 0:00:00 Average standard deviation of split frequencies: 0.078567 5500 -- (-2132.022) (-2128.558) (-2139.482) [-2127.171] * [-2131.637] (-2131.581) (-2127.159) (-2127.597) -- 0:00:00 6000 -- (-2125.749) (-2132.939) (-2135.098) [-2125.506] * (-2126.275) (-2127.495) [-2129.110] (-2130.829) -- 0:00:00 6500 -- (-2137.519) (-2128.602) (-2130.677) [-2125.678] * [-2129.438] (-2130.868) (-2135.992) (-2124.272) -- 0:00:00 7000 -- [-2124.956] (-2132.342) (-2129.505) (-2128.248) * (-2139.128) (-2132.694) [-2126.360] (-2136.337) -- 0:00:00 7500 -- [-2135.581] (-2128.591) (-2139.721) (-2128.476) * (-2127.618) [-2126.635] (-2137.203) (-2128.899) -- 0:00:00 8000 -- (-2136.855) [-2127.730] (-2129.481) (-2126.136) * (-2132.119) (-2132.585) (-2125.804) [-2127.446] -- 0:02:04 8500 -- (-2132.127) (-2131.747) (-2128.965) [-2130.094] * [-2128.776] (-2129.859) (-2135.470) (-2136.692) -- 0:01:56 9000 -- (-2127.880) (-2128.103) (-2131.854) [-2125.027] * (-2127.953) (-2125.650) (-2127.252) [-2132.576] -- 0:01:50 9500 -- (-2142.197) [-2131.432] (-2127.983) (-2134.645) * (-2135.318) [-2131.973] (-2133.359) (-2127.676) -- 0:01:44 10000 -- (-2131.951) [-2133.200] (-2131.318) (-2123.534) * (-2133.596) (-2143.565) (-2127.440) [-2129.328] -- 0:01:39 Average standard deviation of split frequencies: 0.072106 10500 -- (-2129.305) (-2129.640) [-2131.835] (-2129.563) * [-2134.159] (-2129.952) (-2129.371) (-2134.039) -- 0:01:34 11000 -- (-2128.332) (-2141.872) (-2128.410) [-2129.099] * (-2125.809) (-2131.853) [-2129.341] (-2129.115) -- 0:01:29 11500 -- (-2127.432) [-2130.021] (-2129.798) (-2128.200) * [-2127.623] (-2126.437) (-2131.605) (-2140.905) -- 0:01:25 12000 -- (-2132.461) (-2129.693) [-2127.439] (-2127.651) * (-2128.148) [-2129.209] (-2125.640) (-2129.359) -- 0:01:22 12500 -- (-2127.298) (-2121.381) [-2127.321] (-2135.496) * (-2131.531) (-2126.600) [-2127.481] (-2131.042) -- 0:01:19 13000 -- [-2130.452] (-2121.924) (-2132.153) (-2125.829) * (-2130.211) (-2131.122) [-2125.461] (-2139.617) -- 0:01:15 13500 -- (-2129.211) (-2121.015) (-2126.773) [-2125.304] * [-2126.685] (-2125.236) (-2130.115) (-2133.849) -- 0:01:13 14000 -- [-2129.899] (-2120.208) (-2127.945) (-2134.565) * [-2129.261] (-2130.941) (-2129.975) (-2125.621) -- 0:01:10 14500 -- (-2124.757) (-2119.634) (-2127.899) [-2128.492] * (-2132.528) (-2132.551) [-2127.443] (-2127.072) -- 0:01:07 15000 -- (-2125.752) (-2126.096) [-2129.778] (-2130.697) * [-2127.512] (-2125.292) (-2134.160) (-2129.783) -- 0:01:05 Average standard deviation of split frequencies: 0.055979 15500 -- (-2128.678) (-2121.120) (-2131.917) [-2130.204] * (-2129.585) [-2125.158] (-2131.422) (-2127.211) -- 0:01:03 16000 -- [-2121.627] (-2123.399) (-2138.074) (-2136.242) * (-2133.763) (-2125.046) [-2134.664] (-2128.068) -- 0:01:01 16500 -- [-2122.494] (-2122.637) (-2133.015) (-2132.878) * (-2131.545) (-2124.891) [-2130.928] (-2129.598) -- 0:00:59 17000 -- [-2120.025] (-2121.359) (-2125.253) (-2130.712) * [-2130.179] (-2123.887) (-2124.714) (-2131.352) -- 0:00:57 17500 -- [-2120.960] (-2125.102) (-2134.424) (-2127.776) * (-2139.181) [-2123.889] (-2122.228) (-2130.734) -- 0:00:56 18000 -- [-2122.611] (-2123.782) (-2132.847) (-2130.256) * [-2132.797] (-2121.488) (-2121.745) (-2133.230) -- 0:00:54 18500 -- (-2123.336) [-2122.818] (-2129.195) (-2132.290) * (-2134.255) (-2120.991) [-2124.490] (-2128.278) -- 0:00:53 19000 -- (-2120.453) (-2120.699) (-2129.276) [-2131.355] * [-2128.144] (-2121.874) (-2126.060) (-2128.281) -- 0:00:51 19500 -- (-2120.807) (-2122.475) (-2133.899) [-2129.080] * [-2128.301] (-2124.190) (-2125.578) (-2128.721) -- 0:00:50 20000 -- (-2121.094) (-2120.248) (-2143.381) [-2129.963] * (-2130.582) (-2134.058) (-2122.953) [-2127.986] -- 0:00:49 Average standard deviation of split frequencies: 0.055012 20500 -- (-2120.154) [-2121.060] (-2142.577) (-2132.258) * (-2129.183) [-2132.699] (-2126.158) (-2126.214) -- 0:00:47 21000 -- [-2121.406] (-2119.343) (-2131.278) (-2127.047) * [-2125.490] (-2122.273) (-2124.864) (-2126.220) -- 0:00:46 21500 -- (-2120.769) (-2120.766) [-2128.005] (-2126.622) * (-2134.871) (-2121.985) [-2123.463] (-2127.738) -- 0:01:31 22000 -- (-2119.956) (-2121.266) (-2128.078) [-2126.053] * (-2132.572) (-2120.753) [-2123.691] (-2131.247) -- 0:01:28 22500 -- (-2119.953) [-2123.683] (-2131.575) (-2133.158) * (-2131.331) [-2122.332] (-2123.370) (-2123.948) -- 0:01:26 23000 -- (-2120.836) (-2123.605) [-2127.249] (-2134.826) * [-2126.947] (-2121.185) (-2123.964) (-2124.507) -- 0:01:24 23500 -- (-2119.742) (-2124.621) (-2130.294) [-2129.829] * [-2132.023] (-2123.003) (-2131.195) (-2127.475) -- 0:01:23 24000 -- (-2122.218) (-2123.357) [-2131.873] (-2137.119) * (-2132.964) (-2119.765) [-2122.750] (-2124.686) -- 0:01:21 24500 -- (-2121.975) [-2122.986] (-2160.780) (-2126.044) * (-2132.670) [-2119.748] (-2125.449) (-2126.562) -- 0:01:19 25000 -- (-2119.825) (-2122.152) [-2120.750] (-2129.923) * (-2130.803) [-2120.808] (-2124.877) (-2126.962) -- 0:01:18 Average standard deviation of split frequencies: 0.038075 25500 -- (-2120.393) [-2122.712] (-2121.111) (-2142.985) * (-2131.952) (-2120.718) [-2119.631] (-2125.552) -- 0:01:16 26000 -- [-2121.530] (-2121.891) (-2122.194) (-2129.189) * (-2128.795) [-2119.279] (-2119.291) (-2135.263) -- 0:01:14 26500 -- [-2121.968] (-2122.451) (-2122.146) (-2134.714) * [-2126.056] (-2119.745) (-2120.437) (-2130.852) -- 0:01:13 27000 -- (-2121.978) (-2120.171) (-2122.138) [-2131.174] * [-2128.575] (-2120.550) (-2120.747) (-2127.323) -- 0:01:12 27500 -- (-2122.052) (-2120.011) [-2120.659] (-2134.201) * [-2130.401] (-2119.855) (-2122.499) (-2129.606) -- 0:01:10 28000 -- (-2121.744) (-2119.773) (-2121.689) [-2129.888] * (-2128.350) [-2119.631] (-2122.499) (-2127.782) -- 0:01:09 28500 -- (-2121.164) (-2122.015) (-2122.096) [-2124.778] * [-2128.010] (-2122.274) (-2121.092) (-2128.164) -- 0:01:08 29000 -- (-2121.948) [-2122.115] (-2124.503) (-2127.661) * (-2131.859) (-2121.215) [-2122.506] (-2126.410) -- 0:01:06 29500 -- (-2121.051) (-2120.062) [-2124.607] (-2130.021) * (-2131.743) (-2121.299) (-2121.129) [-2131.593] -- 0:01:05 30000 -- (-2121.046) (-2120.186) [-2126.126] (-2127.705) * [-2133.038] (-2122.692) (-2121.520) (-2131.063) -- 0:01:04 Average standard deviation of split frequencies: 0.033980 30500 -- (-2126.186) (-2119.938) [-2126.421] (-2130.952) * (-2131.536) (-2123.019) (-2120.391) [-2126.106] -- 0:01:03 31000 -- [-2125.770] (-2119.930) (-2125.925) (-2132.761) * (-2141.056) [-2123.712] (-2120.520) (-2129.428) -- 0:01:02 31500 -- [-2123.526] (-2119.925) (-2123.658) (-2130.315) * [-2128.005] (-2120.087) (-2123.126) (-2136.361) -- 0:01:01 32000 -- (-2123.950) (-2121.490) (-2126.074) [-2127.954] * (-2132.834) [-2120.587] (-2122.426) (-2130.699) -- 0:01:00 32500 -- [-2124.997] (-2122.133) (-2121.966) (-2127.840) * [-2128.247] (-2121.888) (-2122.605) (-2134.970) -- 0:00:59 33000 -- (-2121.793) (-2120.198) (-2121.331) [-2126.662] * (-2128.268) (-2125.942) (-2125.460) [-2122.323] -- 0:00:58 33500 -- (-2120.476) [-2120.095] (-2119.983) (-2128.316) * [-2125.680] (-2122.202) (-2123.852) (-2120.311) -- 0:00:57 34000 -- [-2121.326] (-2119.841) (-2119.792) (-2129.679) * [-2124.887] (-2121.445) (-2122.583) (-2121.117) -- 0:00:56 34500 -- (-2122.313) [-2120.629] (-2119.422) (-2128.268) * (-2131.889) [-2122.533] (-2124.755) (-2123.017) -- 0:00:55 35000 -- [-2122.149] (-2124.098) (-2122.987) (-2127.649) * (-2132.050) [-2122.172] (-2124.970) (-2123.414) -- 0:00:55 Average standard deviation of split frequencies: 0.044797 35500 -- [-2124.383] (-2120.746) (-2123.152) (-2128.802) * [-2133.469] (-2120.884) (-2126.665) (-2122.781) -- 0:01:21 36000 -- (-2121.400) (-2125.203) [-2123.330] (-2125.532) * (-2131.521) (-2120.998) (-2121.617) [-2122.676] -- 0:01:20 36500 -- (-2121.707) (-2120.294) (-2121.988) [-2125.105] * [-2129.690] (-2120.881) (-2123.238) (-2123.066) -- 0:01:19 37000 -- [-2122.879] (-2119.776) (-2120.688) (-2130.937) * (-2131.739) (-2122.210) [-2122.827] (-2124.791) -- 0:01:18 37500 -- (-2123.049) (-2120.896) [-2119.826] (-2137.726) * [-2127.194] (-2122.235) (-2120.471) (-2120.766) -- 0:01:17 38000 -- (-2122.112) (-2121.611) [-2120.706] (-2135.209) * (-2133.446) (-2120.705) (-2119.454) [-2120.831] -- 0:01:15 38500 -- (-2122.263) (-2120.516) [-2119.962] (-2130.759) * (-2131.528) (-2121.576) (-2119.215) [-2120.325] -- 0:01:14 39000 -- (-2122.539) (-2119.547) [-2118.970] (-2128.100) * (-2126.252) (-2121.539) [-2119.243] (-2122.963) -- 0:01:13 39500 -- (-2122.428) (-2120.162) [-2118.865] (-2136.368) * (-2137.293) (-2123.959) [-2119.575] (-2121.051) -- 0:01:12 40000 -- (-2120.255) (-2121.287) [-2119.081] (-2136.657) * (-2130.757) (-2124.121) [-2119.357] (-2120.300) -- 0:01:12 Average standard deviation of split frequencies: 0.047656 40500 -- (-2121.030) (-2124.408) (-2119.011) [-2128.534] * (-2124.560) (-2122.749) (-2119.357) [-2119.109] -- 0:01:11 41000 -- (-2119.894) (-2124.108) [-2119.032] (-2127.032) * (-2134.113) (-2123.936) [-2120.512] (-2118.999) -- 0:01:10 41500 -- (-2119.882) (-2121.980) (-2119.065) [-2126.642] * (-2136.152) (-2120.233) [-2120.954] (-2119.625) -- 0:01:09 42000 -- (-2121.134) [-2120.719] (-2122.143) (-2128.962) * (-2134.633) (-2121.465) [-2125.467] (-2122.080) -- 0:01:08 42500 -- (-2120.727) (-2119.891) (-2123.077) [-2127.470] * (-2132.073) [-2119.889] (-2124.147) (-2122.080) -- 0:01:07 43000 -- (-2119.695) [-2119.030] (-2121.820) (-2126.677) * (-2129.602) (-2120.931) (-2122.705) [-2122.216] -- 0:01:06 43500 -- (-2121.855) [-2118.999] (-2122.080) (-2134.567) * (-2131.835) (-2120.927) (-2122.798) [-2121.608] -- 0:01:05 44000 -- (-2125.830) (-2120.274) [-2121.315] (-2130.802) * (-2128.507) [-2119.271] (-2122.156) (-2120.615) -- 0:01:05 44500 -- (-2123.491) [-2120.825] (-2123.243) (-2128.596) * [-2126.431] (-2119.566) (-2122.149) (-2120.551) -- 0:01:04 45000 -- (-2120.961) (-2122.428) [-2121.162] (-2126.786) * [-2127.639] (-2119.836) (-2120.312) (-2120.482) -- 0:01:03 Average standard deviation of split frequencies: 0.043041 45500 -- (-2121.983) (-2121.297) [-2123.164] (-2123.465) * (-2132.868) [-2119.853] (-2119.996) (-2119.381) -- 0:01:02 46000 -- [-2121.217] (-2123.097) (-2124.519) (-2127.916) * [-2126.739] (-2119.390) (-2119.218) (-2121.041) -- 0:01:02 46500 -- [-2119.069] (-2124.983) (-2128.951) (-2137.626) * (-2132.120) [-2120.731] (-2120.522) (-2123.291) -- 0:01:01 47000 -- (-2120.392) (-2126.004) (-2127.638) [-2131.381] * (-2130.251) [-2121.040] (-2119.979) (-2118.934) -- 0:01:00 47500 -- (-2121.961) (-2121.528) (-2120.843) [-2127.710] * (-2130.230) (-2120.855) [-2118.723] (-2119.706) -- 0:01:00 48000 -- (-2121.492) (-2123.359) [-2120.226] (-2139.350) * (-2129.972) (-2121.027) (-2119.251) [-2118.674] -- 0:00:59 48500 -- [-2120.762] (-2120.339) (-2125.280) (-2133.316) * [-2130.077] (-2119.455) (-2119.607) (-2118.741) -- 0:00:58 49000 -- (-2119.594) [-2119.284] (-2122.231) (-2133.365) * (-2131.658) [-2120.240] (-2121.014) (-2119.013) -- 0:00:58 49500 -- (-2122.028) [-2120.830] (-2122.422) (-2130.608) * [-2128.478] (-2126.728) (-2120.723) (-2119.588) -- 