--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:39:14 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1339/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2120.34 -2123.28 2 -2120.36 -2125.44 -------------------------------------- TOTAL -2120.35 -2124.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899146 0.088910 0.378539 1.497152 0.862669 832.77 1140.49 1.001 r(A<->C){all} 0.157979 0.017199 0.000122 0.431004 0.123115 167.27 201.42 1.005 r(A<->G){all} 0.180790 0.021744 0.000161 0.482132 0.144867 152.98 223.34 1.007 r(A<->T){all} 0.166610 0.020798 0.000075 0.459213 0.126558 217.92 230.07 1.002 r(C<->G){all} 0.166227 0.019595 0.000144 0.452034 0.130329 102.13 138.86 1.010 r(C<->T){all} 0.159234 0.017823 0.000030 0.423067 0.126687 288.98 314.71 1.001 r(G<->T){all} 0.169161 0.021391 0.000060 0.473843 0.125348 129.16 144.76 1.001 pi(A){all} 0.195992 0.000100 0.176050 0.215564 0.195966 1119.70 1229.60 1.000 pi(C){all} 0.348534 0.000133 0.326733 0.371374 0.348518 1367.55 1383.97 1.002 pi(G){all} 0.286474 0.000125 0.265396 0.309250 0.286409 1341.25 1374.00 1.000 pi(T){all} 0.169000 0.000096 0.150566 0.188426 0.168907 1055.70 1116.64 1.000 alpha{1,2} 0.438335 0.254580 0.000109 1.417447 0.260389 1294.41 1337.33 1.000 alpha{3} 0.450780 0.240929 0.000217 1.442928 0.286566 645.12 967.68 1.000 pinvar{all} 0.999019 0.000001 0.996851 0.999998 0.999367 1018.68 1041.59 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2047.531568 Model 2: PositiveSelection -2047.531581 Model 0: one-ratio -2047.531592 Model 7: beta -2047.531552 Model 8: beta&w>1 -2047.531509 Model 0 vs 1 4.799999987881165E-5 Model 2 vs 1 2.5999999706982635E-5 Model 8 vs 7 8.600000001024455E-5
>C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=525 C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA ************************************************** C1 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C2 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C3 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C4 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C5 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C6 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL ************************************************** C1 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C2 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C3 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C4 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C5 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C6 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS ************************************************** C1 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C2 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C3 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C4 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C5 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C6 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN ************************************************** C1 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C2 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C3 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C4 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C5 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C6 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG ************************************************** C1 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C2 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C3 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C4 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C5 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C6 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF ************************************************** C1 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C2 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C3 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C4 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C5 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C6 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF ************************************************** C1 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C2 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C3 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C4 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C5 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C6 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ************************************************** C1 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C2 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C3 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C4 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C5 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C6 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL ************************************************** C1 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C2 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C3 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C4 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C5 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C6 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ************************************************** C1 ACAVPPIIGYLTSGKLPATDTYCPA C2 ACAVPPIIGYLTSGKLPATDTYCPA C3 ACAVPPIIGYLTSGKLPATDTYCPA C4 ACAVPPIIGYLTSGKLPATDTYCPA C5 ACAVPPIIGYLTSGKLPATDTYCPA C6 ACAVPPIIGYLTSGKLPATDTYCPA ************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 525 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 525 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15750] Library Relaxation: Multi_proc [96] Relaxation Summary: [15750]--->[15750] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.567 Mb, Max= 31.129 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA ************************************************** C1 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C2 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C3 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C4 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C5 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL C6 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL ************************************************** C1 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C2 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C3 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C4 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C5 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS C6 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS ************************************************** C1 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C2 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C3 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C4 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C5 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN C6 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN ************************************************** C1 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C2 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C3 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C4 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C5 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG C6 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG ************************************************** C1 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C2 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C3 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C4 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C5 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF C6 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF ************************************************** C1 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C2 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C3 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C4 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C5 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF C6 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF ************************************************** C1 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C2 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C3 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C4 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C5 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD C6 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ************************************************** C1 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C2 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C3 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C4 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C5 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL C6 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL ************************************************** C1 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C2 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C3 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C4 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C5 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS C6 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ************************************************** C1 ACAVPPIIGYLTSGKLPATDTYCPA C2 ACAVPPIIGYLTSGKLPATDTYCPA C3 ACAVPPIIGYLTSGKLPATDTYCPA C4 ACAVPPIIGYLTSGKLPATDTYCPA C5 ACAVPPIIGYLTSGKLPATDTYCPA C6 ACAVPPIIGYLTSGKLPATDTYCPA ************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C2 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C3 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C4 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C5 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT C6 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT ************************************************** C1 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C2 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C3 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C4 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C5 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA C6 GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ************************************************** C1 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C2 