0:01:16 50000 -- (-2119.915) (-2120.268) (-2121.487) [-2129.257] * (-2132.296) (-2122.406) [-2120.592] (-2119.553) -- 0:01:16 Average standard deviation of split frequencies: 0.043862 50500 -- [-2119.286] (-2119.502) (-2119.794) (-2129.498) * [-2134.426] (-2122.375) (-2120.556) (-2119.054) -- 0:01:15 51000 -- (-2119.292) [-2120.004] (-2120.040) (-2128.379) * (-2129.872) (-2125.364) [-2119.811] (-2120.872) -- 0:01:14 51500 -- (-2119.874) (-2119.747) [-2119.499] (-2129.786) * (-2138.227) [-2122.734] (-2119.734) (-2120.090) -- 0:01:13 52000 -- [-2119.331] (-2119.240) (-2122.965) (-2126.597) * (-2128.615) [-2123.636] (-2120.775) (-2123.994) -- 0:01:12 52500 -- (-2119.604) (-2119.929) (-2121.034) [-2132.278] * (-2133.737) (-2122.628) [-2122.781] (-2123.637) -- 0:01:12 53000 -- (-2121.728) [-2119.749] (-2128.527) (-2129.700) * (-2136.040) (-2122.711) (-2120.820) [-2120.956] -- 0:01:11 53500 -- (-2121.653) [-2120.022] (-2122.961) (-2131.644) * (-2128.797) (-2121.241) [-2120.534] (-2121.734) -- 0:01:10 54000 -- (-2122.462) (-2120.016) (-2122.615) [-2130.173] * [-2132.624] (-2123.583) (-2120.228) (-2120.675) -- 0:01:10 54500 -- (-2121.826) (-2120.238) [-2124.220] (-2126.281) * (-2131.099) (-2119.640) [-2123.000] (-2119.961) -- 0:01:09 55000 -- (-2122.664) (-2120.236) (-2127.930) [-2130.331] * (-2130.938) (-2120.057) (-2125.073) [-2122.561] -- 0:01:08 Average standard deviation of split frequencies: 0.037279 55500 -- (-2122.643) (-2120.944) [-2124.796] (-2134.903) * (-2129.287) (-2123.086) [-2123.810] (-2125.227) -- 0:01:08 56000 -- (-2122.648) (-2120.944) (-2123.489) [-2127.664] * [-2130.139] (-2120.978) (-2120.481) (-2122.658) -- 0:01:07 56500 -- (-2121.339) (-2121.326) [-2123.848] (-2136.224) * (-2127.091) [-2121.719] (-2120.809) (-2122.240) -- 0:01:06 57000 -- (-2123.909) [-2120.425] (-2125.596) (-2130.484) * (-2127.514) (-2121.669) (-2122.211) [-2120.559] -- 0:01:06 57500 -- [-2124.675] (-2120.487) (-2123.584) (-2132.104) * (-2127.584) (-2121.789) (-2123.047) [-2122.479] -- 0:01:05 58000 -- (-2127.002) (-2122.544) [-2123.147] (-2132.119) * [-2126.684] (-2121.770) (-2123.538) (-2120.113) -- 0:01:04 58500 -- (-2122.692) (-2121.649) (-2121.182) [-2127.886] * (-2137.040) (-2121.336) [-2123.584] (-2120.439) -- 0:01:04 59000 -- (-2123.570) [-2123.967] (-2121.122) (-2129.721) * (-2124.002) (-2120.871) (-2125.140) [-2120.955] -- 0:01:03 59500 -- (-2121.734) (-2122.436) [-2121.675] (-2132.286) * [-2127.209] (-2121.975) (-2122.154) (-2122.163) -- 0:01:03 60000 -- (-2123.618) (-2120.110) (-2122.085) [-2128.708] * [-2129.454] (-2122.467) (-2122.995) (-2123.772) -- 0:01:02 Average standard deviation of split frequencies: 0.034762 60500 -- (-2122.536) (-2122.661) [-2122.078] (-2130.374) * (-2134.211) [-2122.379] (-2120.126) (-2121.161) -- 0:01:02 61000 -- (-2121.393) (-2122.015) (-2122.412) [-2128.852] * [-2133.095] (-2122.842) (-2119.946) (-2119.147) -- 0:01:01 61500 -- [-2120.152] (-2119.548) (-2126.258) (-2133.963) * (-2127.915) [-2121.008] (-2120.752) (-2119.817) -- 0:01:01 62000 -- (-2120.123) (-2119.548) [-2124.985] (-2141.390) * (-2131.848) (-2120.467) (-2122.346) [-2119.638] -- 0:01:00 62500 -- (-2120.881) [-2119.210] (-2123.135) (-2135.683) * (-2126.664) (-2121.600) [-2120.226] (-2119.161) -- 0:01:00 63000 -- (-2120.609) [-2119.517] (-2123.190) (-2126.357) * [-2131.909] (-2121.019) (-2121.302) (-2118.896) -- 0:00:59 63500 -- [-2121.498] (-2119.422) (-2126.475) (-2133.488) * (-2133.890) (-2120.600) [-2121.699] (-2120.396) -- 0:00:58 64000 -- (-2119.909) (-2119.187) (-2125.578) [-2125.519] * (-2132.730) [-2120.636] (-2122.492) (-2119.503) -- 0:01:13 64500 -- (-2121.757) [-2120.676] (-2124.443) (-2133.586) * (-2126.535) (-2121.424) [-2125.399] (-2125.254) -- 0:01:12 65000 -- (-2123.290) (-2119.975) (-2123.821) [-2139.017] * [-2128.421] (-2122.806) (-2122.898) (-2119.755) -- 0:01:11 Average standard deviation of split frequencies: 0.032466 65500 -- (-2121.130) (-2119.977) (-2124.006) [-2131.646] * (-2127.643) [-2122.442] (-2134.114) (-2119.743) -- 0:01:11 66000 -- [-2121.257] (-2120.302) (-2126.817) (-2131.838) * [-2126.894] (-2121.524) (-2124.761) (-2121.438) -- 0:01:10 66500 -- (-2119.534) [-2119.466] (-2124.556) (-2131.131) * (-2138.095) (-2121.198) (-2121.126) [-2120.673] -- 0:01:10 67000 -- (-2119.229) [-2120.286] (-2124.359) (-2130.997) * (-2135.150) [-2120.700] (-2121.251) (-2122.526) -- 0:01:09 67500 -- (-2120.804) [-2119.713] (-2125.637) (-2128.124) * (-2129.733) (-2120.999) (-2120.939) [-2120.326] -- 0:01:09 68000 -- [-2120.653] (-2120.696) (-2121.280) (-2129.039) * (-2134.766) (-2124.169) [-2119.574] (-2119.201) -- 0:01:08 68500 -- (-2125.084) [-2121.655] (-2121.448) (-2137.011) * (-2126.768) [-2121.969] (-2123.162) (-2120.747) -- 0:01:07 69000 -- (-2124.331) (-2121.990) [-2121.230] (-2132.146) * [-2126.854] (-2122.073) (-2121.231) (-2120.724) -- 0:01:07 69500 -- (-2123.653) [-2119.777] (-2121.138) (-2124.984) * (-2135.399) [-2121.312] (-2121.270) (-2118.796) -- 0:01:06 70000 -- [-2119.536] (-2120.247) (-2120.670) (-2126.270) * (-2136.161) (-2120.506) [-2119.785] (-2120.111) -- 0:01:06 Average standard deviation of split frequencies: 0.025730 70500 -- (-2119.801) [-2120.162] (-2125.193) (-2125.893) * [-2139.365] (-2120.515) (-2120.009) (-2118.825) -- 0:01:05 71000 -- [-2122.022] (-2120.527) (-2125.965) (-2134.006) * [-2127.801] (-2121.162) (-2119.834) (-2118.981) -- 0:01:05 71500 -- (-2119.933) (-2121.860) [-2123.265] (-2126.342) * [-2123.781] (-2121.445) (-2121.506) (-2119.923) -- 0:01:04 72000 -- [-2121.009] (-2123.212) (-2123.401) (-2138.649) * (-2126.735) (-2121.468) (-2119.827) [-2119.923] -- 0:01:04 72500 -- [-2119.670] (-2121.320) (-2124.357) (-2126.922) * (-2124.361) (-2124.095) [-2119.282] (-2119.923) -- 0:01:03 73000 -- (-2122.544) (-2121.698) [-2123.451] (-2136.392) * (-2130.246) (-2124.383) [-2119.866] (-2120.012) -- 0:01:03 73500 -- [-2119.178] (-2122.103) (-2123.030) (-2129.156) * (-2131.182) (-2123.132) [-2121.718] (-2121.077) -- 0:01:03 74000 -- (-2118.998) (-2124.650) [-2124.239] (-2129.849) * [-2132.331] (-2125.031) (-2119.814) (-2120.437) -- 0:01:02 74500 -- (-2119.034) (-2120.275) (-2125.785) [-2127.208] * (-2130.825) (-2120.401) [-2120.281] (-2119.965) -- 0:01:02 75000 -- [-2119.438] (-2123.309) (-2124.488) (-2122.877) * (-2134.603) [-2120.219] (-2120.010) (-2119.423) -- 0:01:01 Average standard deviation of split frequencies: 0.026361 75500 -- (-2119.416) [-2123.163] (-2125.631) (-2122.387) * [-2130.344] (-2119.747) (-2119.987) (-2119.433) -- 0:01:01 76000 -- (-2119.187) (-2122.711) (-2125.819) [-2123.308] * (-2136.173) (-2121.635) [-2119.687] (-2119.921) -- 0:01:00 76500 -- (-2119.474) (-2122.567) [-2120.853] (-2121.587) * (-2132.483) (-2124.001) (-2120.936) [-2120.175] -- 0:01:00 77000 -- [-2120.471] (-2123.669) (-2121.553) (-2122.637) * (-2133.374) (-2123.114) (-2120.704) [-2123.670] -- 0:00:59 77500 -- (-2122.173) (-2122.148) [-2121.564] (-2123.887) * (-2132.305) (-2124.529) (-2119.961) [-2119.650] -- 0:00:59 78000 -- (-2120.414) (-2124.857) [-2121.100] (-2123.352) * (-2133.274) (-2124.346) (-2123.423) [-2119.524] -- 0:00:59 78500 -- [-2123.413] (-2124.168) (-2120.660) (-2121.704) * [-2124.809] (-2131.010) (-2122.196) (-2123.949) -- 0:01:10 79000 -- (-2120.290) [-2122.169] (-2122.271) (-2119.873) * (-2129.193) [-2124.238] (-2121.782) (-2122.562) -- 0:01:09 79500 -- (-2120.529) (-2120.235) [-2120.627] (-2119.848) * (-2127.878) (-2121.914) [-2121.784] (-2119.825) -- 0:01:09 80000 -- (-2121.184) (-2123.114) (-2120.003) [-2120.171] * (-2129.919) (-2121.339) (-2121.230) [-2119.032] -- 0:01:09 Average standard deviation of split frequencies: 0.025323 80500 -- (-2121.332) (-2120.668) [-2119.968] (-2120.077) * [-2134.575] (-2119.755) (-2120.235) (-2118.787) -- 0:01:08 81000 -- (-2121.904) [-2120.429] (-2120.135) (-2120.068) * (-2131.776) [-2120.294] (-2119.347) (-2119.745) -- 0:01:08 81500 -- (-2121.531) (-2121.475) [-2123.157] (-2119.246) * (-2130.924) (-2121.473) (-2119.905) [-2123.707] -- 0:01:07 82000 -- [-2121.884] (-2120.788) (-2118.743) (-2122.734) * (-2138.263) [-2123.458] (-2119.258) (-2118.924) -- 0:01:07 82500 -- (-2121.244) [-2120.930] (-2119.863) (-2121.442) * (-2132.618) (-2122.848) (-2119.706) [-2118.922] -- 0:01:06 83000 -- (-2122.136) (-2126.415) (-2122.940) [-2121.522] * (-2135.972) (-2120.970) (-2120.750) [-2119.020] -- 0:01:06 83500 -- (-2122.218) (-2124.122) (-2129.935) [-2123.947] * [-2134.737] (-2123.666) (-2119.860) (-2121.136) -- 0:01:05 84000 -- [-2121.091] (-2122.999) (-2124.338) (-2123.470) * (-2128.284) (-2125.682) (-2119.736) [-2120.330] -- 0:01:05 84500 -- (-2121.173) [-2120.039] (-2123.093) (-2121.911) * (-2128.244) [-2121.128] (-2122.317) (-2119.022) -- 0:01:05 85000 -- (-2120.647) [-2120.658] (-2123.391) (-2120.768) * (-2129.905) [-2120.737] (-2121.126) (-2118.947) -- 0:01:04 Average standard deviation of split frequencies: 0.023022 85500 -- [-2120.677] (-2120.721) (-2121.196) (-2120.578) * (-2141.948) [-2120.873] (-2119.638) (-2118.923) -- 0:01:04 86000 -- [-2119.870] (-2120.519) (-2121.235) (-2120.254) * (-2137.500) (-2125.202) [-2121.245] (-2120.320) -- 0:01:03 86500 -- (-2121.692) [-2120.338] (-2119.877) (-2120.015) * (-2133.668) (-2122.634) [-2122.533] (-2120.492) -- 0:01:03 87000 -- (-2120.438) (-2123.769) (-2121.303) [-2119.896] * (-2131.024) [-2122.757] (-2125.091) (-2119.372) -- 0:01:02 87500 -- (-2120.263) (-2124.754) [-2120.900] (-2122.423) * (-2128.927) (-2122.755) (-2124.840) [-2119.393] -- 0:01:02 88000 -- (-2121.574) (-2120.123) [-2119.398] (-2121.958) * (-2130.408) (-2124.520) [-2121.758] (-2119.408) -- 0:01:02 88500 -- (-2119.694) [-2120.529] (-2121.311) (-2122.197) * (-2132.384) (-2120.987) [-2120.009] (-2122.024) -- 0:01:01 89000 -- (-2120.061) [-2119.852] (-2120.031) (-2120.604) * [-2125.754] (-2120.230) (-2120.200) (-2121.419) -- 0:01:01 89500 -- [-2120.105] (-2119.849) (-2120.403) (-2121.488) * (-2139.512) [-2122.220] (-2120.103) (-2119.468) -- 0:01:01 90000 -- (-2122.150) (-2120.128) [-2118.837] (-2122.842) * (-2134.374) (-2123.465) [-2119.913] (-2119.105) -- 0:01:00 Average standard deviation of split frequencies: 0.022215 90500 -- (-2120.534) [-2120.294] (-2118.837) (-2126.695) * (-2128.712) (-2122.651) (-2119.594) [-2119.730] -- 0:01:00 91000 -- [-2121.971] (-2119.915) (-2119.946) (-2126.837) * (-2128.337) (-2124.199) (-2120.737) [-2121.209] -- 0:00:59 91500 -- (-2123.217) (-2120.523) (-2119.031) [-2123.923] * (-2128.379) (-2121.981) (-2120.403) [-2120.483] -- 0:00:59 92000 -- (-2123.734) (-2120.448) (-2118.960) [-2124.723] * (-2128.414) (-2120.686) (-2120.150) [-2119.658] -- 0:00:59 92500 -- (-2125.277) (-2120.450) [-2120.357] (-2120.429) * (-2124.598) [-2121.255] (-2120.191) (-2122.075) -- 0:00:58 93000 -- (-2121.908) (-2120.298) (-2119.343) [-2119.523] * [-2122.096] (-2120.858) (-2120.005) (-2122.398) -- 0:00:58 93500 -- (-2120.735) (-2119.965) (-2119.634) [-2119.337] * [-2122.065] (-2120.858) (-2120.293) (-2124.629) -- 0:01:07 94000 -- (-2120.203) [-2120.834] (-2119.634) (-2119.337) * (-2121.991) [-2123.134] (-2121.689) (-2123.761) -- 0:01:07 94500 -- [-2120.198] (-2120.490) (-2119.182) (-2119.394) * (-2121.173) [-2122.390] (-2119.905) (-2121.783) -- 0:01:07 95000 -- [-2122.514] (-2120.131) (-2120.114) (-2120.596) * (-2123.571) [-2121.156] (-2120.404) (-2121.883) -- 0:01:06 Average standard deviation of split frequencies: 0.019887 95500 -- [-2121.965] (-2120.844) (-2121.484) (-2119.003) * (-2121.267) (-2122.661) [-2122.499] (-2121.854) -- 0:01:06 96000 -- (-2126.180) (-2120.843) [-2119.571] (-2119.003) * (-2121.835) (-2122.015) (-2120.997) [-2122.477] -- 0:01:05 96500 -- (-2126.673) (-2120.261) [-2120.275] (-2119.003) * (-2122.950) [-2124.569] (-2120.315) (-2122.578) -- 0:01:05 97000 -- (-2125.940) [-2120.526] (-2119.282) (-2118.978) * [-2123.388] (-2122.676) (-2120.857) (-2121.259) -- 0:01:05 97500 -- (-2126.043) (-2119.409) (-2121.015) [-2119.501] * (-2121.047) (-2122.562) [-2121.273] (-2119.482) -- 0:01:04 98000 -- (-2121.544) (-2119.148) [-2120.620] (-2119.093) * (-2122.416) (-2122.163) (-2120.859) [-2122.075] -- 0:01:04 98500 -- (-2121.259) (-2121.147) (-2119.912) [-2119.057] * (-2127.898) [-2121.461] (-2120.701) (-2120.105) -- 0:01:04 99000 -- [-2121.962] (-2119.637) (-2119.415) (-2119.061) * (-2125.083) (-2121.420) [-2120.846] (-2122.425) -- 0:01:03 99500 -- (-2121.168) (-2119.899) [-2121.677] (-2120.425) * (-2125.246) (-2123.134) [-2120.253] (-2120.957) -- 0:01:03 100000 -- [-2120.558] (-2120.465) (-2120.813) (-2122.049) * (-2120.319) (-2122.220) [-2122.267] (-2120.819) -- 0:01:02 Average standard deviation of split frequencies: 0.017326 100500 -- (-2119.369) (-2123.232) [-2123.095] (-2119.920) * (-2122.457) [-2120.557] (-2119.637) (-2119.899) -- 0:01:02 101000 -- (-2119.653) (-2121.959) (-2121.328) [-2119.874] * (-2119.529) [-2121.514] (-2120.631) (-2119.850) -- 0:01:02 101500 -- (-2119.704) [-2123.662] (-2119.510) (-2121.076) * (-2119.204) (-2124.185) (-2121.014) [-2119.779] -- 0:01:01 102000 -- [-2120.144] (-2121.311) (-2119.274) (-2121.058) * (-2119.158) (-2121.999) (-2120.668) [-2120.156] -- 0:01:01 102500 -- (-2120.099) (-2121.751) (-2119.338) [-2119.168] * (-2120.666) (-2123.457) (-2120.537) [-2119.313] -- 0:01:01 103000 -- (-2119.067) (-2123.155) [-2120.661] (-2120.460) * (-2119.733) (-2123.684) (-2120.271) [-2119.500] -- 0:01:00 103500 -- (-2119.140) (-2122.953) (-2120.981) [-2119.877] * [-2122.730] (-2125.066) (-2120.218) (-2122.567) -- 0:01:00 104000 -- (-2119.140) (-2121.034) (-2120.989) [-2122.486] * [-2122.029] (-2124.908) (-2125.633) (-2123.416) -- 0:01:00 104500 -- (-2119.406) [-2122.962] (-2118.893) (-2122.017) * (-2123.848) (-2121.885) [-2124.193] (-2122.977) -- 0:00:59 105000 -- [-2119.312] (-2120.461) (-2121.604) (-2120.565) * (-2123.668) (-2121.801) (-2123.967) [-2121.393] -- 0:00:59 Average standard deviation of split frequencies: 0.019123 105500 -- [-2119.186] (-2119.558) (-2120.808) (-2119.681) * [-2121.842] (-2121.506) (-2122.837) (-2122.368) -- 0:00:59 106000 -- (-2118.748) (-2120.974) (-2120.757) [-2120.138] * [-2121.898] (-2120.407) (-2121.650) (-2122.519) -- 0:00:59 106500 -- (-2119.928) (-2119.075) [-2121.173] (-2119.359) * [-2118.983] (-2120.426) (-2121.145) (-2121.313) -- 0:00:58 107000 -- (-2123.528) (-2119.075) (-2121.074) [-2119.939] * (-2120.651) [-2120.492] (-2121.025) (-2120.940) -- 0:00:58 107500 -- (-2123.532) (-2120.808) [-2119.931] (-2119.705) * (-2120.754) [-2120.422] (-2120.743) (-2121.553) -- 0:00:58 108000 -- (-2125.383) (-2121.970) [-2125.685] (-2119.260) * (-2121.261) [-2123.604] (-2121.397) (-2121.148) -- 0:01:06 108500 -- (-2124.143) (-2123.044) [-2121.657] (-2121.284) * (-2122.617) [-2120.268] (-2121.713) (-2123.279) -- 0:01:05 109000 -- (-2119.746) (-2119.942) [-2122.386] (-2122.773) * (-2119.983) [-2121.333] (-2121.526) (-2124.251) -- 0:01:05 109500 -- [-2119.204] (-2122.464) (-2123.219) (-2122.966) * (-2120.120) (-2124.583) [-2121.995] (-2119.401) -- 0:01:05 110000 -- (-2119.146) [-2119.549] (-2123.163) (-2119.707) * (-2120.124) (-2122.373) [-2121.181] (-2119.104) -- 0:01:04 Average standard deviation of split frequencies: 0.019505 110500 -- (-2119.147) (-2121.629) [-2121.488] (-2121.455) * [-2119.750] (-2124.786) (-2121.466) (-2121.683) -- 0:01:04 111000 -- (-2119.031) [-2121.044] (-2122.737) (-2122.760) * (-2120.047) (-2121.473) (-2122.624) [-2119.825] -- 0:01:04 111500 -- (-2121.043) [-2122.122] (-2124.082) (-2120.351) * (-2120.006) (-2120.313) (-2122.397) [-2121.087] -- 0:01:03 112000 -- (-2120.243) (-2124.382) (-2122.224) [-2123.736] * [-2120.045] (-2120.750) (-2125.325) (-2121.599) -- 0:01:03 112500 -- (-2120.243) [-2121.430] (-2121.605) (-2119.741) * (-2119.727) (-2120.132) (-2122.089) [-2121.333] -- 0:01:03 113000 -- (-2123.595) [-2122.773] (-2122.221) (-2119.677) * [-2120.945] (-2122.941) (-2121.136) (-2121.391) -- 0:01:02 113500 -- (-2121.391) [-2123.436] (-2122.163) (-2123.443) * [-2124.209] (-2121.498) (-2120.553) (-2121.283) -- 0:01:02 114000 -- [-2120.465] (-2126.620) (-2121.590) (-2121.920) * (-2122.249) (-2121.460) [-2120.138] (-2120.912) -- 0:01:02 114500 -- [-2120.904] (-2126.290) (-2124.456) (-2122.335) * [-2123.754] (-2126.662) (-2120.737) (-2122.345) -- 0:01:01 115000 -- (-2120.542) (-2125.973) (-2124.287) [-2119.191] * (-2122.664) (-2124.571) [-2119.463] (-2122.760) -- 0:01:01 Average standard deviation of split frequencies: 0.019303 115500 -- [-2120.443] (-2123.084) (-2126.475) (-2118.929) * (-2120.647) [-2124.168] (-2122.422) (-2122.461) -- 0:01:01 116000 -- (-2120.443) (-2122.953) (-2121.574) [-2120.597] * (-2120.187) (-2120.178) (-2122.632) [-2121.724] -- 0:01:00 116500 -- [-2122.031] (-2124.839) (-2120.768) (-2119.423) * [-2120.613] (-2122.568) (-2121.344) (-2121.178) -- 0:01:00 117000 -- [-2119.864] (-2120.952) (-2119.922) (-2119.204) * (-2125.833) (-2122.440) (-2121.052) [-2119.602] -- 0:01:00 117500 -- [-2122.072] (-2122.499) (-2121.282) (-2119.748) * (-2120.845) (-2120.535) [-2121.820] (-2120.090) -- 0:01:00 118000 -- (-2119.808) (-2121.771) (-2119.545) [-2120.886] * (-2119.419) [-2122.215] (-2121.841) (-2120.838) -- 0:00:59 118500 -- [-2125.268] (-2120.971) (-2120.821) (-2121.921) * [-2121.631] (-2126.268) (-2123.867) (-2120.882) -- 0:00:59 119000 -- (-2121.560) [-2119.429] (-2120.821) (-2121.972) * (-2121.198) [-2122.587] (-2121.513) (-2120.749) -- 0:00:59 119500 -- (-2121.508) [-2120.854] (-2119.850) (-2121.339) * [-2121.145] (-2121.446) (-2121.609) (-2120.569) -- 0:00:58 120000 -- (-2121.542) [-2120.346] (-2119.859) (-2122.823) * (-2119.789) (-2119.301) (-2121.385) [-2120.458] -- 0:00:58 Average standard deviation of split frequencies: 0.021795 120500 -- (-2121.686) [-2121.955] (-2120.133) (-2123.004) * (-2120.708) (-2120.669) [-2120.493] (-2121.057) -- 0:00:58 121000 -- (-2121.796) [-2121.882] (-2119.974) (-2121.996) * [-2120.311] (-2120.463) (-2120.676) (-2120.240) -- 0:00:58 121500 -- (-2122.647) (-2121.426) [-2119.718] (-2122.007) * (-2122.848) [-2125.842] (-2119.852) (-2121.850) -- 0:00:57 122000 -- (-2126.624) (-2121.151) [-2118.878] (-2121.821) * [-2122.575] (-2119.851) (-2119.076) (-2121.957) -- 0:00:57 122500 -- (-2121.057) (-2122.887) (-2119.395) [-2125.130] * (-2121.692) (-2119.288) (-2119.166) [-2120.352] -- 0:00:57 123000 -- (-2123.552) [-2121.297] (-2119.568) (-2123.028) * (-2120.488) [-2125.115] (-2120.576) (-2120.760) -- 0:00:57 123500 -- [-2123.487] (-2121.685) (-2120.391) (-2125.977) * (-2120.246) (-2123.420) [-2121.549] (-2121.668) -- 0:01:03 124000 -- (-2119.715) (-2123.194) [-2119.497] (-2121.770) * (-2120.365) (-2122.851) (-2121.808) [-2120.383] -- 0:01:03 124500 -- (-2119.513) (-2120.703) (-2120.513) [-2120.100] * [-2121.690] (-2121.787) (-2121.207) (-2120.122) -- 0:01:03 125000 -- [-2118.957] (-2120.695) (-2120.781) (-2121.508) * (-2122.165) (-2121.374) (-2120.877) [-2120.428] -- 0:01:03 Average standard deviation of split frequencies: 0.022054 125500 -- (-2119.007) [-2120.708] (-2119.352) (-2121.342) * [-2122.391] (-2122.288) (-2121.168) (-2120.672) -- 0:01:02 126000 -- [-2119.230] (-2120.703) (-2119.055) (-2120.606) * (-2119.795) (-2121.528) (-2121.236) [-2120.260] -- 0:01:02 126500 -- (-2119.189) (-2121.054) [-2120.196] (-2119.695) * (-2119.014) (-2121.255) [-2121.533] (-2121.980) -- 0:01:02 127000 -- (-2120.649) (-2121.154) (-2120.219) [-2119.120] * [-2121.923] (-2121.921) (-2120.951) (-2120.554) -- 0:01:01 127500 -- (-2121.301) [-2124.904] (-2120.249) (-2118.859) * [-2121.797] (-2121.852) (-2121.334) (-2121.152) -- 0:01:01 128000 -- (-2120.696) [-2123.291] (-2124.332) (-2119.078) * (-2127.572) (-2120.938) [-2121.030] (-2120.359) -- 0:01:01 128500 -- (-2118.967) (-2122.271) [-2121.326] (-2120.840) * (-2125.461) (-2121.505) [-2120.797] (-2119.599) -- 0:01:01 129000 -- (-2119.374) (-2122.154) (-2123.872) [-2120.519] * (-2128.686) [-2121.710] (-2120.951) (-2119.999) -- 0:01:00 129500 -- (-2120.377) (-2124.266) [-2120.660] (-2122.134) * (-2121.669) [-2121.526] (-2121.663) (-2121.891) -- 0:01:00 130000 -- (-2122.278) (-2122.518) [-2120.420] (-2122.291) * [-2120.822] (-2119.382) (-2121.901) (-2120.946) -- 0:01:00 Average standard deviation of split frequencies: 0.022026 130500 -- [-2120.129] (-2122.518) (-2122.853) (-2120.576) * (-2121.114) [-2120.638] (-2118.855) (-2124.152) -- 0:00:59 131000 -- [-2119.810] (-2119.539) (-2120.741) (-2120.637) * (-2122.920) (-2120.492) (-2118.811) [-2122.956] -- 0:00:59 131500 -- (-2125.199) (-2119.696) (-2120.632) [-2120.365] * (-2122.294) (-2119.927) [-2119.533] (-2121.224) -- 0:00:59 132000 -- [-2120.160] (-2119.585) (-2120.832) (-2121.541) * (-2126.749) (-2119.962) (-2120.903) [-2119.766] -- 0:00:59 132500 -- (-2120.234) [-2119.421] (-2121.003) (-2119.819) * (-2121.894) (-2120.506) (-2123.243) [-2119.977] -- 0:00:58 133000 -- (-2121.735) [-2121.515] (-2120.815) (-2122.243) * (-2122.070) (-2122.481) [-2121.716] (-2119.521) -- 0:00:58 133500 -- (-2122.314) (-2121.159) (-2121.040) [-2120.464] * [-2121.710] (-2121.557) (-2120.109) (-2119.918) -- 0:00:58 134000 -- (-2125.183) (-2122.917) [-2120.579] (-2119.932) * (-2120.634) (-2119.813) (-2121.232) [-2119.994] -- 0:00:58 134500 -- (-2122.240) (-2125.434) [-2120.198] (-2119.673) * (-2124.662) [-2119.819] (-2121.940) (-2122.037) -- 0:00:57 135000 -- (-2121.859) (-2121.875) [-2120.103] (-2119.124) * (-2125.648) (-2120.853) [-2123.466] (-2121.481) -- 0:00:57 Average standard deviation of split frequencies: 0.023169 135500 -- (-2119.273) (-2120.165) (-2123.631) [-2119.860] * (-2121.059) [-2119.126] (-2125.723) (-2119.556) -- 0:00:57 136000 -- (-2121.224) (-2121.083) (-2122.614) [-2119.382] * (-2122.699) (-2119.032) [-2122.112] (-2119.055) -- 0:00:57 136500 -- (-2121.196) (-2120.774) [-2124.801] (-2120.345) * (-2123.009) [-2119.281] (-2125.339) (-2119.055) -- 0:00:56 137000 -- (-2122.279) (-2121.285) [-2121.654] (-2121.148) * (-2123.009) [-2119.345] (-2123.956) (-2119.700) -- 0:00:56 137500 -- [-2120.202] (-2122.976) (-2122.235) (-2122.589) * (-2126.753) (-2120.661) (-2123.599) [-2119.922] -- 0:00:56 138000 -- [-2121.415] (-2124.340) (-2122.159) (-2123.169) * (-2125.243) [-2122.011] (-2124.831) (-2120.327) -- 