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C3 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C4 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C5 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC C6 ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ************************************************** C1 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C2 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C3 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C4 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C5 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA C6 ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA ************************************************** C1 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C2 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C3 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C4 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C5 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG C6 CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG ************************************************** C1 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C2 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C3 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C4 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C5 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC C6 CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC ************************************************** C1 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C2 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C3 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C4 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C5 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC C6 GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC ************************************************** C1 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C2 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C3 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C4 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C5 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG C6 CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG ************************************************** C1 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C2 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C3 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C4 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C5 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG C6 GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG ************************************************** C1 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C2 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C3 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C4 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C5 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG C6 GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG ************************************************** C1 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C2 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C3 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C4 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C5 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA C6 CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA ************************************************** C1 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C2 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C3 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C4 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C5 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC C6 AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC ************************************************** C1 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C2 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C3 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C4 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C5 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC C6 CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ************************************************** C1 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C2 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C3 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C4 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C5 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC C6 ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC ************************************************** C1 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C2 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C3 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C4 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C5 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC C6 GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC ************************************************** C1 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C2 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C3 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C4 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C5 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT C6 AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT ************************************************** C1 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C2 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C3 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C4 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C5 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG C6 CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG ************************************************** C1 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C2 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C3 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C4 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C5 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC C6 CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC ************************************************** C1 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C2 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C3 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C4 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C5 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG C6 GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG ************************************************** C1 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C2 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C3 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C4 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C5 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG C6 CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG ************************************************** C1 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C2 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C3 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C4 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C5 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC C6 GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC ************************************************** C1 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C2 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C3 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C4 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C5 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC C6 CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC ************************************************** C1 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C2 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C3 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C4 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C5 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT C6 GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT ************************************************** C1 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C2 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C3 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C4 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C5 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC C6 CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC ************************************************** C1 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C2 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C3 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C4 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C5 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG C6 GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG ************************************************** C1 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C2 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C3 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C4 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C5 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA C6 GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA ************************************************** C1 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C2 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C3 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C4 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C5 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC C6 AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC ************************************************** C1 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C2 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C3 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C4 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C5 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT C6 AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT ************************************************** C1 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C2 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C3 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C4 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C5 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA C6 TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA ************************************************** C1 