0:00:56 138500 -- [-2120.733] (-2121.517) (-2122.208) (-2127.417) * (-2125.195) (-2119.578) [-2124.135] (-2118.931) -- 0:01:02 139000 -- [-2120.004] (-2123.198) (-2123.863) (-2130.500) * (-2127.777) (-2119.491) [-2123.368] (-2123.007) -- 0:01:01 139500 -- [-2120.354] (-2122.675) (-2121.399) (-2126.064) * (-2121.792) [-2119.042] (-2122.988) (-2121.213) -- 0:01:01 140000 -- (-2120.501) (-2123.604) [-2121.800] (-2125.949) * (-2121.350) [-2118.965] (-2123.617) (-2121.947) -- 0:01:01 Average standard deviation of split frequencies: 0.023811 140500 -- (-2120.051) (-2128.450) [-2121.059] (-2125.750) * (-2122.458) (-2121.371) (-2119.080) [-2123.435] -- 0:01:01 141000 -- (-2121.487) (-2126.062) (-2120.799) [-2123.010] * (-2120.622) [-2121.269] (-2120.529) (-2119.521) -- 0:01:00 141500 -- (-2123.481) (-2122.887) [-2120.970] (-2122.117) * (-2120.896) [-2120.221] (-2121.109) (-2120.516) -- 0:01:00 142000 -- (-2120.785) (-2123.138) (-2121.603) [-2127.965] * (-2121.497) [-2122.123] (-2119.426) (-2122.161) -- 0:01:00 142500 -- (-2122.100) [-2120.213] (-2121.805) (-2121.427) * (-2121.115) (-2122.714) (-2125.836) [-2120.150] -- 0:01:00 143000 -- [-2120.346] (-2121.373) (-2123.734) (-2122.351) * (-2120.164) (-2119.889) [-2125.362] (-2121.999) -- 0:00:59 143500 -- (-2121.873) (-2120.540) [-2123.486] (-2122.006) * (-2121.200) (-2121.410) (-2124.674) [-2120.664] -- 0:00:59 144000 -- [-2119.081] (-2120.206) (-2120.399) (-2119.144) * [-2123.101] (-2121.458) (-2121.396) (-2122.480) -- 0:00:59 144500 -- (-2122.316) [-2120.172] (-2124.108) (-2122.786) * [-2120.060] (-2120.298) (-2123.657) (-2120.930) -- 0:00:59 145000 -- (-2119.226) (-2120.253) (-2120.289) [-2120.946] * (-2119.709) (-2119.797) (-2121.543) [-2120.852] -- 0:00:58 Average standard deviation of split frequencies: 0.023961 145500 -- [-2121.968] (-2119.348) (-2123.697) (-2123.767) * (-2119.379) (-2121.166) [-2120.933] (-2119.490) -- 0:00:58 146000 -- (-2122.174) (-2119.998) [-2122.214] (-2121.670) * (-2126.897) (-2125.365) [-2121.452] (-2119.307) -- 0:00:58 146500 -- (-2121.223) (-2121.724) [-2119.927] (-2121.856) * (-2123.350) (-2123.588) [-2119.553] (-2120.219) -- 0:00:58 147000 -- [-2120.832] (-2123.222) (-2120.354) (-2124.627) * (-2126.749) (-2121.801) [-2120.898] (-2118.980) -- 0:00:58 147500 -- [-2120.511] (-2121.166) (-2120.223) (-2125.252) * (-2125.659) [-2120.936] (-2120.302) (-2119.706) -- 0:00:57 148000 -- (-2120.366) [-2119.107] (-2120.087) (-2122.613) * (-2122.281) (-2120.357) (-2120.334) [-2119.306] -- 0:00:57 148500 -- [-2119.874] (-2120.119) (-2119.369) (-2123.026) * (-2122.301) (-2120.779) (-2121.170) [-2119.306] -- 0:00:57 149000 -- (-2120.634) (-2119.961) (-2119.628) [-2128.822] * (-2120.069) [-2120.471] (-2123.081) (-2119.792) -- 0:00:57 149500 -- (-2120.769) (-2119.961) [-2119.631] (-2120.440) * [-2121.309] (-2126.269) (-2119.887) (-2119.972) -- 0:00:56 150000 -- (-2121.574) [-2119.145] (-2119.000) (-2121.532) * (-2123.399) (-2124.757) (-2119.971) [-2120.860] -- 0:00:56 Average standard deviation of split frequencies: 0.024536 150500 -- (-2122.939) [-2119.835] (-2119.370) (-2119.836) * [-2122.694] (-2125.263) (-2126.001) (-2120.902) -- 0:00:56 151000 -- (-2119.672) (-2121.053) (-2119.259) [-2120.163] * (-2121.083) [-2120.343] (-2120.584) (-2119.904) -- 0:00:56 151500 -- (-2120.251) (-2120.642) [-2121.214] (-2120.355) * (-2121.198) (-2120.142) [-2119.434] (-2123.335) -- 0:00:56 152000 -- (-2119.523) (-2119.042) [-2121.606] (-2120.679) * (-2122.831) (-2120.806) (-2119.615) [-2121.260] -- 0:00:55 152500 -- [-2120.580] (-2119.386) (-2120.561) (-2120.394) * [-2119.617] (-2119.224) (-2122.811) (-2119.692) -- 0:00:55 153000 -- (-2120.198) [-2121.871] (-2124.032) (-2120.170) * (-2119.476) [-2119.323] (-2122.935) (-2121.690) -- 0:00:55 153500 -- (-2120.735) (-2122.896) (-2124.888) [-2119.992] * (-2122.825) (-2119.070) [-2120.913] (-2120.353) -- 0:01:00 154000 -- (-2120.784) (-2124.157) [-2123.595] (-2118.913) * (-2122.601) [-2118.975] (-2120.436) (-2119.124) -- 0:01:00 154500 -- [-2120.320] (-2122.349) (-2121.930) (-2119.425) * [-2121.184] (-2119.346) (-2121.996) (-2120.753) -- 0:01:00 155000 -- (-2120.467) [-2121.997] (-2121.311) (-2119.986) * (-2120.440) [-2119.562] (-2121.401) (-2120.015) -- 0:00:59 Average standard deviation of split frequencies: 0.023220 155500 -- (-2120.741) (-2123.967) [-2121.330] (-2119.522) * (-2123.173) [-2120.544] (-2120.309) (-2122.127) -- 0:00:59 156000 -- [-2122.104] (-2123.321) (-2124.681) (-2119.523) * [-2120.503] (-2120.784) (-2121.780) (-2122.453) -- 0:00:59 156500 -- (-2120.634) (-2121.983) (-2126.506) [-2119.125] * (-2124.388) [-2121.220] (-2120.998) (-2120.440) -- 0:00:59 157000 -- (-2120.553) [-2122.696] (-2125.577) (-2119.319) * (-2128.636) [-2120.309] (-2120.018) (-2119.974) -- 0:00:59 157500 -- [-2119.921] (-2123.096) (-2120.811) (-2120.379) * (-2124.644) (-2122.901) [-2119.849] (-2121.354) -- 0:00:58 158000 -- (-2121.965) (-2124.066) (-2121.448) [-2120.906] * (-2125.838) (-2125.268) [-2119.064] (-2122.798) -- 0:00:58 158500 -- (-2122.621) (-2124.333) (-2119.553) [-2120.066] * (-2123.742) (-2119.637) (-2119.891) [-2121.963] -- 0:00:58 159000 -- (-2120.570) (-2125.320) (-2120.308) [-2120.148] * (-2122.360) (-2120.374) (-2119.292) [-2120.421] -- 0:00:58 159500 -- (-2119.527) [-2121.496] (-2120.366) (-2121.057) * (-2123.320) [-2121.047] (-2119.319) (-2120.459) -- 0:00:57 160000 -- (-2119.150) (-2126.303) (-2120.515) [-2119.931] * (-2122.377) (-2121.914) (-2119.720) [-2122.027] -- 0:00:57 Average standard deviation of split frequencies: 0.021928 160500 -- (-2119.794) (-2124.287) (-2120.473) [-2119.371] * (-2120.394) (-2121.568) [-2120.488] (-2119.428) -- 0:00:57 161000 -- (-2118.824) (-2125.018) (-2121.103) [-2119.636] * (-2121.836) [-2119.045] (-2120.599) (-2120.333) -- 0:00:57 161500 -- [-2119.765] (-2121.337) (-2122.103) (-2119.702) * (-2120.685) (-2119.757) [-2124.924] (-2121.853) -- 0:00:57 162000 -- (-2120.977) (-2121.153) (-2123.876) [-2119.835] * [-2121.458] (-2119.352) (-2128.302) (-2120.100) -- 0:00:56 162500 -- [-2120.652] (-2122.537) (-2124.174) (-2124.945) * [-2122.171] (-2119.455) (-2136.514) (-2121.847) -- 0:00:56 163000 -- (-2120.781) (-2122.185) [-2121.794] (-2123.233) * (-2120.836) (-2123.743) (-2124.570) [-2120.831] -- 0:00:56 163500 -- [-2120.443] (-2121.826) (-2121.436) (-2120.511) * (-2121.098) (-2121.055) (-2130.535) [-2119.198] -- 0:00:56 164000 -- (-2120.496) (-2123.548) [-2121.492] (-2120.085) * [-2125.687] (-2120.645) (-2130.176) (-2119.776) -- 0:00:56 164500 -- (-2120.330) (-2120.765) (-2120.072) [-2120.435] * (-2122.913) (-2120.035) (-2126.333) [-2120.308] -- 0:00:55 165000 -- [-2119.851] (-2121.861) (-2119.268) (-2120.394) * [-2124.251] (-2122.510) (-2120.180) (-2122.102) -- 0:00:55 Average standard deviation of split frequencies: 0.020925 165500 -- (-2119.721) (-2121.815) [-2119.618] (-2120.836) * (-2122.692) (-2122.091) (-2119.356) [-2123.490] -- 0:00:55 166000 -- (-2119.478) (-2123.836) [-2121.050] (-2120.678) * (-2119.206) [-2119.959] (-2119.669) (-2119.214) -- 0:00:55 166500 -- (-2120.803) (-2121.914) (-2121.150) [-2119.577] * (-2120.878) (-2120.797) [-2120.964] (-2119.287) -- 0:00:55 167000 -- (-2119.781) (-2123.301) (-2121.339) [-2123.623] * (-2120.655) [-2120.454] (-2120.125) (-2120.061) -- 0:00:54 167500 -- (-2118.965) (-2123.460) [-2121.714] (-2125.500) * (-2119.777) (-2123.322) (-2118.971) [-2120.038] -- 0:00:54 168000 -- (-2120.266) (-2120.668) [-2120.003] (-2125.624) * (-2119.559) (-2123.548) (-2121.638) [-2119.892] -- 0:00:54 168500 -- (-2120.947) [-2118.970] (-2122.997) (-2122.768) * (-2119.938) [-2120.705] (-2121.817) (-2120.203) -- 0:00:59 169000 -- (-2130.584) (-2118.838) [-2121.746] (-2125.640) * (-2121.900) (-2122.512) (-2119.124) [-2119.694] -- 0:00:59 169500 -- (-2119.150) (-2122.712) [-2119.776] (-2120.559) * [-2122.291] (-2123.241) (-2119.124) (-2119.620) -- 0:00:58 170000 -- (-2120.319) (-2123.307) [-2119.999] (-2122.105) * (-2122.649) [-2126.845] (-2122.341) (-2124.364) -- 0:00:58 Average standard deviation of split frequencies: 0.018608 170500 -- (-2121.301) [-2125.661] (-2129.165) (-2119.614) * [-2122.933] (-2121.117) (-2121.881) (-2120.158) -- 0:00:58 171000 -- (-2120.966) [-2119.529] (-2120.168) (-2119.474) * (-2122.548) (-2122.194) [-2119.249] (-2121.541) -- 0:00:58 171500 -- (-2121.908) (-2120.387) [-2120.275] (-2119.527) * (-2120.115) (-2122.391) (-2119.302) [-2119.207] -- 0:00:57 172000 -- (-2122.384) [-2121.341] (-2119.869) (-2120.480) * (-2121.348) (-2119.979) (-2119.351) [-2118.709] -- 0:00:57 172500 -- [-2120.391] (-2122.143) (-2120.167) (-2120.145) * (-2122.913) (-2120.579) (-2120.200) [-2118.706] -- 0:00:57 173000 -- (-2120.857) [-2120.838] (-2121.398) (-2121.111) * (-2127.616) (-2119.634) (-2119.695) [-2119.524] -- 0:00:57 173500 -- [-2125.691] (-2121.996) (-2124.959) (-2120.204) * (-2122.507) [-2120.198] (-2123.214) (-2119.784) -- 0:00:57 174000 -- (-2119.820) (-2120.949) (-2124.520) [-2119.824] * (-2121.581) (-2119.765) (-2120.399) [-2119.016] -- 0:00:56 174500 -- [-2121.095] (-2120.591) (-2124.155) (-2119.999) * (-2119.547) (-2119.757) (-2122.151) [-2119.274] -- 0:00:56 175000 -- (-2120.652) (-2118.968) (-2119.823) [-2120.422] * (-2120.449) (-2119.581) (-2126.824) [-2119.407] -- 0:00:56 Average standard deviation of split frequencies: 0.017544 175500 -- (-2120.766) (-2121.886) [-2123.167] (-2120.421) * [-2120.360] (-2119.472) (-2122.734) (-2119.503) -- 0:00:56 176000 -- [-2119.847] (-2121.785) (-2122.930) (-2120.420) * (-2119.757) (-2122.316) [-2126.925] (-2121.484) -- 0:00:56 176500 -- [-2121.884] (-2120.589) (-2132.953) (-2119.268) * (-2120.918) [-2127.212] (-2126.861) (-2120.106) -- 0:00:55 177000 -- (-2121.694) (-2120.171) (-2122.739) [-2120.591] * (-2123.546) [-2121.829] (-2126.396) (-2119.911) -- 0:00:55 177500 -- [-2120.812] (-2120.166) (-2122.881) (-2120.732) * (-2126.614) (-2120.716) (-2123.100) [-2119.401] -- 0:00:55 178000 -- (-2123.938) [-2119.421] (-2120.257) (-2120.967) * (-2124.856) [-2119.909] (-2121.262) (-2119.833) -- 0:00:55 178500 -- (-2119.814) (-2122.634) [-2121.223] (-2119.355) * (-2119.939) [-2119.044] (-2121.424) (-2120.463) -- 0:00:55 179000 -- (-2121.831) [-2120.840] (-2120.687) (-2120.970) * (-2125.972) [-2119.480] (-2123.916) (-2120.116) -- 0:00:55 179500 -- (-2120.255) (-2123.390) [-2120.810] (-2122.982) * (-2123.906) [-2122.164] (-2123.800) (-2120.135) -- 0:00:54 180000 -- (-2120.058) [-2123.753] (-2121.424) (-2120.898) * (-2124.151) (-2123.177) (-2119.139) [-2120.929] -- 0:00:54 Average standard deviation of split frequencies: 0.016525 180500 -- (-2121.342) (-2119.235) [-2122.066] (-2121.048) * (-2123.748) (-2121.546) (-2120.268) [-2119.803] -- 0:00:54 181000 -- (-2122.446) [-2120.040] (-2124.690) (-2122.415) * [-2121.524] (-2121.109) (-2120.006) (-2122.730) -- 0:00:54 181500 -- [-2119.019] (-2119.400) (-2122.541) (-2125.971) * (-2120.570) (-2121.522) (-2120.056) [-2119.290] -- 0:00:54 182000 -- (-2120.013) [-2120.014] (-2120.767) (-2121.661) * (-2120.531) [-2121.742] (-2124.438) (-2119.392) -- 