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C2 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C3 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C4 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C5 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG C6 GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG ************************************************** C1 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C2 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C3 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C4 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C5 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC C6 GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC ************************************************** C1 CGCAACTGACACCTACTGTCCCGCC C2 CGCAACTGACACCTACTGTCCCGCC C3 CGCAACTGACACCTACTGTCCCGCC C4 CGCAACTGACACCTACTGTCCCGCC C5 CGCAACTGACACCTACTGTCCCGCC C6 CGCAACTGACACCTACTGTCCCGCC ************************* >C1 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C2 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C3 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C4 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C5 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C6 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >C1 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C2 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C3 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C4 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C5 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >C6 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1575 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858662 Setting output file names to "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1367232649 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5937814289 Seed = 1357691827 Swapseed = 1579858662 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3524.924980 -- -24.965149 Chain 2 -- -3524.924980 -- -24.965149 Chain 3 -- -3524.925518 -- -24.965149 Chain 4 -- -3524.925518 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3524.925518 -- -24.965149 Chain 2 -- -3524.925518 -- -24.965149 Chain 3 -- -3524.925317 -- -24.965149 Chain 4 -- -3524.925518 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3524.925] (-3524.925) (-3524.926) (-3524.926) * [-3524.926] (-3524.926) (-3524.925) (-3524.926) 500 -- (-2173.726) (-2150.912) [-2138.103] (-2178.388) * (-2130.016) (-2133.516) (-2169.769) [-2135.874] -- 0:00:00 1000 -- (-2126.960) [-2131.461] (-2128.273) (-2140.681) * (-2127.988) (-2130.828) (-2153.030) [-2129.085] -- 0:00:00 1500 -- (-2126.056) [-2127.054] (-2128.615) (-2140.056) * (-2129.869) [-2128.759] (-2140.090) (-2132.646) -- 0:00:00 2000 -- [-2131.565] (-2131.500) (-2130.096) (-2131.220) * [-2133.151] (-2131.403) (-2136.567) (-2127.050) -- 0:00:00 2500 -- (-2130.620) (-2137.879) (-2127.701) [-2128.551] * (-2136.183) [-2128.298] (-2130.881) (-2135.277) -- 0:00:00 3000 -- (-2133.299) [-2124.758] (-2129.071) (-2128.866) * (-2125.879) [-2124.509] (-2126.656) (-2136.442) -- 0:00:00 3500 -- (-2136.121) (-2130.517) (-2127.373) [-2122.484] * (-2133.337) (-2132.087) [-2128.170] (-2128.240) -- 0:00:00 4000 -- (-2130.231) [-2126.409] (-2132.799) (-2128.254) * (-2132.892) (-2128.502) [-2126.877] (-2130.315) -- 0:00:00 4500 -- (-2126.841) (-2128.339) [-2126.115] (-2127.948) * [-2127.313] (-2126.247) (-2132.859) (-2129.098) -- 0:00:00 5000 -- (-2131.855) [-2127.098] (-2130.959) (-2125.104) * (-2124.237) (-2137.807) (-2134.152) [-2126.479] -- 0:00:00 Average standard deviation of split frequencies: 0.078567 5500 -- (-2132.022) (-2128.558) (-2139.482) [-2127.171] * [-2131.637] (-2131.581) (-2127.159) (-2127.597) -- 0:00:00 6000 -- (-2125.749) (-2132.939) (-2135.098) [-2125.506] * (-2126.275) (-2127.495) [-2129.110] (-2130.829) -- 0:00:00 6500 -- (-2137.519) (-2128.602) (-2130.677) [-2125.678] * [-2129.438] (-2130.868) (-2135.992) (-2124.272) -- 0:00:00 7000 -- [-2124.956] (-2132.342) (-2129.505) (-2128.248) * (-2139.128) (-2132.694) [-2126.360] (-2136.337) -- 0:00:00 7500 -- [-2135.581] (-2128.591) (-2139.721) (-2128.476) * (-2127.618) [-2126.635] (-2137.203) (-2128.899) -- 0:00:00 8000 -- (-2136.855) [-2127.730] (-2129.481) (-2126.136) * (-2132.119) (-2132.585) (-2125.804) [-2127.446] -- 0:02:04 8500 -- (-2132.127) (-2131.747) (-2128.965) [-2130.094] * [-2128.776] (-2129.859) (-2135.470) (-2136.692) -- 0:01:56 9000 -- (-2127.880) (-2128.103) (-2131.854) [-2125.027] * (-2127.953) (-2125.650) (-2127.252) [-2132.576] -- 0:01:50 9500 -- (-2142.197) [-2131.432] (-2127.983) (-2134.645) * (-2135.318) [-2131.973] (-2133.359) (-2127.676) -- 0:01:44 10000 -- (-2131.951) [-2133.200] (-2131.318) (-2123.534) * (-2133.596) (-2143.565) (-2127.440) [-2129.328] -- 0:01:39 Average standard deviation of split frequencies: 0.072106 10500 -- (-2129.305) (-2129.640) [-2131.835] (-2129.563) * [-2134.159] (-2129.952) (-2129.371) (-2134.039) -- 0:01:34 11000 -- (-2128.332) (-2141.872) (-2128.410) [-2129.099] * (-2125.809) (-2131.853) [-2129.341] (-2129.115) -- 0:01:29 11500 -- (-2127.432) [-2130.021] (-2129.798) (-2128.200) * [-2127.623] (-2126.437) (-2131.605) (-2140.905) -- 0:01:25 12000 -- (-2132.461) (-2129.693) [-2127.439] (-2127.651) * (-2128.148) [-2129.209] (-2125.640) (-2129.359) -- 0:01:22 12500 -- (-2127.298) (-2121.381) [-2127.321] (-2135.496) * (-2131.531) (-2126.600) [-2127.481] (-2131.042) -- 0:01:19 13000 -- [-2130.452] (-2121.924) (-2132.153) (-2125.829) * (-2130.211) (-2131.122) [-2125.461] (-2139.617) -- 0:01:15 13500 -- (-2129.211) (-2121.015) (-2126.773) [-2125.304] * [-2126.685] (-2125.236) (-2130.115) (-2133.849) -- 0:01:13 14000 -- [-2129.899] (-2120.208) (-2127.945) (-2134.565) * [-2129.261] (-2130.941) (-2129.975) (-2125.621) -- 0:01:10 14500 -- (-2124.757) (-2119.634) (-2127.899) [-2128.492] * (-2132.528) (-2132.551) [-2127.443] (-2127.072) -- 0:01:07 15000 -- (-2125.752) (-2126.096) [-2129.778] (-2130.697) * [-2127.512] (-2125.292) (-2134.160) (-2129.783) -- 0:01:05 Average standard deviation of split frequencies: 0.055979 15500 -- (-2128.678) (-2121.120) (-2131.917) [-2130.204] * (-2129.585) [-2125.158] (-2131.422) (-2127.211) -- 0:01:03 16000 -- [-2121.627] (-2123.399) (-2138.074) (-2136.242) * (-2133.763) (-2125.046) [-2134.664] (-2128.068) -- 0:01:01 16500 -- [-2122.494] (-2122.637) (-2133.015) (-2132.878) * (-2131.545) (-2124.891) [-2130.928] (-2129.598) -- 0:00:59 17000 -- [-2120.025] (-2121.359) (-2125.253) (-2130.712) * [-2130.179] (-2123.887) (-2124.714) (-2131.352) -- 0:00:57 17500 -- [-2120.960] (-2125.102) (-2134.424) (-2127.776) * (-2139.181) [-2123.889] (-2122.228) (-2130.734) -- 0:00:56 18000 -- [-2122.611] (-2123.782) (-2132.847) (-2130.256) * [-2132.797] (-2121.488) (-2121.745) (-2133.230) -- 0:00:54 18500 -- (-2123.336) [-2122.818] (-2129.195) (-2132.290) * (-2134.255) (-2120.991) [-2124.490] (-2128.278) -- 0:00:53 19000 -- (-2120.453) (-2120.699) (-2129.276) [-2131.355] * [-2128.144] (-2121.874) (-2126.060) (-2128.281) -- 0:00:51 19500 -- (-2120.807) (-2122.475) (-2133.899) [-2129.080] * [-2128.301] (-2124.190) (-2125.578) (-2128.721) -- 0:00:50 20000 -- (-2121.094) (-2120.248) (-2143.381) [-2129.963] * (-2130.582) (-2134.058) (-2122.953) [-2127.986] -- 0:00:49 Average standard deviation of split frequencies: 0.055012 20500 -- (-2120.154) [-2121.060] (-2142.577) (-2132.258) * (-2129.183) [-2132.699] (-2126.158) (-2126.214) -- 0:00:47 21000 -- [-2121.406] (-2119.343) (-2131.278) (-2127.047) * [-2125.490] (-2122.273) (-2124.864) (-2126.220) -- 0:00:46 21500 -- (-2120.769) (-2120.766) [-2128.005] (-2126.622) * (-2134.871) (-2121.985) [-2123.463] (-2127.738) -- 0:01:31 22000 -- (-2119.956) (-2121.266) (-2128.078) [-2126.053] * (-2132.572) (-2120.753) [-2123.691] (-2131.247) -- 0:01:28 22500 -- (-2119.953) [-2123.683] (-2131.575) (-2133.158) * (-2131.331) [-2122.332] (-2123.370) (-2123.948) -- 0:01:26 23000 -- (-2120.836) (-2123.605) [-2127.249] (-2134.826) * [-2126.947] (-2121.185) (-2123.964) (-2124.507) -- 0:01:24 23500 -- (-2119.742) (-2124.621) (-2130.294) [-2129.829] * [-2132.023] (-2123.003) (-2131.195) (-2127.475) -- 0:01:23 24000 -- (-2122.218) (-2123.357) [-2131.873] (-2137.119) * (-2132.964) (-2119.765) [-2122.750] (-2124.686) -- 0:01:21 24500 -- (-2121.975) [-2122.986] (-2160.780) (-2126.044) * (-2132.670) [-2119.748] (-2125.449) (-2126.562) -- 0:01:19 25000 -- (-2119.825) (-2122.152) [-2120.750] (-2129.923) * (-2130.803) [-2120.808] (-2124.877) (-2126.962) -- 0:01:18 Average standard deviation of split frequencies: 0.038075 25500 -- (-2120.393) [-2122.712] (-2121.111) (-2142.985) * (-2131.952) (-2120.718) [-2119.631] (-2125.552) -- 0:01:16 26000 -- [-2121.530] (-2121.891) (-2122.194) (-2129.189) * (-2128.795) [-2119.279] (-2119.291) (-2135.263) -- 0:01:14 26500 -- [-2121.968] (-2122.451) (-2122.146) (-2134.714) * [-2126.056] (-2119.745) (-2120.437) (-2130.852) -- 0:01:13 27000 -- (-2121.978) (-2120.171) (-2122.138) [-2131.174] * [-2128.575] (-2120.550) (-2120.747) (-2127.323) -- 0:01:12 27500 -- (-2122.052) (-2120.011) [-2120.659] (-2134.201) * [-2130.401] (-2119.855) (-2122.499) (-2129.606) -- 0:01:10 28000 -- (-2121.744) (-2119.773) (-2121.689) [-2129.888] * (-2128.350) [-2119.631] (-2122.499) (-2127.782) -- 0:01:09 28500 -- (-2121.164) (-2122.015) (-2122.096) [-2124.778] * [-2128.010] (-2122.274) (-2121.092) (-2128.164) -- 0:01:08 29000 -- (-2121.948) [-2122.115] (-2124.503) (-2127.661) * (-2131.859) (-2121.215) [-2122.506] (-2126.410) -- 0:01:06 29500 -- (-2121.051) (-2120.062) [-2124.607] (-2130.021) * (-2131.743) (-2121.299) (-2121.129) [-2131.593] -- 0:01:05 30000 -- (-2121.046) (-2120.186) [-2126.126] (-2127.705) * [-2133.038] (-2122.692) (-2121.520) (-2131.063) -- 0:01:04 Average standard deviation of split frequencies: 0.033980 30500 -- (-2126.186) (-2119.938) [-2126.421] (-2130.952) * (-2131.536) (-2123.019) (-2120.391) [-2126.106] -- 0:01:03 31000 -- [-2125.770] (-2119.930) (-2125.925) (-2132.761) * (-2141.056) [-2123.712] (-2120.520) (-2129.428) -- 0:01:02 31500 -- [-2123.526] (-2119.925) (-2123.658) (-2130.315) * [-2128.005] (-2120.087) (-2123.126) (-2136.361) -- 0:01:01 32000 -- (-2123.950) (-2121.490) (-2126.074) [-2127.954] * (-2132.834) [-2120.587] (-2122.426) (-2130.699) -- 0:01:00 32500 -- [-2124.997] (-2122.133) (-2121.966) (-2127.840) * [-2128.247] (-2121.888) (-2122.605) (-2134.970) -- 0:00:59 33000 -- (-2121.793) (-2120.198) (-2121.331) [-2126.662] * (-2128.268) (-2125.942) (-2125.460) [-2122.323] -- 0:00:58 33500 -- (-2120.476) [-2120.095] (-2119.983) (-2128.316) * [-2125.680] (-2122.202) (-2123.852) (-2120.311) -- 0:00:57 34000 -- [-2121.326] (-2119.841) (-2119.792) (-2129.679) * [-2124.887] (-2121.445) (-2122.583) (-2121.117) -- 0:00:56 34500 -- (-2122.313) [-2120.629] (-2119.422) (-2128.268) * (-2131.889) [-2122.533] (-2124.755) (-2123.017) -- 0:00:55 35000 -- [-2122.149] (-2124.098) (-2122.987) (-2127.649) * (-2132.050) [-2122.172] (-2124.970) (-2123.414) -- 0:00:55 Average standard deviation of split frequencies: 0.044797 35500 -- [-2124.383] (-2120.746) (-2123.152) (-2128.802) * [-2133.469] (-2120.884) (-2126.665) (-2122.781) -- 0:01:21 36000 -- (-2121.400) (-2125.203) [-2123.330] (-2125.532) * (-2131.521) (-2120.998) (-2121.617) [-2122.676] -- 0:01:20 36500 -- (-2121.707) (-2120.294) (-2121.988) [-2125.105] * [-2129.690] (-2120.881) (-2123.238) (-2123.066) -- 0:01:19 37000 -- [-2122.879] (-2119.776) (-2120.688) (-2130.937) * (-2131.739) (-2122.210) [-2122.827] (-2124.791) -- 0:01:18 37500 -- (-2123.049) (-2120.896) [-2119.826] (-2137.726) * [-2127.194] (-2122.235) (-2120.471) (-2120.766) -- 0:01:17 38000 -- (-2122.112) (-2121.611) [-2120.706] (-2135.209) * (-2133.446) (-2120.705) (-2119.454) [-2120.831] -- 0:01:15 38500 -- (-2122.263) (-2120.516) [-2119.962] (-2130.759) * (-2131.528) (-2121.576) (-2119.215) [-2120.325] -- 0:01:14 39000 -- (-2122.539) (-2119.547) [-2118.970] (-2128.100) * (-2126.252) (-2121.539) [-2119.243] (-2122.963) -- 0:01:13 39500 -- (-2122.428) (-2120.162) [-2118.865] (-2136.368) * (-2137.293) (-2123.959) [-2119.575] (-2121.051) -- 0:01:12 40000 -- (-2120.255) (-2121.287) [-2119.081] (-2136.657) * (-2130.757) (-2124.121) [-2119.357] (-2120.300) -- 0:01:12 Average standard deviation of split frequencies: 0.047656 40500 -- (-2121.030) (-2124.408) (-2119.011) [-2128.534] * (-2124.560) (-2122.749) (-2119.357) [-2119.109] -- 0:01:11 41000 -- (-2119.894) (-2124.108) [-2119.032] (-2127.032) * (-2134.113) (-2123.936) [-2120.512] (-2118.999) -- 0:01:10 41500 -- (-2119.882) (-2121.980) (-2119.065) [-2126.642] * (-2136.152) (-2120.233) [-2120.954] (-2119.625) -- 0:01:09 42000 -- (-2121.134) [-2120.719] (-2122.143) (-2128.962) * (-2134.633) (-2121.465) [-2125.467] (-2122.080) -- 0:01:08 42500 -- (-2120.727) (-2119.891) (-2123.077) [-2127.470] * (-2132.073) [-2119.889] (-2124.147) (-2122.080) -- 0:01:07 43000 -- (-2119.695) [-2119.030] (-2121.820) (-2126.677) * (-2129.602) (-2120.931) (-2122.705) [-2122.216] -- 0:01:06 43500 -- (-2121.855) [-2118.999] (-2122.080) (-2134.567) * (-2131.835) (-2120.927) (-2122.798) [-2121.608] -- 0:01:05 44000 -- (-2125.830) (-2120.274) [-2121.315] (-2130.802) * (-2128.507) [-2119.271] (-2122.156) (-2120.615) -- 0:01:05 44500 -- (-2123.491) [-2120.825] (-2123.243) (-2128.596) * [-2126.431] (-2119.566) (-2122.149) (-2120.551) -- 0:01:04 45000 -- (-2120.961) (-2122.428) [-2121.162] (-2126.786) * [-2127.639] (-2119.836) (-2120.312) (-2120.482) -- 0:01:03 Average standard deviation of split frequencies: 0.043041 45500 -- (-2121.983) (-2121.297) [-2123.164] (-2123.465) * (-2132.868) [-2119.853] (-2119.996) (-2119.381) -- 0:01:02 46000 -- [-2121.217] (-2123.097) (-2124.519) (-2127.916) * [-2126.739] (-2119.390) (-2119.218) (-2121.041) -- 0:01:02 46500 -- [-2119.069] (-2124.983) (-2128.951) (-2137.626) * (-2132.120) [-2120.731] (-2120.522) (-2123.291) -- 0:01:01 47000 -- (-2120.392) (-2126.004) (-2127.638) [-2131.381] * (-2130.251) [-2121.040] (-2119.979) (-2118.934) -- 0:01:00 47500 -- (-2121.961) (-2121.528) (-2120.843) [-2127.710] * (-2130.230) (-2120.855) [-2118.723] (-2119.706) -- 0:01:00 48000 -- (-2121.492) (-2123.359) [-2120.226] (-2139.350) * (-2129.972) (-2121.027) (-2119.251) [-2118.674] -- 0:00:59 48500 -- [-2120.762] (-2120.339) (-2125.280) (-2133.316) * [-2130.077] (-2119.455) (-2119.607) (-2118.741) -- 0:00:58 49000 -- (-2119.594) [-2119.284] (-2122.231) (-2133.365) * (-2131.658) [-2120.240] (-2121.014) (-2119.013) -- 0:00:58 49500 -- (-2122.028) [-2120.830] (-2122.422) (-2130.608) * [-2128.478] (-2126.728) (-2120.723) (-2119.588) -- 0:01:16 50000 -- (-2119.915) (-2120.268) (-2121.487) [-2129.257] * (-2132.296) (-2122.406) [-2120.592] (-2119.553) -- 0:01:16 Average standard deviation of split frequencies: 0.043862 50500 -- [-2119.286] (-2119.502) (-2119.794) (-2129.498) * [-2134.426] (-2122.375) (-2120.556) (-2119.054) -- 0:01:15 51000 -- (-2119.292) [-2120.004] (-2120.040) (-2128.379) * (-2129.872) (-2125.364) [-2119.811] (-2120.872) -- 0:01:14 51500 -- (-2119.874) (-2119.747) [-2119.499] (-2129.786) * (-2138.227) [-2122.734] (-2119.734) (-2120.090) -- 0:01:13 52000 -- [-2119.331] (-2119.240) (-2122.965) (-2126.597) * (-2128.615) [-2123.636] (-2120.775) (-2123.994) -- 0:01:12 52500 -- (-2119.604) (-2119.929) (-2121.034) [-2132.278] * (-2133.737) (-2122.628) [-2122.781] (-2123.637) -- 0:01:12 53000 -- (-2121.728) [-2119.749] (-2128.527) (-2129.700) * (-2136.040) (-2122.711) (-2120.820) [-2120.956] -- 0:01:11 53500 -- (-2121.653) [-2120.022] (-2122.961) (-2131.644) * (-2128.797) (-2121.241) [-2120.534] (-2121.734) -- 0:01:10 54000 -- (-2122.462) (-2120.016) (-2122.615) [-2130.173] * [-2132.624] (-2123.583) (-2120.228) (-2120.675) -- 0:01:10 54500 -- (-2121.826) (-2120.238) [-2124.220] (-2126.281) * (-2131.099) (-2119.640) [-2123.000] (-2119.961) -- 0:01:09 55000 -- (-2122.664) (-2120.236) (-2127.930) [-2130.331] * (-2130.938) (-2120.057) (-2125.073) [-2122.561] -- 0:01:08 Average standard deviation of split frequencies: 0.037279 55500 -- (-2122.643) (-2120.944) [-2124.796] (-2134.903) * (-2129.287) (-2123.086) [-2123.810] (-2125.227) -- 0:01:08 56000 -- (-2122.648) (-2120.944) (-2123.489) [-2127.664] * [-2130.139] (-2120.978) (-2120.481) (-2122.658) -- 0:01:07 56500 -- (-2121.339) (-2121.326) [-2123.848] (-2136.224) * (-2127.091) [-2121.719] (-2120.809) (-2122.240) -- 0:01:06 57000 -- (-2123.909) [-2120.425] (-2125.596) (-2130.484) * (-2127.514) (-2121.669) (-2122.211) [-2120.559] -- 0:01:06 57500 -- [-2124.675] (-2120.487) (-2123.584) (-2132.104) * (-2127.584) (-2121.789) (-2123.047) [-2122.479] -- 0:01:05 58000 -- (-2127.002) (-2122.544) [-2123.147] (-2132.119) * [-2126.684] (-2121.770) (-2123.538) (-2120.113) -- 0:01:04 58500 -- (-2122.692) (-2121.649) (-2121.182) [-2127.886] * (-2137.040) (-2121.336) [-2123.584] (-2120.439) -- 0:01:04 59000 -- (-2123.570) [-2123.967] (-2121.122) (-2129.721) * (-2124.002) (-2120.871) (-2125.140) [-2120.955] -- 0:01:03 59500 -- (-2121.734) (-2122.436) [-2121.675] (-2132.286) * [-2127.209] (-2121.975) (-2122.154) (-2122.163) -- 0:01:03 60000 -- (-2123.618) (-2120.110) (-2122.085) [-2128.708] * [-2129.454] (-2122.467) (-2122.995) (-2123.772) -- 0:01:02 Average standard deviation of split frequencies: 0.034762 60500 -- (-2122.536) (-2122.661) [-2122.078] (-2130.374) * (-2134.211) [-2122.379] (-2120.126) (-2121.161) -- 0:01:02 61000 -- (-2121.393) (-2122.015) (-2122.412) [-2128.852] * [-2133.095] (-2122.842) (-2119.946) (-2119.147) -- 0:01:01 61500 -- [-2120.152] (-2119.548) (-2126.258) (-2133.963) * (-2127.915) [-2121.008] (-2120.752) (-2119.817) -- 0:01:01 62000 -- (-2120.123) (-2119.548) [-2124.985] (-2141.390) * (-2131.848) (-2120.467) (-2122.346) [-2119.638] -- 0:01:00 62500 -- (-2120.881) [-2119.210] (-2123.135) (-2135.683) * (-2126.664) (-2121.600) [-2120.226] (-2119.161) -- 0:01:00 63000 -- (-2120.609) [-2119.517] (-2123.190) (-2126.357) * [-2131.909] (-2121.019) (-2121.302) (-2118.896) -- 0:00:59 63500 -- [-2121.498] (-2119.422) (-2126.475) (-2133.488) * (-2133.890) (-2120.600) [-2121.699] (-2120.396) -- 0:00:58 64000 -- (-2119.909) (-2119.187) (-2125.578) [-2125.519] * (-2132.730) [-2120.636] (-2122.492) (-2119.503) -- 0:01:13 64500 -- (-2121.757) [-2120.676] (-2124.443) (-2133.586) * (-2126.535) (-2121.424) [-2125.399] (-2125.254) -- 0:01:12 65000 -- (-2123.290) (-2119.975) (-2123.821) [-2139.017] * [-2128.421] (-2122.806) (-2122.898) (-2119.755) -- 0:01:11 Average standard deviation of split frequencies: 0.032466 65500 -- (-2121.130) (-2119.977) (-2124.006) [-2131.646] * (-2127.643) [-2122.442] (-2134.114) (-2119.743) -- 0:01:11 66000 -- [-2121.257] (-2120.302) (-2126.817) (-2131.838) * [-2126.894] (-2121.524) (-2124.761) (-2121.438) -- 0:01:10 66500 -- (-2119.534) [-2119.466] (-2124.556) (-2131.131) * (-2138.095) (-2121.198) (-2121.126) [-2120.673] -- 0:01:10 67000 -- (-2119.229) [-2120.286] (-2124.359) (-2130.997) * (-2135.150) [-2120.700] (-2121.251) (-2122.526) -- 0:01:09 67500 -- (-2120.804) [-2119.713] (-2125.637) (-2128.124) * (-2129.733) (-2120.999) (-2120.939) [-2120.326] -- 0:01:09 68000 -- [-2120.653] (-2120.696) (-2121.280) (-2129.039) * (-2134.766) (-2124.169) [-2119.574] (-2119.201) -- 0:01:08 68500 -- (-2125.084) [-2121.655] (-2121.448) (-2137.011) * (-2126.768) [-2121.969] (-2123.162) (-2120.747) -- 0:01:07 69000 -- (-2124.331) (-2121.990) [-2121.230] (-2132.146) * [-2126.854] (-2122.073) (-2121.231) (-2120.724) -- 0:01:07 69500 -- (-2123.653) [-2119.777] (-2121.138) (-2124.984) * (-2135.399) [-2121.312] (-2121.270) (-2118.796) -- 0:01:06 70000 -- [-2119.536] (-2120.247) (-2120.670) (-2126.270) * (-2136.161) (-2120.506) [-2119.785] (-2120.111) -- 0:01:06 Average standard deviation of split frequencies: 0.025730 70500 -- (-2119.801) [-2120.162] (-2125.193) (-2125.893) * [-2139.365] (-2120.515) (-2120.009) (-2118.825) -- 0:01:05 71000 -- [-2122.022] (-2120.527) (-2125.965) (-2134.006) * [-2127.801] (-2121.162) (-2119.834) (-2118.981) -- 0:01:05 71500 -- (-2119.933) (-2121.860) [-2123.265] (-2126.342) * [-2123.781] (-2121.445) (-2121.506) (-2119.923) -- 0:01:04 72000 -- [-2121.009] (-2123.212) (-2123.401) (-2138.649) * (-2126.735) (-2121.468) (-2119.827) [-2119.923] -- 0:01:04 72500 -- [-2119.670] (-2121.320) (-2124.357) (-2126.922) * (-2124.361) (-2124.095) [-2119.282] (-2119.923) -- 0:01:03 73000 -- (-2122.544) (-2121.698) [-2123.451] (-2136.392) * (-2130.246) (-2124.383) [-2119.866] (-2120.012) -- 0:01:03 73500 -- [-2119.178] (-2122.103) (-2123.030) (-2129.156) * (-2131.182) (-2123.132) [-2121.718] (-2121.077) -- 0:01:03 74000 -- (-2118.998) (-2124.650) [-2124.239] (-2129.849) * [-2132.331] (-2125.031) (-2119.814) (-2120.437) -- 0:01:02 74500 -- (-2119.034) (-2120.275) (-2125.785) [-2127.208] * (-2130.825) (-2120.401) [-2120.281] (-2119.965) -- 0:01:02 75000 -- [-2119.438] (-2123.309) (-2124.488) (-2122.877) * (-2134.603) [-2120.219] (-2120.010) (-2119.423) -- 0:01:01 Average standard deviation of split frequencies: 0.026361 75500 -- (-2119.416) [-2123.163] (-2125.631) (-2122.387) * [-2130.344] (-2119.747) (-2119.987) (-2119.433) -- 0:01:01 76000 -- (-2119.187) (-2122.711) (-2125.819) [-2123.308] * (-2136.173) (-2121.635) [-2119.687] (-2119.921) -- 0:01:00 76500 -- (-2119.474) (-2122.567) [-2120.853] (-2121.587) * (-2132.483) (-2124.001) (-2120.936) [-2120.175] -- 0:01:00 77000 -- [-2120.471] (-2123.669) (-2121.553) (-2122.637) * (-2133.374) (-2123.114) (-2120.704) [-2123.670] -- 0:00:59 77500 -- (-2122.173) (-2122.148) [-2121.564] (-2123.887) * (-2132.305) (-2124.529) (-2119.961) [-2119.650] -- 0:00:59 78000 -- (-2120.414) (-2124.857) [-2121.100] (-2123.352) * (-2133.274) (-2124.346) (-2123.423) [-2119.524] -- 0:00:59 78500 -- [-2123.413] (-2124.168) (-2120.660) (-2121.704) * [-2124.809] (-2131.010) (-2122.196) (-2123.949) -- 0:01:10 79000 -- (-2120.290) [-2122.169] (-2122.271) (-2119.873) * (-2129.193) [-2124.238] (-2121.782) (-2122.562) -- 0:01:09 79500 -- (-2120.529) (-2120.235) [-2120.627] (-2119.848) * (-2127.878) (-2121.914) [-2121.784] (-2119.825) -- 0:01:09 80000 -- (-2121.184) (-2123.114) (-2120.003) [-2120.171] * (-2129.919) (-2121.339) (-2121.230) [-2119.032] -- 0:01:09 Average standard deviation of split frequencies: 0.025323 80500 -- (-2121.332) (-2120.668) [-2119.968] (-2120.077) * [-2134.575] (-2119.755) (-2120.235) (-2118.787) -- 0:01:08 81000 -- (-2121.904) [-2120.429] (-2120.135) (-2120.068) * (-2131.776) [-2120.294] (-2119.347) (-2119.745) -- 0:01:08 81500 -- (-2121.531) (-2121.475) [-2123.157] (-2119.246) * (-2130.924) (-2121.473) (-2119.905) [-2123.707] -- 0:01:07 82000 -- [-2121.884] (-2120.788) (-2118.743) (-2122.734) * (-2138.263) [-2123.458] (-2119.258) (-2118.924) -- 0:01:07 82500 -- (-2121.244) [-2120.930] (-2119.863) (-2121.442) * (-2132.618) (-2122.848) (-2119.706) [-2118.922] -- 0:01:06 83000 -- (-2122.136) (-2126.415) (-2122.940) [-2121.522] * (-2135.972) (-2120.970) (-2120.750) [-2119.020] -- 0:01:06 83500 -- (-2122.218) (-2124.122) (-2129.935) [-2123.947] * [-2134.737] (-2123.666) (-2119.860) (-2121.136) -- 0:01:05 84000 -- [-2121.091] (-2122.999) (-2124.338) (-2123.470) * (-2128.284) (-2125.682) (-2119.736) [-2120.330] -- 0:01:05 84500 -- (-2121.173) [-2120.039] (-2123.093) (-2121.911) * (-2128.244) [-2121.128] (-2122.317) (-2119.022) -- 0:01:05 85000 -- (-2120.647) [-2120.658] (-2123.391) (-2120.768) * (-2129.905) [-2120.737] (-2121.126) (-2118.947) -- 0:01:04 Average standard deviation of split frequencies: 0.023022 85500 -- [-2120.677] (-2120.721) (-2121.196) (-2120.578) * (-2141.948) [-2120.873] (-2119.638) (-2118.923) -- 0:01:04 86000 -- [-2119.870] (-2120.519) (-2121.235) (-2120.254) * (-2137.500) (-2125.202) [-2121.245] (-2120.320) -- 0:01:03 86500 -- (-2121.692) [-2120.338] (-2119.877) (-2120.015) * (-2133.668) (-2122.634) [-2122.533] (-2120.492) -- 0:01:03 87000 -- (-2120.438) (-2123.769) (-2121.303) [-2119.896] * (-2131.024) [-2122.757] (-2125.091) (-2119.372) -- 0:01:02 87500 -- (-2120.263) (-2124.754) [-2120.900] (-2122.423) * (-2128.927) (-2122.755) (-2124.840) [-2119.393] -- 0:01:02 88000 -- (-2121.574) (-2120.123) [-2119.398] (-2121.958) * (-2130.408) (-2124.520) [-2121.758] (-2119.408) -- 0:01:02 88500 -- (-2119.694) [-2120.529] (-2121.311) (-2122.197) * (-2132.384) (-2120.987) [-2120.009] (-2122.024) -- 0:01:01 89000 -- (-2120.061) [-2119.852] (-2120.031) (-2120.604) * [-2125.754] (-2120.230) (-2120.200) (-2121.419) -- 0:01:01 89500 -- [-2120.105] (-2119.849) (-2120.403) (-2121.488) * (-2139.512) [-2122.220] (-2120.103) (-2119.468) -- 0:01:01 90000 -- (-2122.150) (-2120.128) [-2118.837] (-2122.842) * (-2134.374) (-2123.465) [-2119.913] (-2119.105) -- 0:01:00 Average standard deviation of split frequencies: 0.022215 90500 -- (-2120.534) [-2120.294] (-2118.837) (-2126.695) * (-2128.712) (-2122.651) (-2119.594) [-2119.730] -- 0:01:00 91000 -- [-2121.971] (-2119.915) (-2119.946) (-2126.837) * (-2128.337) (-2124.199) (-2120.737) [-2121.209] -- 0:00:59 91500 -- (-2123.217) (-2120.523) (-2119.031) [-2123.923] * (-2128.379) (-2121.981) (-2120.403) [-2120.483] -- 0:00:59 92000 -- (-2123.734) (-2120.448) (-2118.960) [-2124.723] * (-2128.414) (-2120.686) (-2120.150) [-2119.658] -- 0:00:59 92500 -- (-2125.277) (-2120.450) [-2120.357] (-2120.429) * (-2124.598) [-2121.255] (-2120.191) (-2122.075) -- 0:00:58 93000 -- (-2121.908) (-2120.298) (-2119.343) [-2119.523] * [-2122.096] (-2120.858) (-2120.005) (-2122.398) -- 0:00:58 93500 -- (-2120.735) (-2119.965) (-2119.634) [-2119.337] * [-2122.065] (-2120.858) (-2120.293) (-2124.629) -- 0:01:07 94000 -- (-2120.203) [-2120.834] (-2119.634) (-2119.337) * (-2121.991) [-2123.134] (-2121.689) (-2123.761) -- 0:01:07 94500 -- [-2120.198] (-2120.490) (-2119.182) (-2119.394) * (-2121.173) [-2122.390] (-2119.905) (-2121.783) -- 0:01:07 95000 -- [-2122.514] (-2120.131) (-2120.114) (-2120.596) * (-2123.571) [-2121.156] (-2120.404) (-2121.883) -- 0:01:06 Average standard deviation of split frequencies: 0.019887 95500 -- [-2121.965] (-2120.844) (-2121.484) (-2119.003) * (-2121.267) (-2122.661) [-2122.499] (-2121.854) -- 0:01:06 96000 -- (-2126.180) (-2120.843) [-2119.571] (-2119.003) * (-2121.835) (-2122.015) (-2120.997) [-2122.477] -- 0:01:05 96500 -- (-2126.673) (-2120.261) [-2120.275] (-2119.003) * (-2122.950) [-2124.569] (-2120.315) (-2122.578) -- 0:01:05 97000 -- (-2125.940) [-2120.526] (-2119.282) (-2118.978) * [-2123.388] (-2122.676) (-2120.857) (-2121.259) -- 0:01:05 97500 -- (-2126.043) (-2119.409) (-2121.015) [-2119.501] * (-2121.047) (-2122.562) [-2121.273] (-2119.482) -- 0:01:04 98000 -- (-2121.544) (-2119.148) [-2120.620] (-2119.093) * (-2122.416) (-2122.163) (-2120.859) [-2122.075] -- 0:01:04 98500 -- (-2121.259) (-2121.147) (-2119.912) [-2119.057] * (-2127.898) [-2121.461] (-2120.701) (-2120.105) -- 0:01:04 99000 -- [-2121.962] (-2119.637) (-2119.415) (-2119.061) * (-2125.083) (-2121.420) [-2120.846] (-2122.425) -- 0:01:03 99500 -- (-2121.168) (-2119.899) [-2121.677] (-2120.425) * (-2125.246) (-2123.134) [-2120.253] (-2120.957) -- 0:01:03 100000 -- [-2120.558] (-2120.465) (-2120.813) (-2122.049) * (-2120.319) (-2122.220) [-2122.267] (-2120.819) -- 0:01:02 Average standard deviation of split frequencies: 0.017326 100500 -- (-2119.369) (-2123.232) [-2123.095] (-2119.920) * (-2122.457) [-2120.557] (-2119.637) (-2119.899) -- 0:01:02 101000 -- (-2119.653) (-2121.959) (-2121.328) [-2119.874] * (-2119.529) [-2121.514] (-2120.631) (-2119.850) -- 0:01:02 101500 -- (-2119.704) [-2123.662] (-2119.510) (-2121.076) * (-2119.204) (-2124.185) (-2121.014) [-2119.779] -- 0:01:01 102000 -- [-2120.144] (-2121.311) (-2119.274) (-2121.058) * (-2119.158) (-2121.999) (-2120.668) [-2120.156] -- 0:01:01 102500 -- (-2120.099) (-2121.751) (-2119.338) [-2119.168] * (-2120.666) (-2123.457) (-2120.537) [-2119.313] -- 0:01:01 103000 -- (-2119.067) (-2123.155) [-2120.661] (-2120.460) * (-2119.733) (-2123.684) (-2120.271) [-2119.500] -- 0:01:00 103500 -- (-2119.140) (-2122.953) (-2120.981) [-2119.877] * [-2122.730] (-2125.066) (-2120.218) (-2122.567) -- 0:01:00 104000 -- (-2119.140) (-2121.034) (-2120.989) [-2122.486] * [-2122.029] (-2124.908) (-2125.633) (-2123.416) -- 0:01:00 104500 -- (-2119.406) [-2122.962] (-2118.893) (-2122.017) * (-2123.848) (-2121.885) [-2124.193] (-2122.977) -- 0:00:59 105000 -- [-2119.312] (-2120.461) (-2121.604) (-2120.565) * (-2123.668) (-2121.801) (-2123.967) [-2121.393] -- 0:00:59 Average standard deviation of split frequencies: 0.019123 105500 -- [-2119.186] (-2119.558) (-2120.808) (-2119.681) * [-2121.842] (-2121.506) (-2122.837) (-2122.368) -- 0:00:59 106000 -- (-2118.748) (-2120.974) (-2120.757) [-2120.138] * [-2121.898] (-2120.407) (-2121.650) (-2122.519) -- 0:00:59 106500 -- (-2119.928) (-2119.075) [-2121.173] (-2119.359) * [-2118.983] (-2120.426) (-2121.145) (-2121.313) -- 0:00:58 107000 -- (-2123.528) (-2119.075) (-2121.074) [-2119.939] * (-2120.651) [-2120.492] (-2121.025) (-2120.940) -- 0:00:58 107500 -- (-2123.532) (-2120.808) [-2119.931] (-2119.705) * (-2120.754) [-2120.422] (-2120.743) (-2121.553) -- 0:00:58 108000 -- (-2125.383) (-2121.970) [-2125.685] (-2119.260) * (-2121.261) [-2123.604] (-2121.397) (-2121.148) -- 0:01:06 108500 -- (-2124.143) (-2123.044) [-2121.657] (-2121.284) * (-2122.617) [-2120.268] (-2121.713) (-2123.279) -- 0:01:05 109000 -- (-2119.746) (-2119.942) [-2122.386] (-2122.773) * (-2119.983) [-2121.333] (-2121.526) (-2124.251) -- 0:01:05 109500 -- [-2119.204] (-2122.464) (-2123.219) (-2122.966) * (-2120.120) (-2124.583) [-2121.995] (-2119.401) -- 0:01:05 110000 -- (-2119.146) [-2119.549] (-2123.163) (-2119.707) * (-2120.124) (-2122.373) [-2121.181] (-2119.104) -- 0:01:04 Average standard deviation of split frequencies: 0.019505 110500 -- (-2119.147) (-2121.629) [-2121.488] (-2121.455) * [-2119.750] (-2124.786) (-2121.466) (-2121.683) -- 0:01:04 111000 -- (-2119.031) [-2121.044] (-2122.737) (-2122.760) * (-2120.047) (-2121.473) (-2122.624) [-2119.825] -- 0:01:04 111500 -- (-2121.043) [-2122.122] (-2124.082) (-2120.351) * (-2120.006) (-2120.313) (-2122.397) [-2121.087] -- 0:01:03 112000 -- (-2120.243) (-2124.382) (-2122.224) [-2123.736] * [-2120.045] (-2120.750) (-2125.325) (-2121.599) -- 0:01:03 112500 -- (-2120.243) [-2121.430] (-2121.605) (-2119.741) * (-2119.727) (-2120.132) (-2122.089) [-2121.333] -- 0:01:03 113000 -- (-2123.595) [-2122.773] (-2122.221) (-2119.677) * [-2120.945] (-2122.941) (-2121.136) (-2121.391) -- 0:01:02 113500 -- (-2121.391) [-2123.436] (-2122.163) (-2123.443) * [-2124.209] (-2121.498) (-2120.553) (-2121.283) -- 0:01:02 114000 -- [-2120.465] (-2126.620) (-2121.590) (-2121.920) * (-2122.249) (-2121.460) [-2120.138] (-2120.912) -- 0:01:02 114500 -- [-2120.904] (-2126.290) (-2124.456) (-2122.335) * [-2123.754] (-2126.662) (-2120.737) (-2122.345) -- 0:01:01 115000 -- (-2120.542) (-2125.973) (-2124.287) [-2119.191] * (-2122.664) (-2124.571) [-2119.463] (-2122.760) -- 0:01:01 Average standard deviation of split frequencies: 0.019303 115500 -- [-2120.443] (-2123.084) (-2126.475) (-2118.929) * (-2120.647) [-2124.168] (-2122.422) (-2122.461) -- 0:01:01 116000 -- (-2120.443) (-2122.953) (-2121.574) [-2120.597] * (-2120.187) (-2120.178) (-2122.632) [-2121.724] -- 0:01:00 116500 -- [-2122.031] (-2124.839) (-2120.768) (-2119.423) * [-2120.613] (-2122.568) (-2121.344) (-2121.178) -- 0:01:00 117000 -- [-2119.864] (-2120.952) (-2119.922) (-2119.204) * (-2125.833) (-2122.440) (-2121.052) [-2119.602] -- 0:01:00 117500 -- [-2122.072] (-2122.499) (-2121.282) (-2119.748) * (-2120.845) (-2120.535) [-2121.820] (-2120.090) -- 