0:00:53 182500 -- (-2121.208) (-2121.098) (-2120.819) [-2123.500] * (-2121.610) [-2119.318] (-2124.438) (-2119.639) -- 0:00:53 183000 -- (-2121.208) (-2121.095) [-2121.636] (-2120.666) * (-2120.225) (-2120.419) (-2124.252) [-2120.773] -- 0:00:58 183500 -- (-2121.207) (-2119.547) (-2121.043) [-2121.818] * (-2120.072) (-2120.157) (-2122.788) [-2121.504] -- 0:00:57 184000 -- (-2121.670) (-2119.931) (-2119.750) [-2124.624] * (-2120.019) (-2120.124) [-2120.921] (-2121.166) -- 0:00:57 184500 -- (-2125.677) (-2118.740) [-2119.376] (-2119.862) * (-2119.921) (-2120.124) (-2119.862) [-2122.043] -- 0:00:57 185000 -- (-2124.394) [-2122.707] (-2120.151) (-2120.531) * [-2119.960] (-2121.095) (-2120.217) (-2120.478) -- 0:00:57 Average standard deviation of split frequencies: 0.017074 185500 -- (-2119.291) (-2119.595) [-2122.648] (-2121.269) * [-2120.429] (-2120.415) (-2120.461) (-2122.593) -- 0:00:57 186000 -- (-2119.946) (-2120.997) [-2121.384] (-2120.988) * (-2120.808) [-2120.477] (-2119.770) (-2122.530) -- 0:00:56 186500 -- (-2119.936) (-2123.412) (-2125.372) [-2121.260] * (-2121.908) [-2119.750] (-2120.070) (-2121.445) -- 0:00:56 187000 -- (-2120.775) (-2118.730) (-2126.003) [-2121.806] * (-2120.893) (-2120.213) [-2122.203] (-2120.881) -- 0:00:56 187500 -- (-2123.100) [-2120.796] (-2126.911) (-2120.508) * (-2121.343) [-2121.738] (-2123.025) (-2120.239) -- 0:00:56 188000 -- (-2122.788) (-2123.915) (-2123.087) [-2120.429] * (-2120.705) [-2121.337] (-2120.694) (-2120.782) -- 0:00:56 188500 -- (-2119.436) (-2126.742) (-2126.105) [-2119.417] * (-2120.705) (-2119.926) [-2121.098] (-2119.423) -- 0:00:55 189000 -- [-2119.845] (-2124.365) (-2121.134) (-2119.057) * [-2119.748] (-2121.178) (-2121.593) (-2119.217) -- 0:00:55 189500 -- (-2119.845) (-2121.799) [-2121.298] (-2120.529) * (-2119.010) (-2122.384) [-2126.851] (-2120.418) -- 0:00:55 190000 -- (-2119.632) [-2121.530] (-2119.537) (-2119.578) * (-2119.705) [-2121.062] (-2126.694) (-2120.328) -- 0:00:55 Average standard deviation of split frequencies: 0.015453 190500 -- (-2120.553) (-2121.448) [-2124.075] (-2120.666) * (-2119.387) (-2121.945) (-2121.654) [-2120.330] -- 0:00:55 191000 -- (-2120.301) [-2120.843] (-2121.711) (-2120.666) * (-2120.443) (-2122.751) (-2121.382) [-2120.797] -- 0:00:55 191500 -- [-2120.217] (-2121.884) (-2121.317) (-2119.799) * (-2120.170) (-2123.577) (-2121.848) [-2119.682] -- 0:00:54 192000 -- (-2124.271) (-2118.842) (-2120.447) [-2119.553] * (-2121.342) (-2123.668) [-2121.012] (-2120.070) -- 0:00:54 192500 -- (-2122.809) (-2120.280) (-2121.750) [-2119.965] * (-2125.151) [-2123.406] (-2121.465) (-2121.874) -- 0:00:54 193000 -- [-2123.146] (-2119.271) (-2122.425) (-2120.063) * (-2124.945) (-2121.473) [-2121.884] (-2119.598) -- 0:00:54 193500 -- (-2122.666) (-2118.654) (-2122.613) [-2120.965] * (-2128.304) (-2122.178) [-2121.757] (-2119.588) -- 0:00:54 194000 -- (-2120.732) (-2120.278) (-2122.012) [-2124.269] * (-2121.928) (-2120.923) (-2120.274) [-2120.459] -- 0:00:54 194500 -- [-2121.696] (-2121.967) (-2119.509) (-2122.717) * (-2124.009) (-2121.831) [-2120.490] (-2121.862) -- 0:00:53 195000 -- (-2120.988) [-2121.794] (-2119.189) (-2121.321) * (-2122.008) [-2120.672] (-2121.149) (-2119.586) -- 0:00:53 Average standard deviation of split frequencies: 0.016475 195500 -- (-2119.719) (-2124.168) (-2119.706) [-2119.374] * [-2121.066] (-2120.813) (-2121.115) (-2121.240) -- 0:00:57 196000 -- (-2119.707) (-2124.016) (-2120.777) [-2119.395] * (-2119.959) [-2119.495] (-2120.368) (-2120.722) -- 0:00:57 196500 -- (-2121.520) [-2121.368] (-2120.799) (-2120.547) * [-2119.754] (-2119.958) (-2121.051) (-2127.565) -- 0:00:57 197000 -- [-2121.566] (-2121.707) (-2120.004) (-2124.843) * (-2121.152) (-2123.830) (-2122.687) [-2125.550] -- 0:00:57 197500 -- (-2119.878) (-2124.879) (-2119.746) [-2120.082] * [-2121.257] (-2123.552) (-2123.426) (-2122.512) -- 0:00:56 198000 -- (-2121.274) [-2120.064] (-2121.565) (-2120.290) * (-2121.222) [-2120.738] (-2122.761) (-2121.768) -- 0:00:56 198500 -- [-2120.625] (-2119.767) (-2124.649) (-2122.743) * [-2120.000] (-2121.184) (-2122.072) (-2122.596) -- 0:00:56 199000 -- (-2119.402) [-2121.543] (-2123.792) (-2124.170) * (-2121.356) (-2123.380) [-2121.735] (-2127.623) -- 0:00:56 199500 -- [-2119.346] (-2122.071) (-2120.799) (-2122.639) * (-2120.732) (-2121.416) [-2122.050] (-2126.911) -- 0:00:56 200000 -- (-2119.243) [-2119.993] (-2121.312) (-2123.282) * (-2119.904) [-2120.600] (-2119.854) (-2123.710) -- 0:00:55 Average standard deviation of split frequencies: 0.015270 200500 -- (-2121.999) [-2120.474] (-2121.537) (-2122.392) * (-2121.770) [-2124.800] (-2119.935) (-2123.394) -- 0:00:55 201000 -- (-2120.947) (-2125.541) [-2121.660] (-2120.707) * (-2120.247) (-2122.751) [-2120.466] (-2123.941) -- 0:00:55 201500 -- [-2121.314] (-2125.840) (-2121.619) (-2121.121) * (-2121.473) [-2121.339] (-2122.035) (-2129.325) -- 0:00:55 202000 -- (-2121.222) (-2122.228) [-2119.604] (-2121.757) * [-2119.346] (-2122.946) (-2120.194) (-2124.619) -- 0:00:55 202500 -- (-2120.268) (-2124.195) [-2123.469] (-2121.548) * [-2119.154] (-2119.534) (-2120.542) (-2121.827) -- 0:00:55 203000 -- [-2121.471] (-2121.819) (-2124.639) (-2121.825) * (-2119.147) (-2120.807) (-2126.236) [-2121.219] -- 0:00:54 203500 -- (-2125.372) (-2124.024) (-2124.186) [-2119.909] * (-2120.859) (-2120.448) (-2125.069) [-2120.470] -- 0:00:54 204000 -- [-2123.754] (-2120.420) (-2124.496) (-2120.595) * (-2119.592) [-2120.971] (-2129.047) (-2120.334) -- 0:00:54 204500 -- (-2123.706) (-2120.803) [-2119.847] (-2122.326) * (-2120.888) (-2120.351) (-2123.118) [-2121.559] -- 0:00:54 205000 -- (-2121.663) (-2121.398) (-2120.693) [-2120.633] * (-2121.933) (-2121.574) (-2120.623) [-2121.879] -- 0:00:54 Average standard deviation of split frequencies: 0.016019 205500 -- (-2122.898) [-2122.274] (-2122.249) (-2121.198) * (-2120.255) [-2122.094] (-2124.909) (-2121.427) -- 0:00:54 206000 -- [-2121.513] (-2126.106) (-2118.794) (-2119.836) * (-2121.279) [-2122.652] (-2125.503) (-2121.428) -- 0:00:53 206500 -- [-2121.270] (-2125.598) (-2119.863) (-2120.991) * [-2120.414] (-2123.505) (-2124.511) (-2124.112) -- 0:00:53 207000 -- (-2120.764) [-2123.417] (-2124.487) (-2123.660) * (-2121.941) [-2121.154] (-2123.606) (-2120.688) -- 0:00:53 207500 -- (-2127.140) (-2119.918) [-2121.666] (-2120.663) * (-2122.071) (-2121.600) [-2121.915] (-2120.066) -- 0:00:53 208000 -- (-2126.372) [-2120.899] (-2120.007) (-2120.973) * [-2122.651] (-2121.603) (-2121.684) (-2120.050) -- 0:00:53 208500 -- (-2118.982) (-2123.539) [-2119.958] (-2121.318) * (-2126.071) (-2123.562) [-2123.738] (-2120.678) -- 0:00:53 209000 -- (-2119.212) (-2123.089) (-2120.363) [-2119.915] * (-2122.879) (-2123.332) (-2121.891) [-2120.678] -- 0:00:52 209500 -- (-2121.078) (-2119.642) (-2120.767) [-2120.605] * (-2125.040) (-2122.917) [-2120.359] (-2119.721) -- 0:00:52 210000 -- (-2124.375) (-2120.180) (-2122.658) [-2121.450] * (-2125.343) (-2122.825) (-2123.128) [-2120.361] -- 0:00:52 Average standard deviation of split frequencies: 0.016335 210500 -- (-2121.405) (-2120.324) (-2121.728) [-2123.149] * (-2119.450) (-2122.487) [-2121.144] (-2120.361) -- 0:00:56 211000 -- (-2119.996) [-2119.476] (-2119.833) (-2122.139) * (-2120.044) (-2122.644) [-2120.708] (-2119.175) -- 0:00:56 211500 -- (-2120.420) (-2118.765) [-2124.882] (-2122.077) * (-2119.957) (-2122.742) [-2120.813] (-2119.208) -- 0:00:55 212000 -- (-2121.169) (-2119.439) [-2124.290] (-2121.163) * (-2121.309) (-2124.431) (-2121.347) [-2120.368] -- 0:00:55 212500 -- (-2121.411) (-2119.286) (-2120.739) [-2120.153] * (-2120.194) (-2121.604) (-2121.120) [-2123.352] -- 0:00:55 213000 -- (-2122.158) (-2118.757) [-2124.660] (-2120.157) * (-2120.063) (-2125.135) [-2121.540] (-2121.865) -- 0:00:55 213500 -- (-2122.920) (-2119.638) (-2122.074) [-2120.843] * (-2120.241) (-2121.976) (-2120.710) [-2121.137] -- 0:00:55 214000 -- (-2119.363) (-2119.698) [-2121.173] (-2119.510) * [-2119.838] (-2120.828) (-2122.564) (-2122.379) -- 0:00:55 214500 -- [-2120.470] (-2120.919) (-2121.728) (-2121.358) * (-2120.252) (-2120.530) (-2121.406) [-2121.698] -- 0:00:54 215000 -- (-2122.590) [-2122.595] (-2120.712) (-2120.021) * (-2119.517) [-2120.281] (-2120.482) (-2120.308) -- 0:00:54 Average standard deviation of split frequencies: 0.016805 215500 -- (-2121.871) (-2120.578) [-2120.625] (-2120.397) * (-2121.803) (-2120.022) (-2120.302) [-2121.075] -- 0:00:54 216000 -- (-2121.664) (-2119.914) [-2122.123] (-2119.772) * (-2119.984) (-2120.546) (-2120.514) [-2123.403] -- 0:00:54 216500 -- [-2124.410] (-2123.194) (-2120.115) (-2121.541) * [-2120.434] (-2122.543) (-2120.219) (-2124.127) -- 0:00:54 217000 -- (-2121.270) [-2123.849] (-2125.895) (-2122.859) * [-2121.719] (-2123.793) (-2120.115) (-2123.858) -- 0:00:54 217500 -- (-2121.936) (-2119.799) [-2120.468] (-2119.923) * (-2121.716) [-2122.437] (-2122.289) (-2124.572) -- 0:00:53 218000 -- (-2120.486) (-2121.362) [-2119.200] (-2120.940) * (-2122.690) (-2125.068) [-2121.066] (-2122.641) -- 0:00:53 218500 -- (-2120.883) [-2123.606] (-2119.117) (-2120.940) * [-2122.089] (-2120.402) (-2120.842) (-2121.226) -- 0:00:53 219000 -- (-2121.710) [-2122.700] (-2119.118) (-2121.230) * (-2122.245) (-2120.242) [-2120.366] (-2119.293) -- 0:00:53 219500 -- (-2120.765) (-2124.452) [-2121.552] (-2122.958) * (-2123.580) [-2122.676] (-2119.346) (-2119.183) -- 0:00:53 220000 -- (-2122.739) (-2121.493) [-2119.902] (-2122.221) * (-2122.193) [-2122.064] (-2118.940) (-2120.575) -- 0:00:53 Average standard deviation of split frequencies: 0.016342 220500 -- (-2121.006) (-2121.049) (-2119.079) [-2121.040] * (-2120.309) [-2124.056] (-2118.999) (-2119.260) -- 0:00:53 221000 -- (-2120.742) (-2120.984) (-2119.530) [-2120.086] * [-2119.257] (-2130.630) (-2118.992) (-2121.634) -- 0:00:52 221500 -- [-2122.153] (-2120.534) (-2124.074) (-2119.524) * [-2119.758] (-2126.278) (-2119.920) (-2121.805) -- 0:00:52 222000 -- (-2123.893) (-2121.006) [-2124.184] (-2121.281) * (-2118.841) [-2121.204] (-2121.857) (-2120.679) -- 0:00:52 222500 -- (-2120.684) (-2120.909) [-2124.181] (-2123.312) * [-2120.151] (-2121.128) (-2119.214) (-2120.640) -- 0:00:52 223000 -- (-2119.473) [-2121.376] (-2122.396) (-2125.399) * [-2120.795] (-2122.588) (-2119.426) (-2120.762) -- 0:00:52 223500 -- [-2119.388] (-2119.469) (-2121.158) (-2119.810) * (-2122.149) (-2121.148) [-2121.041] (-2121.572) -- 0:00:52 224000 -- (-2121.282) (-2125.391) (-2122.345) [-2120.835] * (-2123.175) (-2121.271) [-2120.409] (-2122.741) -- 0:00:51 224500 -- (-2124.695) (-2121.465) (-2120.865) [-2120.150] * (-2122.487) [-2119.399] (-2124.105) (-2124.066) -- 0:00:51 225000 -- (-2119.071) (-2119.668) (-2121.103) [-2120.874] * (-2120.437) (-2121.732) [-2122.400] (-2125.838) -- 0:00:51 Average standard deviation of split frequencies: 0.016687 225500 -- (-2119.329) [-2119.435] (-2122.112) (-2122.047) * (-2122.693) [-2120.056] (-2119.293) (-2121.119) -- 0:00:54 226000 -- (-2120.301) (-2120.601) [-2119.493] (-2119.407) * [-2122.539] (-2120.051) (-2119.771) (-2120.421) -- 0:00:54 226500 -- (-2120.300) (-2120.272) (-2120.288) [-2120.695] * (-2118.942) (-2122.275) (-2121.143) [-2119.560] -- 0:00:54 227000 -- [-2127.396] (-2122.323) (-2119.730) (-2120.950) * [-2118.804] (-2119.178) (-2122.510) (-2122.238) -- 0:00:54 227500 -- (-2122.426) (-2126.305) [-2124.229] (-2120.647) * (-2130.887) (-2121.086) (-2120.853) [-2122.886] -- 0:00:54 228000 -- [-2121.310] (-2122.121) (-2120.078) (-2122.452) * (-2123.662) (-2119.372) (-2120.383) [-2122.511] -- 0:00:54 228500 -- (-2121.089) (-2121.214) (-2121.304) [-2120.288] * (-2122.512) (-2119.389) (-2120.997) [-2122.427] -- 0:00:54 229000 -- (-2121.512) [-2121.474] (-2120.233) (-2120.345) * (-2123.111) (-2119.389) [-2120.181] (-2120.219) -- 0:00:53 229500 -- (-2120.096) (-2124.267) [-2123.787] (-2120.351) * (-2125.687) (-2121.324) [-2119.414] (-2122.607) -- 0:00:53 230000 -- (-2121.052) [-2120.794] (-2122.011) (-2120.161) * (-2123.229) [-2119.636] (-2123.633) (-2119.991) -- 0:00:53 Average standard deviation of split frequencies: 0.017269 230500 -- [-2120.301] (-2120.552) (-2120.945) (-2121.155) * (-2121.698) (-2122.247) (-2123.302) [-2120.489] -- 0:00:53 231000 -- (-2120.758) [-2120.303] (-2123.708) (-2120.598) * [-2123.597] (-2119.935) (-2124.197) (-2124.959) -- 0:00:53 231500 -- (-2121.193) [-2120.933] (-2121.303) (-2120.654) * [-2122.565] (-2121.068) (-2124.694) (-2125.816) -- 0:00:53 232000 -- (-2119.503) (-2119.728) (-2124.792) [-2120.858] * (-2122.082) (-2122.448) (-2120.543) [-2119.754] -- 0:00:52 232500 -- (-2119.939) (-2124.689) [-2122.806] (-2122.760) * (-2122.513) (-2123.354) [-2121.670] (-2120.254) -- 0:00:52 233000 -- (-2119.322) (-2120.214) [-2121.496] (-2124.238) * [-2125.995] (-2123.614) (-2121.659) (-2120.145) -- 0:00:52 233500 -- (-2122.072) (-2120.772) (-2120.783) [-2120.502] * (-2123.282) (-2124.140) (-2121.005) [-2120.465] -- 0:00:52 234000 -- (-2121.226) (-2120.750) (-2120.789) [-2121.889] * (-2124.084) (-2121.839) (-2120.457) [-2120.588] -- 0:00:52 234500 -- (-2121.458) (-2120.702) [-2121.699] (-2123.790) * (-2122.811) [-2121.595] (-2124.645) (-2120.356) -- 0:00:52 235000 -- (-2119.443) (-2120.918) [-2122.377] (-2122.127) * (-2122.176) [-2119.493] (-2123.428) (-2120.584) -- 0:00:52 Average standard deviation of split frequencies: 0.016979 235500 -- (-2120.142) [-2120.384] (-2121.178) (-2123.290) * (-2119.411) (-2120.596) (-2120.482) [-2122.518] -- 0:00:51 236000 -- (-2120.476) (-2122.857) [-2119.801] (-2120.158) * (-2123.566) (-2118.830) [-2120.597] (-2122.465) -- 0:00:51 236500 -- (-2122.097) (-2121.823) [-2121.103] (-2119.286) * (-2121.446) (-2119.078) [-2119.615] (-2121.958) -- 0:00:51 237000 -- [-2121.504] (-2122.785) (-2120.594) (-2121.163) * (-2121.186) (-2119.078) [-2119.179] (-2120.045) -- 0:00:51 237500 -- (-2121.435) [-2122.431] (-2120.880) (-2120.845) * [-2120.457] (-2121.792) (-2121.657) (-2124.432) -- 0:00:51 238000 -- [-2122.753] (-2122.383) (-2124.502) (-2120.245) * (-2124.832) (-2121.714) [-2123.777] (-2119.263) -- 0:00:51 238500 -- (-2121.496) [-2120.500] (-2125.777) (-2119.321) * (-2124.527) (-2119.049) [-2121.054] (-2119.616) -- 0:00:51 239000 -- [-2122.347] (-2119.628) (-2122.703) (-2119.207) * (-2122.546) [-2121.842] (-2123.113) (-2121.157) -- 0:00:50 239500 -- [-2122.228] (-2119.628) (-2123.055) (-2119.682) * [-2121.574] (-2121.868) (-2122.821) (-2124.918) -- 0:00:50 240000 -- (-2122.450) (-2119.759) (-2123.237) [-2119.731] * [-2120.152] (-2119.787) (-2120.258) (-2123.769) -- 0:00:50 Average standard deviation of split frequencies: 0.015082 240500 -- (-2123.166) [-2120.919] (-2120.878) (-2119.240) * (-2125.752) [-2119.032] (-2119.975) (-2123.976) -- 0:00:50 241000 -- (-2121.464) (-2121.443) [-2121.857] (-2119.574) * (-2120.612) (-2119.527) [-2120.524] (-2123.454) -- 0:00:53 241500 -- (-2120.760) (-2123.260) [-2120.289] (-2120.991) * (-2120.384) (-2123.239) [-2120.130] (-2122.143) -- 0:00:53 242000 -- (-2126.149) (-2124.293) (-2120.324) [-2119.942] * (-2120.249) (-2119.940) [-2122.973] (-2126.080) -- 0:00:53 242500 -- (-2124.323) (-2123.909) [-2120.153] (-2120.527) * (-2120.580) [-2119.751] (-2122.279) (-2124.399) -- 0:00:53 243000 -- [-2123.961] (-2122.374) (-2120.288) (-2120.771) * (-2122.094) (-2120.895) [-2118.888] (-2122.570) -- 0:00:52 243500 -- (-2126.253) [-2122.307] (-2119.228) (-2120.269) * (-2119.715) [-2126.835] (-2119.274) (-2120.800) -- 0:00:52 244000 -- [-2120.560] (-2121.325) (-2119.272) (-2122.609) * [-2119.451] (-2120.483) (-2121.198) (-2124.273) -- 0:00:52 244500 -- (-2119.971) (-2120.659) [-2119.917] (-2119.895) * (-2119.884) (-2120.360) [-2121.198] (-2121.078) -- 0:00:52 245000 -- (-2122.546) (-2124.375) (-2120.348) [-2120.226] * (-2121.303) (-2120.357) (-2122.175) [-2120.524] -- 0:00:52 Average standard deviation of split frequencies: 0.015043 245500 -- (-2121.333) (-2123.669) (-2119.872) [-2119.273] * (-2120.544) [-2122.271] (-2122.418) (-2119.776) -- 0:00:52 246000 -- [-2120.209] (-2120.493) (-2119.909) (-2121.514) * (-2120.831) (-2119.416) [-2121.869] (-2120.714) -- 0:00:52 246500 -- (-2120.295) [-2121.291] (-2121.893) (-2120.831) * (-2120.674) [-2119.538] (-2121.508) (-2121.537) -- 0:00:51 247000 -- (-2120.965) (-2120.517) [-2119.071] (-2120.597) * (-2120.680) (-2120.752) (-2124.061) [-2120.215] -- 0:00:51 247500 -- (-2119.845) (-2119.857) [-2119.078] (-2122.508) * (-2120.770) (-2120.545) (-2122.656) [-2123.369] -- 0:00:51 248000 -- [-2120.284] (-2119.823) (-2119.768) (-2121.246) * (-2120.427) [-2121.111] (-2119.117) (-2119.705) -- 0:00:51 248500 -- (-2119.610) [-2119.827] (-2121.986) (-2119.448) * (-2120.532) (-2120.251) [-2118.992] (-2119.829) -- 0:00:51 249000 -- (-2121.568) [-2120.736] (-2119.690) (-2121.608) * (-2121.094) (-2121.494) (-2120.007) [-2122.139] -- 0:00:51 249500 -- (-2120.923) (-2126.748) [-2119.908] (-2122.200) * (-2119.964) [-2120.190] (-2121.084) (-2122.599) -- 0:00:51 250000 -- [-2121.349] (-2120.265) (-2120.167) (-2124.831) * [-2120.276] (-2120.170) (-2124.231) (-2119.989) -- 0:00:51 Average standard deviation of split frequencies: 0.015936 250500 -- (-2120.376) [-2120.086] (-2120.334) (-2118.901) * [-2120.890] (-2122.353) (-2124.721) (-2120.001) -- 0:00:50 251000 -- (-2120.431) (-2121.006) [-2121.524] (-2119.209) * (-2121.014) [-2120.119] (-2123.546) (-2119.861) -- 0:00:50 251500 -- [-2121.370] (-2122.805) (-2122.435) (-2120.318) * (-2120.470) [-2120.136] (-2126.734) (-2123.057) -- 0:00:50 252000 -- (-2121.051) (-2124.964) (-2122.955) [-2120.129] * [-2120.142] (-2119.296) (-2121.299) (-2120.538) -- 0:00:50 252500 -- [-2120.802] (-2125.540) (-2119.195) (-2120.543) * [-2120.185] (-2119.641) (-2121.299) (-2124.140) -- 0:00:50 253000 -- (-2121.580) (-2122.629) (-2119.708) [-2120.244] * (-2121.253) (-2121.725) (-2122.042) [-2119.641] -- 0:00:50 253500 -- (-2120.309) (-2123.372) [-2120.154] (-2120.206) * (-2121.009) (-2121.416) (-2124.082) [-2120.141] -- 0:00:50 254000 -- [-2120.462] (-2122.784) (-2122.466) (-2120.115) * (-2121.294) (-2121.442) (-2123.017) [-2120.656] -- 0:00:49 254500 -- (-2122.830) [-2121.769] (-2122.584) (-2121.479) * [-2120.524] (-2124.440) (-2121.343) (-2119.118) -- 0:00:49 255000 -- [-2122.717] (-2122.621) (-2122.030) (-2121.496) * (-2123.085) [-2120.398] (-2121.607) (-2121.657) -- 0:00:49 Average standard deviation of split frequencies: 0.015376 255500 -- (-2121.811) (-2122.841) [-2120.770] (-2119.965) * (-2123.677) [-2120.481] (-2120.999) (-2122.254) -- 0:00:49 256000 -- (-2121.467) (-2122.010) (-2119.782) [-2119.083] * (-2124.144) (-2121.340) [-2119.499] (-2119.748) -- 0:00:52 256500 -- (-2122.575) (-2121.658) (-2124.103) [-2120.279] * (-2120.953) (-2120.631) (-2119.716) [-2119.698] -- 0:00:52 257000 -- (-2120.099) (-2120.538) [-2124.603] (-2120.957) * (-2122.189) (-2124.871) (-2119.569) [-2118.884] -- 0:00:52 257500 -- [-2119.795] (-2121.021) (-2119.807) (-2121.266) * (-2122.169) [-2124.937] (-2120.182) (-2119.992) -- 0:00:51 258000 -- [-2119.745] (-2123.646) (-2120.073) (-2122.878) * (-2119.969) [-2122.536] (-2121.700) (-2119.856) -- 0:00:51 258500 -- (-2120.595) (-2123.862) [-2118.624] (-2120.853) * [-2121.068] (-2129.776) (-2121.934) (-2119.944) -- 0:00:51 259000 -- (-2119.370) [-2122.099] (-2119.596) (-2122.495) * (-2121.461) (-2128.425) (-2121.744) [-2119.827] -- 0:00:51 259500 -- (-2119.108) [-2120.418] (-2121.771) (-2122.279) * (-2120.974) [-2122.303] (-2122.503) (-2120.927) -- 0:00:51 260000 -- (-2120.982) (-2120.007) (-2120.183) [-2121.048] * (-2122.720) (-2123.786) (-2123.358) [-2124.686] -- 0:00:51 Average standard deviation of split frequencies: 0.014848 260500 -- (-2121.822) [-2123.891] (-2121.462) (-2127.278) * (-2127.249) (-2120.973) (-2122.412) [-2124.498] -- 0:00:51 261000 -- (-2120.481) (-2123.225) (-2125.869) [-2120.337] * [-2123.267] (-2120.973) (-2121.001) (-2125.972) -- 0:00:50 261500 -- (-2120.438) [-2121.850] (-2124.458) (-2119.987) * (-2119.890) (-2118.749) [-2119.165] (-2123.077) -- 0:00:50 262000 -- [-2119.884] (-2121.771) (-2123.907) (-2120.934) * (-2120.123) [-2120.642] (-2120.111) (-2122.911) -- 0:00:50 262500 -- (-2119.350) [-2121.096] (-2123.907) (-2125.228) * [-2119.273] (-2123.328) (-2123.835) (-2122.794) -- 0:00:50 263000 -- (-2119.276) (-2119.730) [-2122.745] (-2125.303) * [-2119.655] (-2121.743) (-2124.112) (-2121.035) -- 0:00:50 263500 -- (-2119.600) (-2122.575) (-2124.904) [-2120.878] * [-2123.074] (-2122.741) (-2126.104) (-2119.488) -- 0:00:50 264000 -- (-2119.973) [-2121.613] (-2121.479) (-2120.878) * (-2121.291) (-2121.581) (-2119.940) [-2120.013] -- 0:00:50 264500 -- (-2119.789) (-2120.275) [-2121.345] (-2120.766) * [-2118.869] (-2123.016) (-2122.804) (-2119.487) -- 0:00:50 265000 -- (-2120.955) (-2122.343) (-2122.373) [-2121.754] * (-2120.375) [-2121.119] (-2121.923) (-2119.245) -- 0:00:49 Average standard deviation of split frequencies: 0.014644 265500 -- [-2119.501] (-2122.798) (-2122.864) (-2119.639) * (-2122.917) (-2120.320) (-2120.051) [-2120.332] -- 0:00:49 266000 -- (-2120.405) (-2122.375) [-2123.068] (-2120.135) * (-2121.605) (-2121.318) [-2122.840] (-2121.393) -- 0:00:49 266500 -- [-2120.327] (-2122.422) (-2118.902) (-2120.154) * [-2120.058] (-2120.642) (-2122.836) (-2120.702) -- 0:00:49 267000 -- (-2120.489) (-2120.176) (-2121.552) [-2120.951] * (-2119.440) (-2121.375) [-2119.435] (-2120.889) -- 0:00:49 267500 -- (-2120.535) (-2118.658) (-2123.099) [-2120.604] * [-2120.241] (-2122.286) (-2123.922) (-2122.285) -- 0:00:49 268000 -- (-2120.504) [-2119.421] (-2120.850) (-2119.935) * [-2121.386] (-2122.604) (-2123.068) (-2126.376) -- 0:00:49 268500 -- [-2123.139] (-2120.878) (-2121.738) (-2119.787) * [-2120.536] (-2119.905) (-2120.836) (-2121.406) -- 0:00:49 269000 -- (-2122.574) (-2118.901) (-2121.641) [-2121.663] * (-2120.725) [-2120.188] (-2122.660) (-2124.551) -- 0:00:48 269500 -- (-2121.261) (-2119.750) [-2123.430] (-2121.005) * [-2120.207] (-2126.078) (-2120.192) (-2125.528) -- 0:00:51 270000 -- (-2122.970) (-2119.742) [-2119.272] (-2121.871) * (-2121.605) (-2123.725) (-2119.456) [-2122.535] -- 0:00:51 Average standard deviation of split frequencies: 0.013585 270500 -- (-2122.359) (-2119.008) [-2121.279] (-2122.681) * (-2121.921) (-2121.983) [-2121.719] (-2122.096) -- 0:00:51 271000 -- [-2120.323] (-2121.746) (-2120.703) (-2121.088) * (-2122.160) [-2120.334] (-2121.449) (-2123.056) -- 0:00:51 271500 -- (-2121.288) (-2120.755) [-2122.886] (-2121.365) * (-2120.658) (-2120.131) (-2122.313) [-2123.046] -- 0:00:50 272000 -- (-2120.247) (-2121.416) [-2122.698] (-2120.837) * (-2122.718) [-2119.472] (-2121.290) (-2120.828) -- 0:00:50 272500 -- (-2120.104) [-2122.051] (-2120.422) (-2119.914) * (-2123.127) [-2119.791] (-2120.021) (-2121.649) -- 0:00:50 273000 -- [-2123.002] (-2122.164) (-2122.607) (-2121.001) * (-2122.863) (-2119.261) (-2119.677) [-2120.584] -- 0:00:50 273500 -- [-2119.734] (-2123.669) (-2123.535) (-2121.118) * (-2123.628) (-2119.999) [-2120.831] (-2122.371) -- 0:00:50 274000 -- (-2119.807) [-2121.459] (-2123.519) (-2120.081) * (-2125.608) [-2122.056] (-2119.406) (-2119.166) -- 0:00:50 274500 -- [-2120.349] (-2121.476) (-2121.704) (-2119.593) * (-2124.826) (-2119.854) (-2123.707) [-2119.065] -- 0:00:50 275000 -- [-2120.889] (-2121.607) (-2120.127) (-2120.120) * (-2122.515) (-2121.985) (-2124.434) [-2119.062] -- 0:00:50 Average standard deviation of split frequencies: 0.012136 275500 -- (-2121.947) (-2125.284) (-2119.531) [-2120.089] * (-2121.004) [-2119.922] (-2122.950) (-2119.431) -- 0:00:49 276000 -- (-2124.971) (-2122.717) [-2120.509] (-2120.207) * (-2120.915) (-2121.780) [-2120.523] (-2120.223) -- 0:00:49 276500 -- [-2124.795] (-2126.531) (-2123.062) (-2120.528) * (-2121.139) (-2124.925) (-2120.982) [-2120.479] -- 0:00:49 277000 -- [-2122.475] (-2119.325) (-2123.252) (-2120.150) * (-2122.878) (-2120.022) (-2120.820) [-2119.241] -- 0:00:49 277500 -- [-2121.747] (-2119.157) (-2123.293) (-2119.854) * (-2120.699) [-2122.015] (-2122.467) (-2119.063) -- 0:00:49 278000 -- [-2121.840] (-2121.545) (-2124.453) (-2119.957) * (-2121.027) (-2121.753) [-2124.930] (-2120.291) -- 0:00:49 278500 -- (-2122.740) (-2122.022) (-2123.951) [-2119.676] * (-2122.631) [-2122.012] (-2124.871) (-2120.896) -- 0:00:49 279000 -- (-2122.208) (-2119.934) (-2121.587) [-2119.460] * (-2121.085) [-2120.037] (-2119.777) (-2121.277) -- 0:00:49 279500 -- (-2122.939) (-2119.284) (-2123.073) [-2120.823] * (-2125.692) [-2120.042] (-2119.384) (-2119.454) -- 0:00:48 280000 -- [-2125.310] (-2120.000) (-2123.328) (-2120.812) * [-2122.776] (-2122.071) (-2121.847) (-2120.046) -- 0:00:48 Average standard deviation of split frequencies: 0.010785 280500 -- (-2121.391) [-2121.302] (-2119.325) (-2120.861) * (-2120.698) (-2125.655) [-2120.079] (-2120.417) -- 0:00:48 281000 -- [-2123.091] (-2119.526) (-2122.496) (-2120.016) * (-2121.018) (-2124.338) (-2119.344) [-2119.919] -- 0:00:48 281500 -- [-2122.268] (-2120.962) (-2123.998) (-2122.007) * (-2121.494) (-2121.427) [-2120.649] (-2123.748) -- 0:00:48 282000 -- [-2121.823] (-2121.616) (-2122.948) (-2124.960) * [-2120.701] (-2120.498) (-2124.084) (-2122.166) -- 0:00:48 282500 -- [-2119.780] (-2118.993) (-2123.681) (-2125.414) * [-2119.356] (-2120.227) (-2123.812) (-2125.190) -- 0:00:50 283000 -- (-2120.811) [-2121.012] (-2125.891) (-2127.749) * (-2120.235) [-2121.472] (-2122.611) (-2123.144) -- 0:00:50 283500 -- (-2120.811) [-2120.932] (-2120.752) (-2123.377) * (-2121.277) [-2120.615] (-2120.239) (-2120.535) -- 0:00:50 284000 -- (-2119.035) (-2120.317) (-2121.921) [-2120.924] * (-2123.381) [-2120.618] (-2119.908) (-2120.878) -- 0:00:50 284500 -- (-2120.540) (-2122.251) [-2123.955] (-2118.922) * (-2120.418) (-2120.874) [-2121.892] (-2120.878) -- 0:00:50 285000 -- (-2119.994) (-2121.548) (-2119.365) [-2118.929] * [-2120.841] (-2122.573) (-2121.446) (-2123.215) -- 0:00:50 Average standard deviation of split frequencies: 0.011080 285500 -- (-2123.027) (-2119.589) (-2123.521) [-2118.895] * (-2121.876) [-2124.087] (-2120.945) (-2124.415) -- 0:00:50 286000 -- (-2120.129) [-2119.302] (-2124.003) (-2122.248) * [-2120.048] (-2122.668) (-2124.834) (-2122.821) -- 0:00:49 286500 -- (-2121.243) (-2118.851) [-2119.584] (-2122.352) * (-2120.692) (-2121.899) [-2123.352] (-2121.297) -- 0:00:49 287000 -- (-2123.897) (-2119.594) [-2120.462] (-2122.574) * (-2120.758) (-2121.557) (-2120.823) [-2120.978] -- 0:00:49 287500 -- (-2124.642) [-2118.932] (-2124.574) (-2122.002) * (-2120.380) (-2121.921) [-2119.542] (-2123.481) -- 0:00:49 288000 -- (-2124.829) (-2124.148) [-2120.386] (-2119.445) * [-2121.222] (-2120.867) (-2119.530) (-2125.079) -- 0:00:49 288500 -- (-2122.250) (-2123.843) [-2118.899] (-2121.401) * [-2122.410] (-2121.957) (-2122.681) (-2120.753) -- 0:00:49 289000 -- [-2122.153] (-2126.140) (-2119.062) (-2119.244) * (-2120.894) (-2121.231) (-2119.948) [-2120.374] -- 0:00:49 289500 -- (-2122.535) (-2122.720) [-2119.168] (-2119.935) * [-2120.850] (-2122.603) (-2120.493) (-2121.282) -- 0:00:49 290000 -- (-2120.940) [-2122.021] (-2119.553) (-2123.904) * [-2122.912] (-2122.878) (-2120.084) (-2121.153) -- 0:00:48 Average standard deviation of split frequencies: 0.011950 290500 -- (-2120.679) (-2123.332) [-2121.238] (-2123.905) * (-2118.971) (-2123.748) [-2120.217] (-2124.674) -- 0:00:48 291000 -- (-2122.919) (-2121.910) [-2120.333] (-2122.907) * (-2119.238) [-2122.386] (-2127.465) (-2121.995) -- 0:00:48 291500 -- (-2123.191) (-2120.908) [-2120.039] (-2123.575) * (-2119.812) [-2125.475] (-2124.231) (-2121.838) -- 0:00:48 292000 -- (-2122.120) (-2120.876) (-2120.533) [-2122.677] * (-2123.582) (-2122.024) [-2123.438] (-2120.315) -- 0:00:48 292500 -- (-2119.927) (-2121.599) (-2125.825) [-2121.972] * (-2121.562) (-2121.464) (-2124.669) [-2119.788] -- 0:00:48 293000 -- (-2120.475) (-2120.539) (-2121.518) [-2122.562] * [-2120.127] (-2119.386) (-2125.974) (-2122.175) -- 0:00:48 293500 -- [-2119.628] (-2123.504) (-2120.060) (-2123.244) * (-2120.253) (-2119.337) [-2131.294] (-2120.606) -- 0:00:48 294000 -- (-2120.684) (-2121.825) (-2120.083) [-2122.211] * (-2121.374) (-2120.020) [-2123.566] (-2121.697) -- 0:00:48 294500 -- (-2122.688) (-2121.817) [-2119.984] (-2120.067) * (-2119.840) (-2122.487) [-2120.640] (-2121.832) -- 0:00:47 295000 -- [-2122.709] (-2121.631) (-2123.031) (-2120.901) * (-2120.408) (-2120.552) (-2120.325) [-2123.575] -- 0:00:47 Average standard deviation of split frequencies: 0.011400 295500 -- [-2124.242] (-2124.493) (-2119.424) (-2121.327) * [-2119.385] (-2122.744) (-2122.018) (-2121.843) -- 0:00:47 296000 -- (-2124.372) (-2120.386) [-2119.588] (-2119.640) * (-2119.043) [-2122.795] (-2121.069) (-2119.855) -- 0:00:49 296500 -- (-2123.758) [-2120.578] (-2120.334) (-2120.757) * (-2120.568) (-2122.443) [-2120.763] (-2123.010) -- 0:00:49 297000 -- [-2122.187] (-2121.041) (-2120.641) (-2120.765) * (-2122.327) (-2119.306) (-2122.334) [-2120.009] -- 0:00:49 297500 -- (-2122.833) [-2120.305] (-2119.641) (-2119.357) * (-2120.511) [-2119.600] (-2121.520) (-2124.284) -- 0:00:49 298000 -- (-2121.131) [-2120.239] (-2121.075) (-2123.572) * (-2120.490) [-2119.661] (-2126.653) (-2121.910) -- 0:00:49 298500 -- [-2120.860] (-2122.810) (-2121.747) (-2126.093) * (-2121.846) [-2119.703] (-2125.001) (-2123.720) -- 0:00:49 299000 -- (-2121.553) (-2123.232) (-2119.561) [-2121.551] * [-2119.648] (-2120.547) (-2121.782) (-2119.655) -- 0:00:49 299500 -- [-2121.207] (-2125.857) (-2120.147) (-2128.241) * (-2119.892) (-2120.547) [-2120.335] (-2119.415) -- 0:00:49 300000 -- [-2122.163] (-2123.640) (-2119.297) (-2121.420) * (-2119.836) (-2122.334) [-2120.712] (-2119.395) -- 0:00:48 Average standard deviation of split frequencies: 0.012451 300500 -- (-2122.655) (-2122.956) [-2120.308] (-2123.398) * (-2119.944) (-2120.833) (-2126.753) [-2119.479] -- 0:00:48 301000 -- (-2119.134) (-2121.486) [-2119.859] (-2120.372) * (-2119.275) (-2119.938) (-2123.046) [-2119.830] -- 0:00:48 301500 -- (-2120.288) [-2119.790] (-2120.580) (-2119.997) * (-2119.558) (-2121.057) (-2120.811) [-2119.474] -- 0:00:48 302000 -- (-2119.789) (-2121.993) [-2120.423] (-2121.086) * [-2119.558] (-2125.966) (-2121.481) (-2120.950) -- 0:00:48 302500 -- (-2119.749) (-2122.605) [-2125.764] (-2120.326) * (-2119.142) [-2122.991] (-2122.147) (-2121.110) -- 0:00:48 303000 -- [-2120.652] (-2123.654) (-2122.323) (-2121.592) * (-2121.566) (-2124.403) [-2121.341] (-2121.388) -- 0:00:48 303500 -- [-2120.579] (-2123.962) (-2121.448) (-2122.436) * (-2121.232) (-2125.384) [-2121.171] (-2119.597) -- 0:00:48 304000 -- (-2122.643) (-2126.120) (-2118.775) [-2123.106] * (-2119.875) (-2124.966) [-2121.372] (-2119.676) -- 0:00:48 304500 -- [-2123.897] (-2122.934) (-2119.877) (-2121.814) * (-2123.595) (-2121.385) [-2121.711] (-2120.094) -- 0:00:47 305000 -- (-2121.309) [-2123.127] (-2119.589) (-2123.868) * [-2118.918] (-2121.325) (-2121.557) (-2120.662) -- 0:00:47 Average standard deviation of split frequencies: 0.012405 305500 -- (-2121.494) [-2123.386] (-2118.936) (-2122.231) * [-2118.984] (-2120.569) (-2121.871) (-2120.664) -- 0:00:47 306000 -- [-2120.026] (-2124.287) (-2118.933) (-2121.497) * (-2124.353) [-2122.303] (-2119.822) (-2122.078) -- 0:00:47 306500 -- (-2119.991) [-2123.302] (-2120.656) (-2123.752) * (-2124.148) (-2123.164) [-2122.259] (-2121.535) -- 0:00:47 307000 -- [-2120.322] (-2121.844) (-2125.199) (-2122.377) * [-2124.443] (-2124.399) (-2119.654) (-2120.077) -- 0:00:47 307500 -- (-2121.652) [-2119.656] (-2122.638) (-2120.304) * (-2120.013) (-2122.241) [-2120.219] (-2120.406) -- 0:00:47 308000 -- (-2119.417) (-2122.651) [-2119.206] (-2123.663) * (-2127.258) [-2120.936] (-2120.102) (-2122.239) -- 0:00:47 308500 -- (-2121.373) (-2124.222) [-2119.158] (-2126.640) * (-2122.029) (-2125.022) [-2120.936] (-2120.598) -- 0:00:47 309000 -- (-2119.980) (-2121.527) (-2121.189) [-2122.262] * [-2120.846] (-2121.835) (-2121.317) (-2121.406) -- 0:00:46 309500 -- (-2121.016) (-2124.919) [-2119.236] (-2123.825) * (-2121.035) (-2123.394) [-2120.199] (-2120.266) -- 0:00:49 310000 -- [-2120.255] (-2123.950) (-2119.915) (-2126.083) * (-2121.741) [-2120.952] (-2122.185) (-2120.012) -- 0:00:48 Average standard deviation of split frequencies: 0.010890 310500 -- (-2123.407) (-2123.291) [-2119.660] (-2120.510) * (-2119.213) (-2122.012) (-2122.106) [-2121.082] -- 0:00:48 311000 -- [-2123.715] (-2122.850) (-2121.024) (-2120.154) * (-2119.796) (-2123.747) [-2122.907] (-2121.518) -- 0:00:48 311500 -- (-2125.050) (-2121.521) (-2122.385) [-2122.423] * (-2120.066) [-2124.943] (-2120.999) (-2120.878) -- 0:00:48 312000 -- [-2121.433] (-2123.634) (-2121.282) (-2123.446) * (-2119.132) (-2127.221) (-2120.919) [-2123.773] -- 0:00:48 312500 -- (-2126.759) [-2120.416] (-2120.107) (-2120.293) * (-2121.175) (-2122.485) (-2123.213) [-2122.743] -- 0:00:48 313000 -- (-2122.989) (-2121.110) [-2123.761] (-2123.357) * (-2122.831) (-2120.508) (-2121.137) [-2122.005] -- 0:00:48 313500 -- (-2122.348) [-2120.429] (-2129.333) (-2120.932) * (-2120.864) (-2120.567) (-2121.001) [-2120.759] -- 0:00:48 314000 -- (-2122.221) (-2121.385) (-2122.469) [-2122.631] * [-2120.041] (-2120.898) (-2129.175) (-2121.729) -- 0:00:48 314500 -- (-2122.029) [-2121.420] (-2121.336) (-2123.123) * (-2120.863) (-2121.838) [-2122.058] (-2122.344) -- 0:00:47 315000 -- [-2122.687] (-2120.032) (-2121.423) (-2120.746) * (-2121.178) [-2121.575] (-2122.524) (-2122.202) -- 0:00:47 Average standard deviation of split frequencies: 0.011603 315500 -- (-2124.607) [-2123.076] (-2122.168) (-2124.955) * (-2122.648) (-2121.133) (-2121.669) [-2122.388] -- 0:00:47 316000 -- [-2124.365] (-2123.206) (-2122.188) (-2124.429) * (-2120.408) (-2124.580) [-2121.727] (-2123.718) -- 0:00:47 316500 -- [-2121.703] (-2126.467) (-2125.755) (-2122.305) * (-2121.079) [-2121.012] (-2121.726) (-2130.027) -- 0:00:47 317000 -- [-2122.914] (-2124.322) (-2123.415) (-2122.691) * (-2119.684) (-2122.508) (-2126.735) [-2125.711] -- 0:00:47 317500 -- [-2123.120] (-2123.405) (-2122.571) (-2122.344) * (-2120.023) [-2120.067] (-2123.771) (-2119.888) -- 0:00:47 318000 -- (-2122.056) (-2121.011) (-2121.313) [-2122.236] * (-2121.968) (-2120.626) (-2119.215) [-2120.552] -- 0:00:47 318500 -- [-2121.784] (-2122.191) (-2120.472) (-2124.591) * (-2119.623) (-2120.908) [-2119.594] (-2124.454) -- 0:00:47 319000 -- (-2124.860) (-2122.074) (-2120.603) [-2120.761] * (-2119.861) [-2119.936] (-2124.782) (-2121.662) -- 0:00:46 319500 -- (-2124.011) (-2125.159) (-2123.519) [-2120.439] * (-2120.432) (-2119.936) [-2121.677] (-2124.234) -- 0:00:46 320000 -- (-2122.985) [-2120.542] (-2121.256) (-2120.807) * (-2122.444) (-2119.913) (-2119.232) [-2121.000] -- 0:00:46 Average standard deviation of split frequencies: 0.012971 320500 -- (-2122.636) (-2119.709) [-2121.061] (-2122.676) * (-2121.181) (-2120.054) [-2120.118] (-2121.443) -- 0:00:46 321000 -- (-2123.064) (-2120.606) [-2121.277] (-2123.512) * (-2125.864) (-2121.051) [-2120.441] (-2121.417) -- 0:00:46 321500 -- [-2120.268] (-2120.760) (-2119.557) (-2120.051) * (-2123.712) (-2119.227) [-2124.953] (-2120.563) -- 0:00:46 322000 -- (-2119.020) (-2120.556) [-2119.474] (-2119.830) * (-2120.972) (-2119.348) [-2121.213] (-2121.328) -- 0:00:46 322500 -- (-2118.729) (-2122.773) [-2119.676] (-2119.192) * (-2121.552) (-2119.054) [-2122.151] (-2122.561) -- 0:00:46 323000 -- (-2121.163) [-2118.791] (-2119.723) (-2120.561) * (-2124.732) (-2119.139) (-2119.827) [-2122.646] -- 0:00:46 323500 -- (-2118.922) [-2118.978] (-2119.997) (-2121.329) * (-2123.128) (-2120.051) (-2119.368) [-2121.205] -- 0:00:48 324000 -- (-2122.297) [-2119.754] (-2119.997) (-2119.735) * (-2121.545) [-2120.565] (-2119.791) (-2120.340) -- 0:00:47 324500 -- (-2121.833) [-2121.239] (-2119.730) (-2124.199) * (-2122.534) [-2119.854] (-2120.065) (-2121.379) -- 0:00:47 325000 -- (-2121.716) [-2119.156] (-2119.260) (-2121.306) * (-2129.703) [-2119.476] (-2122.226) (-2120.327) -- 0:00:47 Average standard deviation of split frequencies: 0.012773 325500 -- (-2120.176) (-2120.683) [-2118.931] (-2120.364) * (-2121.357) (-2120.281) (-2124.291) [-2120.222] -- 0:00:47 326000 -- [-2121.448] (-2120.094) (-2122.513) (-2121.162) * (-2121.362) [-2119.787] (-2119.689) (-2122.526) -- 0:00:47 326500 -- [-2121.969] (-2123.698) (-2120.262) (-2119.356) * [-2120.441] (-2123.824) (-2119.698) (-2120.816) -- 0:00:47 327000 -- [-2124.947] (-2122.709) (-2120.186) (-2123.631) * (-2119.045) [-2120.358] (-2121.999) (-2121.741) -- 0:00:47 327500 -- [-2121.645] (-2119.260) (-2120.053) (-2124.290) * (-2120.076) (-2122.001) (-2122.682) [-2121.413] -- 0:00:47 328000 -- [-2120.482] (-2119.206) (-2123.400) (-2121.886) * [-2119.824] (-2121.956) (-2122.164) (-2119.975) -- 0:00:47 328500 -- (-2121.621) (-2118.957) [-2122.667] (-2123.006) * (-2119.819) (-2122.280) (-2122.483) [-2119.227] -- 0:00:47 329000 -- (-2120.810) (-2118.957) (-2121.235) [-2128.758] * (-2120.913) [-2122.641] (-2121.435) (-2119.742) -- 0:00:46 329500 -- [-2120.564] (-2120.027) (-2123.810) (-2124.451) * (-2121.430) (-2122.175) (-2120.157) [-2120.316] -- 0:00:46 330000 -- (-2123.308) [-2119.734] (-2121.146) (-2120.355) * (-2121.393) [-2120.812] (-2120.298) (-2123.238) -- 0:00:46 Average standard deviation of split frequencies: 0.013860 330500 -- (-2124.108) (-2121.695) (-2123.229) [-2120.262] * (-2121.432) (-2122.370) (-2123.519) [-2120.839] -- 0:00:46 331000 -- (-2122.632) (-2118.870) (-2119.553) [-2120.980] * (-2119.126) [-2120.681] (-2123.519) (-2124.169) -- 0:00:46 331500 -- (-2124.470) [-2120.556] (-2119.409) (-2120.091) * [-2120.826] (-2122.287) (-2119.930) (-2120.796) -- 0:00:46 332000 -- (-2122.182) (-2120.648) (-2119.439) [-2120.136] * (-2121.068) (-2120.324) (-2120.075) [-2120.641] -- 0:00:46 332500 -- (-2122.331) [-2120.115] (-2119.714) (-2124.785) * (-2121.053) [-2121.392] (-2120.196) (-2121.048) -- 0:00:46 333000 -- [-2121.464] (-2119.523) (-2122.894) (-2121.328) * (-2124.279) (-2121.421) (-2119.933) [-2119.340] -- 0:00:46 333500 -- (-2121.287) (-2120.441) (-2124.000) [-2120.270] * [-2120.630] (-2119.678) (-2121.410) (-2121.947) -- 0:00:45 334000 -- (-2122.040) (-2120.071) [-2124.727] (-2122.530) * [-2120.722] (-2118.867) (-2121.382) (-2119.912) -- 0:00:45 334500 -- (-2125.545) (-2120.546) (-2120.798) [-2120.200] * [-2121.641] (-2119.079) (-2120.594) (-2120.466) -- 0:00:45 335000 -- (-2121.569) (-2120.688) [-2121.127] (-2120.880) * (-2121.500) [-2123.775] (-2120.539) (-2121.080) -- 0:00:45 Average standard deviation of split frequencies: 0.013782 335500 -- (-2123.734) [-2120.876] (-2120.933) (-2120.846) * (-2121.792) (-2123.394) [-2120.560] (-2120.353) -- 0:00:45 336000 -- (-2120.366) [-2120.858] (-2120.529) (-2121.099) * (-2122.028) (-2127.585) [-2119.663] (-2123.300) -- 0:00:45 336500 -- (-2119.630) (-2120.667) [-2120.327] (-2124.080) * [-2119.418] (-2126.485) (-2120.225) (-2122.899) -- 0:00:45 337000 -- (-2120.885) (-2122.066) [-2122.134] (-2123.657) * (-2119.629) (-2123.627) (-2120.205) [-2122.629] -- 0:00:45 337500 -- [-2122.326] (-2119.683) (-2122.562) (-2124.540) * (-2122.891) (-2120.465) (-2120.981) [-2132.330] -- 0:00:47 338000 -- (-2120.581) (-2122.640) [-2123.903] (-2123.738) * (-2123.979) (-2120.919) [-2120.463] (-2125.273) -- 0:00:47 338500 -- (-2119.393) [-2121.827] (-2119.593) (-2124.562) * (-2124.527) (-2120.059) [-2121.172] (-2122.593) -- 0:00:46 339000 -- (-2120.884) [-2124.428] (-2119.260) (-2123.280) * [-2121.402] (-2120.315) (-2120.641) (-2121.629) -- 0:00:46 339500 -- (-2119.986) (-2122.316) [-2118.993] (-2119.816) * (-2120.938) (-2120.422) (-2123.341) [-2122.413] -- 0:00:46 340000 -- (-2124.579) (-2120.060) [-2120.797] (-2120.179) * [-2119.446] (-2120.733) (-2121.941) (-2121.178) -- 0:00:46 Average standard deviation of split frequencies: 0.012942 340500 -- (-2123.621) (-2121.068) [-2119.902] (-2120.007) * (-2122.342) [-2120.894] (-2120.474) (-2121.178) -- 0:00:46 341000 -- (-2123.666) (-2121.651) (-2120.491) [-2122.267] * (-2122.200) (-2121.840) (-2120.439) [-2125.480] -- 0:00:46 341500 -- (-2119.153) [-2121.325] (-2122.534) (-2121.346) * (-2120.636) (-2126.866) (-2120.525) [-2124.801] -- 0:00:46 342000 -- (-2118.997) [-2119.427] (-2121.878) (-2122.145) * [-2121.515] (-2120.781) (-2119.966) (-2122.346) -- 0:00:46 342500 -- (-2119.671) (-2120.006) [-2119.830] (-2120.920) * (-2121.388) [-2120.721] (-2122.914) (-2120.640) -- 0:00:46 343000 -- (-2119.985) (-2120.631) (-2121.178) [-2120.752] * (-2122.308) (-2120.833) [-2122.837] (-2121.923) -- 0:00:45 343500 -- (-2120.318) (-2120.772) (-2121.483) [-2119.511] * (-2121.015) [-2121.057] (-2120.641) (-2122.747) -- 0:00:45 344000 -- (-2119.952) [-2119.172] (-2120.142) (-2123.426) * (-2119.738) (-2120.196) [-2120.504] (-2121.276) -- 0:00:45 344500 -- (-2118.962) (-2119.681) (-2120.894) [-2122.418] * (-2121.584) (-2120.237) [-2125.030] (-2120.138) -- 0:00:45 345000 -- (-2122.965) [-2119.705] (-2124.885) (-2122.666) * [-2120.940] (-2126.739) (-2122.894) (-2120.769) -- 0:00:45 Average standard deviation of split frequencies: 0.011808 345500 -- (-2122.828) [-2119.283] (-2125.737) (-2122.071) * (-2120.419) (-2120.753) (-2120.439) [-2120.964] -- 0:00:45 346000 -- (-2122.042) (-2122.054) (-2120.714) [-2122.645] * [-2120.650] (-2120.949) (-2120.283) (-2120.953) -- 0:00:45 346500 -- (-2121.674) [-2119.531] (-2121.432) (-2121.212) * [-2119.921] (-2119.307) (-2121.921) (-2120.521) -- 0:00:45 347000 -- (-2120.471) (-2123.226) (-2121.982) [-2123.027] * (-2119.090) (-2122.775) (-2119.879) [-2119.543] -- 0:00:45 347500 -- (-2120.053) (-2122.943) (-2120.338) [-2122.955] * (-2123.922) [-2119.932] (-2120.171) (-2122.278) -- 0:00:45 348000 -- [-2121.475] (-2120.059) (-2120.727) (-2123.829) * [-2120.481] (-2119.686) (-2119.557) (-2122.795) -- 0:00:44 348500 -- [-2119.527] (-2121.733) (-2122.025) (-2119.623) * (-2123.525) (-2120.973) (-2121.190) [-2120.712] -- 0:00:44 349000 -- (-2121.936) [-2119.569] (-2126.126) (-2122.203) * (-2120.787) (-2122.831) [-2119.382] (-2120.696) -- 0:00:44 349500 -- (-2119.354) (-2119.573) (-2119.106) [-2122.133] * [-2123.877] (-2121.818) (-2119.496) (-2120.965) -- 0:00:44 350000 -- (-2119.097) [-2120.840] (-2120.397) (-2125.056) * (-2122.354) (-2122.056) [-2121.005] (-2125.105) -- 0:00:44 Average standard deviation of split frequencies: 0.011352 350500 -- [-2119.206] (-2122.346) (-2122.247) (-2121.228) * [-2122.213] (-2123.733) (-2122.564) (-2127.776) -- 0:00:44 351000 -- (-2120.206) (-2120.490) [-2121.042] (-2121.385) * (-2124.302) (-2119.805) (-2119.373) [-2126.404] -- 0:00:44 351500 -- (-2119.701) [-2121.063] (-2120.505) (-2121.295) * (-2122.325) [-2120.061] (-2119.352) (-2124.554) -- 0:00:46 352000 -- (-2121.185) (-2120.778) [-2121.657] (-2122.172) * (-2122.072) (-2120.328) [-2120.491] (-2120.436) -- 0:00:46 352500 -- [-2121.278] (-2121.583) (-2122.101) (-2123.234) * (-2123.163) (-2122.338) [-2120.383] (-2120.807) -- 0:00:45 353000 -- [-2121.403] (-2123.800) (-2120.738) (-2122.274) * (-2120.757) [-2121.585] (-2119.248) (-2127.414) -- 0:00:45 353500 -- [-2121.544] (-2122.261) (-2119.162) (-2121.917) * (-2122.067) (-2122.274) [-2119.615] (-2125.081) -- 0:00:45 354000 -- (-2127.382) [-2123.439] (-2120.589) (-2121.788) * (-2122.298) [-2119.998] (-2121.762) (-2124.726) -- 0:00:45 354500 -- [-2120.204] (-2125.776) (-2121.372) (-2121.500) * (-2120.599) (-2119.195) [-2121.971] (-2120.312) -- 0:00:45 355000 -- (-2121.056) (-2121.711) [-2122.984] (-2122.585) * (-2120.066) (-2119.054) [-2120.366] (-2118.829) -- 0:00:45 Average standard deviation of split frequencies: 0.011329 355500 -- [-2120.917] (-2119.597) (-2120.561) (-2121.350) * (-2120.274) (-2120.286) [-2119.909] (-2119.209) -- 0:00:45 356000 -- (-2120.388) [-2121.980] (-2124.422) (-2119.913) * (-2121.167) (-2119.297) (-2122.129) [-2119.195] -- 0:00:45 356500 -- (-2119.963) (-2121.981) (-2124.964) [-2119.506] * [-2119.310] (-2122.090) (-2121.562) (-2119.185) -- 0:00:45 357000 -- (-2120.262) (-2121.219) (-2120.688) [-2121.399] * (-2120.175) (-2123.919) (-2125.484) [-2120.227] -- 0:00:45 357500 -- (-2121.324) (-2120.079) [-2119.541] (-2121.404) * (-2123.391) (-2124.288) [-2121.271] (-2120.254) -- 0:00:44 358000 -- (-2119.678) (-2119.318) [-2119.570] (-2121.698) * [-2120.286] (-2128.661) (-2121.319) (-2119.769) -- 0:00:44