0:01:00 118000 -- (-2119.808) (-2121.771) (-2119.545) [-2120.886] * (-2119.419) [-2122.215] (-2121.841) (-2120.838) -- 0:00:59 118500 -- [-2125.268] (-2120.971) (-2120.821) (-2121.921) * [-2121.631] (-2126.268) (-2123.867) (-2120.882) -- 0:00:59 119000 -- (-2121.560) [-2119.429] (-2120.821) (-2121.972) * (-2121.198) [-2122.587] (-2121.513) (-2120.749) -- 0:00:59 119500 -- (-2121.508) [-2120.854] (-2119.850) (-2121.339) * [-2121.145] (-2121.446) (-2121.609) (-2120.569) -- 0:00:58 120000 -- (-2121.542) [-2120.346] (-2119.859) (-2122.823) * (-2119.789) (-2119.301) (-2121.385) [-2120.458] -- 0:00:58 Average standard deviation of split frequencies: 0.021795 120500 -- (-2121.686) [-2121.955] (-2120.133) (-2123.004) * (-2120.708) (-2120.669) [-2120.493] (-2121.057) -- 0:00:58 121000 -- (-2121.796) [-2121.882] (-2119.974) (-2121.996) * [-2120.311] (-2120.463) (-2120.676) (-2120.240) -- 0:00:58 121500 -- (-2122.647) (-2121.426) [-2119.718] (-2122.007) * (-2122.848) [-2125.842] (-2119.852) (-2121.850) -- 0:00:57 122000 -- (-2126.624) (-2121.151) [-2118.878] (-2121.821) * [-2122.575] (-2119.851) (-2119.076) (-2121.957) -- 0:00:57 122500 -- (-2121.057) (-2122.887) (-2119.395) [-2125.130] * (-2121.692) (-2119.288) (-2119.166) [-2120.352] -- 0:00:57 123000 -- (-2123.552) [-2121.297] (-2119.568) (-2123.028) * (-2120.488) [-2125.115] (-2120.576) (-2120.760) -- 0:00:57 123500 -- [-2123.487] (-2121.685) (-2120.391) (-2125.977) * (-2120.246) (-2123.420) [-2121.549] (-2121.668) -- 0:01:03 124000 -- (-2119.715) (-2123.194) [-2119.497] (-2121.770) * (-2120.365) (-2122.851) (-2121.808) [-2120.383] -- 0:01:03 124500 -- (-2119.513) (-2120.703) (-2120.513) [-2120.100] * [-2121.690] (-2121.787) (-2121.207) (-2120.122) -- 0:01:03 125000 -- [-2118.957] (-2120.695) (-2120.781) (-2121.508) * (-2122.165) (-2121.374) (-2120.877) [-2120.428] -- 0:01:03 Average standard deviation of split frequencies: 0.022054 125500 -- (-2119.007) [-2120.708] (-2119.352) (-2121.342) * [-2122.391] (-2122.288) (-2121.168) (-2120.672) -- 0:01:02 126000 -- [-2119.230] (-2120.703) (-2119.055) (-2120.606) * (-2119.795) (-2121.528) (-2121.236) [-2120.260] -- 0:01:02 126500 -- (-2119.189) (-2121.054) [-2120.196] (-2119.695) * (-2119.014) (-2121.255) [-2121.533] (-2121.980) -- 0:01:02 127000 -- (-2120.649) (-2121.154) (-2120.219) [-2119.120] * [-2121.923] (-2121.921) (-2120.951) (-2120.554) -- 0:01:01 127500 -- (-2121.301) [-2124.904] (-2120.249) (-2118.859) * [-2121.797] (-2121.852) (-2121.334) (-2121.152) -- 0:01:01 128000 -- (-2120.696) [-2123.291] (-2124.332) (-2119.078) * (-2127.572) (-2120.938) [-2121.030] (-2120.359) -- 0:01:01 128500 -- (-2118.967) (-2122.271) [-2121.326] (-2120.840) * (-2125.461) (-2121.505) [-2120.797] (-2119.599) -- 0:01:01 129000 -- (-2119.374) (-2122.154) (-2123.872) [-2120.519] * (-2128.686) [-2121.710] (-2120.951) (-2119.999) -- 0:01:00 129500 -- (-2120.377) (-2124.266) [-2120.660] (-2122.134) * (-2121.669) [-2121.526] (-2121.663) (-2121.891) -- 0:01:00 130000 -- (-2122.278) (-2122.518) [-2120.420] (-2122.291) * [-2120.822] (-2119.382) (-2121.901) (-2120.946) -- 0:01:00 Average standard deviation of split frequencies: 0.022026 130500 -- [-2120.129] (-2122.518) (-2122.853) (-2120.576) * (-2121.114) [-2120.638] (-2118.855) (-2124.152) -- 0:00:59 131000 -- [-2119.810] (-2119.539) (-2120.741) (-2120.637) * (-2122.920) (-2120.492) (-2118.811) [-2122.956] -- 0:00:59 131500 -- (-2125.199) (-2119.696) (-2120.632) [-2120.365] * (-2122.294) (-2119.927) [-2119.533] (-2121.224) -- 0:00:59 132000 -- [-2120.160] (-2119.585) (-2120.832) (-2121.541) * (-2126.749) (-2119.962) (-2120.903) [-2119.766] -- 0:00:59 132500 -- (-2120.234) [-2119.421] (-2121.003) (-2119.819) * (-2121.894) (-2120.506) (-2123.243) [-2119.977] -- 0:00:58 133000 -- (-2121.735) [-2121.515] (-2120.815) (-2122.243) * (-2122.070) (-2122.481) [-2121.716] (-2119.521) -- 0:00:58 133500 -- (-2122.314) (-2121.159) (-2121.040) [-2120.464] * [-2121.710] (-2121.557) (-2120.109) (-2119.918) -- 0:00:58 134000 -- (-2125.183) (-2122.917) [-2120.579] (-2119.932) * (-2120.634) (-2119.813) (-2121.232) [-2119.994] -- 0:00:58 134500 -- (-2122.240) (-2125.434) [-2120.198] (-2119.673) * (-2124.662) [-2119.819] (-2121.940) (-2122.037) -- 0:00:57 135000 -- (-2121.859) (-2121.875) [-2120.103] (-2119.124) * (-2125.648) (-2120.853) [-2123.466] (-2121.481) -- 0:00:57 Average standard deviation of split frequencies: 0.023169 135500 -- (-2119.273) (-2120.165) (-2123.631) [-2119.860] * (-2121.059) [-2119.126] (-2125.723) (-2119.556) -- 0:00:57 136000 -- (-2121.224) (-2121.083) (-2122.614) [-2119.382] * (-2122.699) (-2119.032) [-2122.112] (-2119.055) -- 0:00:57 136500 -- (-2121.196) (-2120.774) [-2124.801] (-2120.345) * (-2123.009) [-2119.281] (-2125.339) (-2119.055) -- 0:00:56 137000 -- (-2122.279) (-2121.285) [-2121.654] (-2121.148) * (-2123.009) [-2119.345] (-2123.956) (-2119.700) -- 0:00:56 137500 -- [-2120.202] (-2122.976) (-2122.235) (-2122.589) * (-2126.753) (-2120.661) (-2123.599) [-2119.922] -- 0:00:56 138000 -- [-2121.415] (-2124.340) (-2122.159) (-2123.169) * (-2125.243) [-2122.011] (-2124.831) (-2120.327) -- 0:00:56 138500 -- [-2120.733] (-2121.517) (-2122.208) (-2127.417) * (-2125.195) (-2119.578) [-2124.135] (-2118.931) -- 0:01:02 139000 -- [-2120.004] (-2123.198) (-2123.863) (-2130.500) * (-2127.777) (-2119.491) [-2123.368] (-2123.007) -- 0:01:01 139500 -- [-2120.354] (-2122.675) (-2121.399) (-2126.064) * (-2121.792) [-2119.042] (-2122.988) (-2121.213) -- 0:01:01 140000 -- (-2120.501) (-2123.604) [-2121.800] (-2125.949) * (-2121.350) [-2118.965] (-2123.617) (-2121.947) -- 0:01:01 Average standard deviation of split frequencies: 0.023811 140500 -- (-2120.051) (-2128.450) [-2121.059] (-2125.750) * (-2122.458) (-2121.371) (-2119.080) [-2123.435] -- 0:01:01 141000 -- (-2121.487) (-2126.062) (-2120.799) [-2123.010] * (-2120.622) [-2121.269] (-2120.529) (-2119.521) -- 0:01:00 141500 -- (-2123.481) (-2122.887) [-2120.970] (-2122.117) * (-2120.896) [-2120.221] (-2121.109) (-2120.516) -- 0:01:00 142000 -- (-2120.785) (-2123.138) (-2121.603) [-2127.965] * (-2121.497) [-2122.123] (-2119.426) (-2122.161) -- 0:01:00 142500 -- (-2122.100) [-2120.213] (-2121.805) (-2121.427) * (-2121.115) (-2122.714) (-2125.836) [-2120.150] -- 0:01:00 143000 -- [-2120.346] (-2121.373) (-2123.734) (-2122.351) * (-2120.164) (-2119.889) [-2125.362] (-2121.999) -- 0:00:59 143500 -- (-2121.873) (-2120.540) [-2123.486] (-2122.006) * (-2121.200) (-2121.410) (-2124.674) [-2120.664] -- 0:00:59 144000 -- [-2119.081] (-2120.206) (-2120.399) (-2119.144) * [-2123.101] (-2121.458) (-2121.396) (-2122.480) -- 0:00:59 144500 -- (-2122.316) [-2120.172] (-2124.108) (-2122.786) * [-2120.060] (-2120.298) (-2123.657) (-2120.930) -- 0:00:59 145000 -- (-2119.226) (-2120.253) (-2120.289) [-2120.946] * (-2119.709) (-2119.797) (-2121.543) [-2120.852] -- 0:00:58 Average standard deviation of split frequencies: 0.023961 145500 -- [-2121.968] (-2119.348) (-2123.697) (-2123.767) * (-2119.379) (-2121.166) [-2120.933] (-2119.490) -- 0:00:58 146000 -- (-2122.174) (-2119.998) [-2122.214] (-2121.670) * (-2126.897) (-2125.365) [-2121.452] (-2119.307) -- 0:00:58 146500 -- (-2121.223) (-2121.724) [-2119.927] (-2121.856) * (-2123.350) (-2123.588) [-2119.553] (-2120.219) -- 0:00:58 147000 -- [-2120.832] (-2123.222) (-2120.354) (-2124.627) * (-2126.749) (-2121.801) [-2120.898] (-2118.980) -- 0:00:58 147500 -- [-2120.511] (-2121.166) (-2120.223) (-2125.252) * (-2125.659) [-2120.936] (-2120.302) (-2119.706) -- 0:00:57 148000 -- (-2120.366) [-2119.107] (-2120.087) (-2122.613) * (-2122.281) (-2120.357) (-2120.334) [-2119.306] -- 0:00:57 148500 -- [-2119.874] (-2120.119) (-2119.369) (-2123.026) * (-2122.301) (-2120.779) (-2121.170) [-2119.306] -- 0:00:57 149000 -- (-2120.634) (-2119.961) (-2119.628) [-2128.822] * (-2120.069) [-2120.471] (-2123.081) (-2119.792) -- 0:00:57 149500 -- (-2120.769) (-2119.961) [-2119.631] (-2120.440) * [-2121.309] (-2126.269) (-2119.887) (-2119.972) -- 0:00:56 150000 -- (-2121.574) [-2119.145] (-2119.000) (-2121.532) * (-2123.399) (-2124.757) (-2119.971) [-2120.860] -- 0:00:56 Average standard deviation of split frequencies: 0.024536 150500 -- (-2122.939) [-2119.835] (-2119.370) (-2119.836) * [-2122.694] (-2125.263) (-2126.001) (-2120.902) -- 0:00:56 151000 -- (-2119.672) (-2121.053) (-2119.259) [-2120.163] * (-2121.083) [-2120.343] (-2120.584) (-2119.904) -- 0:00:56 151500 -- (-2120.251) (-2120.642) [-2121.214] (-2120.355) * (-2121.198) (-2120.142) [-2119.434] (-2123.335) -- 0:00:56 152000 -- (-2119.523) (-2119.042) [-2121.606] (-2120.679) * (-2122.831) (-2120.806) (-2119.615) [-2121.260] -- 0:00:55 152500 -- [-2120.580] (-2119.386) (-2120.561) (-2120.394) * [-2119.617] (-2119.224) (-2122.811) (-2119.692) -- 0:00:55 153000 -- (-2120.198) [-2121.871] (-2124.032) (-2120.170) * (-2119.476) [-2119.323] (-2122.935) (-2121.690) -- 0:00:55 153500 -- (-2120.735) (-2122.896) (-2124.888) [-2119.992] * (-2122.825) (-2119.070) [-2120.913] (-2120.353) -- 0:01:00 154000 -- (-2120.784) (-2124.157) [-2123.595] (-2118.913) * (-2122.601) [-2118.975] (-2120.436) (-2119.124) -- 0:01:00 154500 -- [-2120.320] (-2122.349) (-2121.930) (-2119.425) * [-2121.184] (-2119.346) (-2121.996) (-2120.753) -- 0:01:00 155000 -- (-2120.467) [-2121.997] (-2121.311) (-2119.986) * (-2120.440) [-2119.562] (-2121.401) (-2120.015) -- 0:00:59 Average standard deviation of split frequencies: 0.023220 155500 -- (-2120.741) (-2123.967) [-2121.330] (-2119.522) * (-2123.173) [-2120.544] (-2120.309) (-2122.127) -- 0:00:59 156000 -- [-2122.104] (-2123.321) (-2124.681) (-2119.523) * [-2120.503] (-2120.784) (-2121.780) (-2122.453) -- 0:00:59 156500 -- (-2120.634) (-2121.983) (-2126.506) [-2119.125] * (-2124.388) [-2121.220] (-2120.998) (-2120.440) -- 0:00:59 157000 -- (-2120.553) [-2122.696] (-2125.577) (-2119.319) * (-2128.636) [-2120.309] (-2120.018) (-2119.974) -- 0:00:59 157500 -- [-2119.921] (-2123.096) (-2120.811) (-2120.379) * (-2124.644) (-2122.901) [-2119.849] (-2121.354) -- 0:00:58 158000 -- (-2121.965) (-2124.066) (-2121.448) [-2120.906] * (-2125.838) (-2125.268) [-2119.064] (-2122.798) -- 0:00:58 158500 -- (-2122.621) (-2124.333) (-2119.553) [-2120.066] * (-2123.742) (-2119.637) (-2119.891) [-2121.963] -- 0:00:58 159000 -- (-2120.570) (-2125.320) (-2120.308) [-2120.148] * (-2122.360) (-2120.374) (-2119.292) [-2120.421] -- 0:00:58 159500 -- (-2119.527) [-2121.496] (-2120.366) (-2121.057) * (-2123.320) [-2121.047] (-2119.319) (-2120.459) -- 0:00:57 160000 -- (-2119.150) (-2126.303) (-2120.515) [-2119.931] * (-2122.377) (-2121.914) (-2119.720) [-2122.027] -- 0:00:57 Average standard deviation of split frequencies: 0.021928 160500 -- (-2119.794) (-2124.287) (-2120.473) [-2119.371] * (-2120.394) (-2121.568) [-2120.488] (-2119.428) -- 0:00:57 161000 -- (-2118.824) (-2125.018) (-2121.103) [-2119.636] * (-2121.836) [-2119.045] (-2120.599) (-2120.333) -- 0:00:57 161500 -- [-2119.765] (-2121.337) (-2122.103) (-2119.702) * (-2120.685) (-2119.757) [-2124.924] (-2121.853) -- 0:00:57 162000 -- (-2120.977) (-2121.153) (-2123.876) [-2119.835] * [-2121.458] (-2119.352) (-2128.302) (-2120.100) -- 0:00:56 162500 -- [-2120.652] (-2122.537) (-2124.174) (-2124.945) * [-2122.171] (-2119.455) (-2136.514) (-2121.847) -- 0:00:56 163000 -- (-2120.781) (-2122.185) [-2121.794] (-2123.233) * (-2120.836) (-2123.743) (-2124.570) [-2120.831] -- 0:00:56 163500 -- [-2120.443] (-2121.826) (-2121.436) (-2120.511) * (-2121.098) (-2121.055) (-2130.535) [-2119.198] -- 0:00:56 164000 -- (-2120.496) (-2123.548) [-2121.492] (-2120.085) * [-2125.687] (-2120.645) (-2130.176) (-2119.776) -- 0:00:56 164500 -- (-2120.330) (-2120.765) (-2120.072) [-2120.435] * (-2122.913) (-2120.035) (-2126.333) [-2120.308] -- 0:00:55 165000 -- [-2119.851] (-2121.861) (-2119.268) (-2120.394) * [-2124.251] (-2122.510) (-2120.180) (-2122.102) -- 0:00:55 Average standard deviation of split frequencies: 0.020925 165500 -- (-2119.721) (-2121.815) [-2119.618] (-2120.836) * (-2122.692) (-2122.091) (-2119.356) [-2123.490] -- 0:00:55 166000 -- (-2119.478) (-2123.836) [-2121.050] (-2120.678) * (-2119.206) [-2119.959] (-2119.669) (-2119.214) -- 0:00:55 166500 -- (-2120.803) (-2121.914) (-2121.150) [-2119.577] * (-2120.878) (-2120.797) [-2120.964] (-2119.287) -- 0:00:55 167000 -- (-2119.781) (-2123.301) (-2121.339) [-2123.623] * (-2120.655) [-2120.454] (-2120.125) (-2120.061) -- 0:00:54 167500 -- (-2118.965) (-2123.460) [-2121.714] (-2125.500) * (-2119.777) (-2123.322) (-2118.971) [-2120.038] -- 0:00:54 168000 -- (-2120.266) (-2120.668) [-2120.003] (-2125.624) * (-2119.559) (-2123.548) (-2121.638) [-2119.892] -- 0:00:54 168500 -- (-2120.947) [-2118.970] (-2122.997) (-2122.768) * (-2119.938) [-2120.705] (-2121.817) (-2120.203) -- 0:00:59 169000 -- (-2130.584) (-2118.838) [-2121.746] (-2125.640) * (-2121.900) (-2122.512) (-2119.124) [-2119.694] -- 0:00:59 169500 -- (-2119.150) (-2122.712) [-2119.776] (-2120.559) * [-2122.291] (-2123.241) (-2119.124) (-2119.620) -- 0:00:58 170000 -- (-2120.319) (-2123.307) [-2119.999] (-2122.105) * (-2122.649) [-2126.845] (-2122.341) (-2124.364) -- 0:00:58 Average standard deviation of split frequencies: 0.018608 170500 -- (-2121.301) [-2125.661] (-2129.165) (-2119.614) * [-2122.933] (-2121.117) (-2121.881) (-2120.158) -- 0:00:58 171000 -- (-2120.966) [-2119.529] (-2120.168) (-2119.474) * (-2122.548) (-2122.194) [-2119.249] (-2121.541) -- 0:00:58 171500 -- (-2121.908) (-2120.387) [-2120.275] (-2119.527) * (-2120.115) (-2122.391) (-2119.302) [-2119.207] -- 0:00:57 172000 -- (-2122.384) [-2121.341] (-2119.869) (-2120.480) * (-2121.348) (-2119.979) (-2119.351) [-2118.709] -- 0:00:57 172500 -- [-2120.391] (-2122.143) (-2120.167) (-2120.145) * (-2122.913) (-2120.579) (-2120.200) [-2118.706] -- 0:00:57 173000 -- (-2120.857) [-2120.838] (-2121.398) (-2121.111) * (-2127.616) (-2119.634) (-2119.695) [-2119.524] -- 0:00:57 173500 -- [-2125.691] (-2121.996) (-2124.959) (-2120.204) * (-2122.507) [-2120.198] (-2123.214) (-2119.784) -- 0:00:57 174000 -- (-2119.820) (-2120.949) (-2124.520) [-2119.824] * (-2121.581) (-2119.765) (-2120.399) [-2119.016] -- 0:00:56 174500 -- [-2121.095] (-2120.591) (-2124.155) (-2119.999) * (-2119.547) (-2119.757) (-2122.151) [-2119.274] -- 0:00:56 175000 -- (-2120.652) (-2118.968) (-2119.823) [-2120.422] * (-2120.449) (-2119.581) (-2126.824) [-2119.407] -- 0:00:56 Average standard deviation of split frequencies: 0.017544 175500 -- (-2120.766) (-2121.886) [-2123.167] (-2120.421) * [-2120.360] (-2119.472) (-2122.734) (-2119.503) -- 0:00:56 176000 -- [-2119.847] (-2121.785) (-2122.930) (-2120.420) * (-2119.757) (-2122.316) [-2126.925] (-2121.484) -- 0:00:56 176500 -- [-2121.884] (-2120.589) (-2132.953) (-2119.268) * (-2120.918) [-2127.212] (-2126.861) (-2120.106) -- 0:00:55 177000 -- (-2121.694) (-2120.171) (-2122.739) [-2120.591] * (-2123.546) [-2121.829] (-2126.396) (-2119.911) -- 0:00:55 177500 -- [-2120.812] (-2120.166) (-2122.881) (-2120.732) * (-2126.614) (-2120.716) (-2123.100) [-2119.401] -- 0:00:55 178000 -- (-2123.938) [-2119.421] (-2120.257) (-2120.967) * (-2124.856) [-2119.909] (-2121.262) (-2119.833) -- 0:00:55 178500 -- (-2119.814) (-2122.634) [-2121.223] (-2119.355) * (-2119.939) [-2119.044] (-2121.424) (-2120.463) -- 0:00:55 179000 -- (-2121.831) [-2120.840] (-2120.687) (-2120.970) * (-2125.972) [-2119.480] (-2123.916) (-2120.116) -- 0:00:55 179500 -- (-2120.255) (-2123.390) [-2120.810] (-2122.982) * (-2123.906) [-2122.164] (-2123.800) (-2120.135) -- 0:00:54 180000 -- (-2120.058) [-2123.753] (-2121.424) (-2120.898) * (-2124.151) (-2123.177) (-2119.139) [-2120.929] -- 0:00:54 Average standard deviation of split frequencies: 0.016525 180500 -- (-2121.342) (-2119.235) [-2122.066] (-2121.048) * (-2123.748) (-2121.546) (-2120.268) [-2119.803] -- 0:00:54 181000 -- (-2122.446) [-2120.040] (-2124.690) (-2122.415) * [-2121.524] (-2121.109) (-2120.006) (-2122.730) -- 0:00:54 181500 -- [-2119.019] (-2119.400) (-2122.541) (-2125.971) * (-2120.570) (-2121.522) (-2120.056) [-2119.290] -- 0:00:54 182000 -- (-2120.013) [-2120.014] (-2120.767) (-2121.661) * (-2120.531) [-2121.742] (-2124.438) (-2119.392) -- 0:00:53 182500 -- (-2121.208) (-2121.098) (-2120.819) [-2123.500] * (-2121.610) [-2119.318] (-2124.438) (-2119.639) -- 0:00:53 183000 -- (-2121.208) (-2121.095) [-2121.636] (-2120.666) * (-2120.225) (-2120.419) (-2124.252) [-2120.773] -- 0:00:58 183500 -- (-2121.207) (-2119.547) (-2121.043) [-2121.818] * (-2120.072) (-2120.157) (-2122.788) [-2121.504] -- 0:00:57 184000 -- (-2121.670) (-2119.931) (-2119.750) [-2124.624] * (-2120.019) (-2120.124) [-2120.921] (-2121.166) -- 0:00:57 184500 -- (-2125.677) (-2118.740) [-2119.376] (-2119.862) * (-2119.921) (-2120.124) (-2119.862) [-2122.043] -- 0:00:57 185000 -- (-2124.394) [-2122.707] (-2120.151) (-2120.531) * [-2119.960] (-2121.095) (-2120.217) (-2120.478) -- 0:00:57 Average standard deviation of split frequencies: 0.017074 185500 -- (-2119.291) (-2119.595) [-2122.648] (-2121.269) * [-2120.429] (-2120.415) (-2120.461) (-2122.593) -- 0:00:57 186000 -- (-2119.946) (-2120.997) [-2121.384] (-2120.988) * (-2120.808) [-2120.477] (-2119.770) (-2122.530) -- 0:00:56 186500 -- (-2119.936) (-2123.412) (-2125.372) [-2121.260] * (-2121.908) [-2119.750] (-2120.070) (-2121.445) -- 0:00:56 187000 -- (-2120.775) (-2118.730) (-2126.003) [-2121.806] * (-2120.893) (-2120.213) [-2122.203] (-2120.881) -- 0:00:56 187500 -- (-2123.100) [-2120.796] (-2126.911) (-2120.508) * (-2121.343) [-2121.738] (-2123.025) (-2120.239) -- 0:00:56 188000 -- (-2122.788) (-2123.915) (-2123.087) [-2120.429] * (-2120.705) [-2121.337] (-2120.694) (-2120.782) -- 0:00:56 188500 -- (-2119.436) (-2126.742) (-2126.105) [-2119.417] * (-2120.705) (-2119.926) [-2121.098] (-2119.423) -- 0:00:55 189000 -- [-2119.845] (-2124.365) (-2121.134) (-2119.057) * [-2119.748] (-2121.178) (-2121.593) (-2119.217) -- 0:00:55 189500 -- (-2119.845) (-2121.799) [-2121.298] (-2120.529) * (-2119.010) (-2122.384) [-2126.851] (-2120.418) -- 0:00:55 190000 -- (-2119.632) [-2121.530] (-2119.537) (-2119.578) * (-2119.705) [-2121.062] (-2126.694) (-2120.328) -- 0:00:55 Average standard deviation of split frequencies: 0.015453 190500 -- (-2120.553) (-2121.448) [-2124.075] (-2120.666) * (-2119.387) (-2121.945) (-2121.654) [-2120.330] -- 0:00:55 191000 -- (-2120.301) [-2120.843] (-2121.711) (-2120.666) * (-2120.443) (-2122.751) (-2121.382) [-2120.797] -- 0:00:55 191500 -- [-2120.217] (-2121.884) (-2121.317) (-2119.799) * (-2120.170) (-2123.577) (-2121.848) [-2119.682] -- 0:00:54 192000 -- (-2124.271) (-2118.842) (-2120.447) [-2119.553] * (-2121.342) (-2123.668) [-2121.012] (-2120.070) -- 0:00:54 192500 -- (-2122.809) (-2120.280) (-2121.750) [-2119.965] * (-2125.151) [-2123.406] (-2121.465) (-2121.874) -- 0:00:54 193000 -- [-2123.146] (-2119.271) (-2122.425) (-2120.063) * (-2124.945) (-2121.473) [-2121.884] (-2119.598) -- 0:00:54 193500 -- (-2122.666) (-2118.654) (-2122.613) [-2120.965] * (-2128.304) (-2122.178) [-2121.757] (-2119.588) -- 0:00:54 194000 -- (-2120.732) (-2120.278) (-2122.012) [-2124.269] * (-2121.928) (-2120.923) (-2120.274) [-2120.459] -- 0:00:54 194500 -- [-2121.696] (-2121.967) (-2119.509) (-2122.717) * (-2124.009) (-2121.831) [-2120.490] (-2121.862) -- 0:00:53 195000 -- (-2120.988) [-2121.794] (-2119.189) (-2121.321) * (-2122.008) [-2120.672] (-2121.149) (-2119.586) -- 0:00:53 Average standard deviation of split frequencies: 0.016475 195500 -- (-2119.719) (-2124.168) (-2119.706) [-2119.374] * [-2121.066] (-2120.813) (-2121.115) (-2121.240) -- 0:00:57 196000 -- (-2119.707) (-2124.016) (-2120.777) [-2119.395] * (-2119.959) [-2119.495] (-2120.368) (-2120.722) -- 0:00:57 196500 -- (-2121.520) [-2121.368] (-2120.799) (-2120.547) * [-2119.754] (-2119.958) (-2121.051) (-2127.565) -- 0:00:57 197000 -- [-2121.566] (-2121.707) (-2120.004) (-2124.843) * (-2121.152) (-2123.830) (-2122.687) [-2125.550] -- 0:00:57 197500 -- (-2119.878) (-2124.879) (-2119.746) [-2120.082] * [-2121.257] (-2123.552) (-2123.426) (-2122.512) -- 0:00:56 198000 -- (-2121.274) [-2120.064] (-2121.565) (-2120.290) * (-2121.222) [-2120.738] (-2122.761) (-2121.768) -- 0:00:56 198500 -- [-2120.625] (-2119.767) (-2124.649) (-2122.743) * [-2120.000] (-2121.184) (-2122.072) (-2122.596) -- 0:00:56 199000 -- (-2119.402) [-2121.543] (-2123.792) (-2124.170) * (-2121.356) (-2123.380) [-2121.735] (-2127.623) -- 0:00:56 199500 -- [-2119.346] (-2122.071) (-2120.799) (-2122.639) * (-2120.732) (-2121.416) [-2122.050] (-2126.911) -- 0:00:56 200000 -- (-2119.243) [-2119.993] (-2121.312) (-2123.282) * (-2119.904) [-2120.600] (-2119.854) (-2123.710) -- 0:00:55 Average standard deviation of split frequencies: 0.015270 200500 -- (-2121.999) [-2120.474] (-2121.537) (-2122.392) * (-2121.770) [-2124.800] (-2119.935) (-2123.394) -- 0:00:55 201000 -- (-2120.947) (-2125.541) [-2121.660] (-2120.707) * (-2120.247) (-2122.751) [-2120.466] (-2123.941) -- 0:00:55 201500 -- [-2121.314] (-2125.840) (-2121.619) (-2121.121) * (-2121.473) [-2121.339] (-2122.035) (-2129.325) -- 0:00:55 202000 -- (-2121.222) (-2122.228) [-2119.604] (-2121.757) * [-2119.346] (-2122.946) (-2120.194) (-2124.619) -- 0:00:55 202500 -- (-2120.268) (-2124.195) [-2123.469] (-2121.548) * [-2119.154] (-2119.534) (-2120.542) (-2121.827) -- 0:00:55 203000 -- [-2121.471] (-2121.819) (-2124.639) (-2121.825) * (-2119.147) (-2120.807) (-2126.236) [-2121.219] -- 0:00:54 203500 -- (-2125.372) (-2124.024) (-2124.186) [-2119.909] * (-2120.859) (-2120.448) (-2125.069) [-2120.470] -- 0:00:54 204000 -- [-2123.754] (-2120.420) (-2124.496) (-2120.595) * (-2119.592) [-2120.971] (-2129.047) (-2120.334) -- 0:00:54 204500 -- (-2123.706) (-2120.803) [-2119.847] (-2122.326) * (-2120.888) (-2120.351) (-2123.118) [-2121.559] -- 0:00:54 205000 -- (-2121.663) (-2121.398) (-2120.693) [-2120.633] * (-2121.933) (-2121.574) (-2120.623) [-2121.879] -- 0:00:54 Average standard deviation of split frequencies: 0.016019 205500 -- (-2122.898) [-2122.274] (-2122.249) (-2121.198) * (-2120.255) [-2122.094] (-2124.909) (-2121.427) -- 0:00:54 206000 -- [-2121.513] (-2126.106) (-2118.794) (-2119.836) * (-2121.279) [-2122.652] (-2125.503) (-2121.428) -- 0:00:53 206500 -- [-2121.270] (-2125.598) (-2119.863) (-2120.991) * [-2120.414] (-2123.505) (-2124.511) (-2124.112) -- 0:00:53 207000 -- (-2120.764) [-2123.417] (-2124.487) (-2123.660) * (-2121.941) [-2121.154] (-2123.606) (-2120.688) -- 0:00:53 207500 -- (-2127.140) (-2119.918) [-2121.666] (-2120.663) * (-2122.071) (-2121.600) [-2121.915] (-2120.066) -- 0:00:53 208000 -- (-2126.372) [-2120.899] (-2120.007) (-2120.973) * [-2122.651] (-2121.603) (-2121.684) (-2120.050) -- 0:00:53 208500 -- (-2118.982) (-2123.539) [-2119.958] (-2121.318) * (-2126.071) (-2123.562) [-2123.738] (-2120.678) -- 0:00:53 209000 -- (-2119.212) (-2123.089) (-2120.363) [-2119.915] * (-2122.879) (-2123.332) (-2121.891) [-2120.678] -- 0:00:52 209500 -- (-2121.078) (-2119.642) (-2120.767) [-2120.605] * (-2125.040) (-2122.917) [-2120.359] (-2119.721) -- 0:00:52 210000 -- (-2124.375) (-2120.180) (-2122.658) [-2121.450] * (-2125.343) (-2122.825) (-2123.128) [-2120.361] -- 0:00:52 Average standard deviation of split frequencies: 0.016335 210500 -- (-2121.405) (-2120.324) (-2121.728) [-2123.149] * (-2119.450) (-2122.487) [-2121.144] (-2120.361) -- 0:00:56 211000 -- (-2119.996) [-2119.476] (-2119.833) (-2122.139) * (-2120.044) (-2122.644) [-2120.708] (-2119.175) -- 0:00:56 211500 -- (-2120.420) (-2118.765) [-2124.882] (-2122.077) * (-2119.957) (-2122.742) [-2120.813] (-2119.208) -- 0:00:55 212000 -- (-2121.169) (-2119.439) [-2124.290] (-2121.163) * (-2121.309) (-2124.431) (-2121.347) [-2120.368] -- 0:00:55 212500 -- (-2121.411) (-2119.286) (-2120.739) [-2120.153] * (-2120.194) (-2121.604) (-2121.120) [-2123.352] -- 0:00:55 213000 -- (-2122.158) (-2118.757) [-2124.660] (-2120.157) * (-2120.063) (-2125.135) [-2121.540] (-2121.865) -- 0:00:55 213500 -- (-2122.920) (-2119.638) (-2122.074) [-2120.843] * (-2120.241) (-2121.976) (-2120.710) [-2121.137] -- 0:00:55 214000 -- (-2119.363) (-2119.698) [-2121.173] (-2119.510) * [-2119.838] (-2120.828) (-2122.564) (-2122.379) -- 0:00:55 214500 -- [-2120.470] (-2120.919) (-2121.728) (-2121.358) * (-2120.252) (-2120.530) (-2121.406) [-2121.698] -- 0:00:54 215000 -- (-2122.590) [-2122.595] (-2120.712) (-2120.021) * (-2119.517) [-2120.281] (-2120.482) (-2120.308) -- 0:00:54 Average standard deviation of split frequencies: 0.016805 215500 -- (-2121.871) (-2120.578) [-2120.625] (-2120.397) * (-2121.803) (-2120.022) (-2120.302) [-2121.075] -- 0:00:54 216000 -- (-2121.664) (-2119.914) [-2122.123] (-2119.772) * (-2119.984) (-2120.546) (-2120.514) [-2123.403] -- 0:00:54 216500 -- [-2124.410] (-2123.194) (-2120.115) (-2121.541) * [-2120.434] (-2122.543) (-2120.219) (-2124.127) -- 0:00:54 217000 -- (-2121.270) [-2123.849] (-2125.895) (-2122.859) * [-2121.719] (-2123.793) (-2120.115) (-2123.858) -- 0:00:54 217500 -- (-2121.936) (-2119.799) [-2120.468] (-2119.923) * (-2121.716) [-2122.437] (-2122.289) (-2124.572) -- 0:00:53 218000 -- (-2120.486) (-2121.362) [-2119.200] (-2120.940) * (-2122.690) (-2125.068) [-2121.066] (-2122.641) -- 0:00:53 218500 -- (-2120.883) [-2123.606] (-2119.117) (-2120.940) * [-2122.089] (-2120.402) (-2120.842) (-2121.226) -- 0:00:53 219000 -- (-2121.710) [-2122.700] (-2119.118) (-2121.230) * (-2122.245) (-2120.242) [-2120.366] (-2119.293) -- 0:00:53 219500 -- (-2120.765) (-2124.452) [-2121.552] (-2122.958) * (-2123.580) [-2122.676] (-2119.346) (-2119.183) -- 0:00:53 220000 -- (-2122.739) (-2121.493) [-2119.902] (-2122.221) * (-2122.193) [-2122.064] (-2118.940) (-2120.575) -- 0:00:53 Average standard deviation of split frequencies: 0.016342 220500 -- (-2121.006) (-2121.049) (-2119.079) [-2121.040] * (-2120.309) [-2124.056] (-2118.999) (-2119.260) -- 0:00:53 221000 -- (-2120.742) (-2120.984) (-2119.530) [-2120.086] * [-2119.257] (-2130.630) (-2118.992) (-2121.634) -- 0:00:52 221500 -- [-2122.153] (-2120.534) (-2124.074) (-2119.524) * [-2119.758] (-2126.278) (-2119.920) (-2121.805) -- 0:00:52 222000 -- (-2123.893) (-2121.006) [-2124.184] (-2121.281) * (-2118.841) [-2121.204] (-2121.857) (-2120.679) -- 0:00:52 222500 -- (-2120.684) (-2120.909) [-2124.181] (-2123.312) * [-2120.151] (-2121.128) (-2119.214) (-2120.640) -- 0:00:52 223000 -- (-2119.473) [-2121.376] (-2122.396) (-2125.399) * [-2120.795] (-2122.588) (-2119.426) (-2120.762) -- 0:00:52 223500 -- [-2119.388] (-2119.469) (-2121.158) (-2119.810) * (-2122.149) (-2121.148) [-2121.041] (-2121.572) -- 0:00:52 224000 -- (-2121.282) (-2125.391) (-2122.345) [-2120.835] * (-2123.175) (-2121.271) [-2120.409] (-2122.741) -- 0:00:51 224500 -- (-2124.695) (-2121.465) (-2120.865) [-2120.150] * (-2122.487) [-2119.399] (-2124.105) (-2124.066) -- 0:00:51 225000 -- (-2119.071) (-2119.668) (-2121.103) [-2120.874] * (-2120.437) (-2121.732) [-2122.400] (-2125.838) -- 0:00:51 Average standard deviation of split frequencies: 0.016687 225500 -- (-2119.329) [-2119.435] (-2122.112) (-2122.047) * (-2122.693) [-2120.056] (-2119.293) (-2121.119) -- 0:00:54 226000 -- (-2120.301) (-2120.601) [-2119.493] (-2119.407) * [-2122.539] (-2120.051) (-2119.771) (-2120.421) -- 0:00:54 226500 -- (-2120.300) (-2120.272) (-2120.288) [-2120.695] * (-2118.942) (-2122.275) (-2121.143) [-2119.560] -- 0:00:54 227000 -- [-2127.396] (-2122.323) (-2119.730) (-2120.950) * [-2118.804] (-2119.178) (-2122.510) (-2122.238) -- 0:00:54 227500 -- (-2122.426) (-2126.305) [-2124.229] (-2120.647) * (-2130.887) (-2121.086) (-2120.853) [-2122.886] -- 0:00:54 228000 -- [-2121.310] (-2122.121) (-2120.078) (-2122.452) * (-2123.662) (-2119.372) (-2120.383) [-2122.511] -- 0:00:54 228500 -- (-2121.089) (-2121.214) (-2121.304) [-2120.288] * (-2122.512) (-2119.389) (-2120.997) [-2122.427] -- 0:00:54 229000 -- (-2121.512) [-2121.474] (-2120.233) (-2120.345) * (-2123.111) (-2119.389) [-2120.181] (-2120.219) -- 0:00:53 229500 -- (-2120.096) (-2124.267) [-2123.787] (-2120.351) * (-2125.687) (-2121.324) [-2119.414] (-2122.607) -- 0:00:53 230000 -- (-2121.052) [-2120.794] (-2122.011) (-2120.161) * (-2123.229) [-2119.636] (-2123.633) (-2119.991) -- 0:00:53 Average standard deviation of split frequencies: 0.017269 230500 -- [-2120.301] (-2120.552) (-2120.945) (-2121.155) * (-2121.698) (-2122.247) (-2123.302) [-2120.489] -- 0:00:53 231000 -- (-2120.758) [-2120.303] (-2123.708) (-2120.598) * [-2123.597] (-2119.935) (-2124.197) (-2124.959) -- 0:00:53 231500 -- (-2121.193) [-2120.933] (-2121.303) (-2120.654) * [-2122.565] (-2121.068) (-2124.694) (-2125.816) -- 0:00:53 232000 -- (-2119.503) (-2119.728) (-2124.792) [-2120.858] * (-2122.082) (-2122.448) (-2120.543) [-2119.754] -- 0:00:52 232500 -- (-2119.939) (-2124.689) [-2122.806] (-2122.760) * (-2122.513) (-2123.354) [-2121.670] (-2120.254) -- 0:00:52 233000 -- (-2119.322) (-2120.214) [-2121.496] (-2124.238) * [-2125.995] (-2123.614) (-2121.659) (-2120.145) -- 0:00:52 233500 -- (-2122.072) (-2120.772) (-2120.783) [-2120.502] * (-2123.282) (-2124.140) (-2121.005) [-2120.465] -- 0:00:52 234000 -- (-2121.226) (-2120.750) (-2120.789) [-2121.889] * (-2124.084) (-2121.839) (-2120.457) [-2120.588] -- 0:00:52 234500 -- (-2121.458) (-2120.702) [-2121.699] (-2123.790) * (-2122.811) [-2121.595] (-2124.645) (-2120.356) -- 0:00:52 235000 -- (-2119.443) (-2120.918) [-2122.377] (-2122.127) * (-2122.176) [-2119.493] (-2123.428) (-2120.584) -- 0:00:52 Average standard deviation of split frequencies: 0.016979 235500 -- (-2120.142) [-2120.384] (-2121.178) (-2123.290) * (-2119.411) (-2120.596) (-2120.482) [-2122.518] -- 0:00:51 236000 -- (-2120.476) (-2122.857) [-2119.801] (-2120.158) * (-2123.566) (-2118.830) [-2120.597] (-2122.465) -- 0:00:51 236500 -- (-2122.097) (-2121.823) [-2121.103] (-2119.286) * (-2121.446) (-2119.078) [-2119.615] (-2121.958) -- 0:00:51 237000 -- [-2121.504] (-2122.785) (-2120.594) (-2121.163) * (-2121.186) (-2119.078) [-2119.179] (-2120.045) -- 0:00:51 237500 -- (-2121.435) [-2122.431] (-2120.880) (-2120.845) * [-2120.457] (-2121.792) (-2121.657) (-2124.432) -- 0:00:51 238000 -- [-2122.753] (-2122.383) (-2124.502) (-2120.245) * (-2124.832) (-2121.714) [-2123.777] (-2119.263) -- 0:00:51 238500 -- (-2121.496) [-2120.500] (-2125.777) (-2119.321) * (-2124.527) (-2119.049) [-2121.054] (-2119.616) -- 0:00:51 239000 -- [-2122.347] (-2119.628) (-2122.703) (-2119.207) * (-2122.546) [-2121.842] (-2123.113) (-2121.157) -- 0:00:50 239500 -- [-2122.228] (-2119.628) (-2123.055) (-2119.682) * [-2121.574] (-2121.868) (-2122.821) (-2124.918) -- 0:00:50 240000 -- (-2122.450) (-2119.759) (-2123.237) [-2119.731] * [-2120.152] (-2119.787) (-2120.258) (-2123.769) -- 0:00:50 Average standard deviation of split frequencies: 0.015082 240500 -- (-2123.166) [-2120.919] (-2120.878) (-2119.240) * (-2125.752) [-2119.032] (-2119.975) (-2123.976) -- 0:00:50 241000 -- (-2121.464) (-2121.443) [-2121.857] (-2119.574) * (-2120.612) (-2119.527) [-2120.524] (-2123.454) -- 0:00:53 241500 -- (-2120.760) (-2123.260) [-2120.289] (-2120.991) * (-2120.384) (-2123.239) [-2120.130] (-2122.143) -- 0:00:53 242000 -- (-2126.149) (-2124.293) (-2120.324) [-2119.942] * (-2120.249) (-2119.940) [-2122.973] (-2126.080) -- 0:00:53 242500 -- (-2124.323) (-2123.909) [-2120.153] (-2120.527) * (-2120.580) [-2119.751] (-2122.279) (-2124.399) -- 0:00:53 243000 -- [-2123.961] (-2122.374) (-2120.288) (-2120.771) * (-2122.094) (-2120.895) [-2118.888] (-2122.570) -- 0:00:52 243500 -- (-2126.253) [-2122.307] (-2119.228) (-2120.269) * (-2119.715) [-2126.835] (-2119.274) (-2120.800) -- 0:00:52 244000 -- [-2120.560] (-2121.325) (-2119.272) (-2122.609) * [-2119.451] (-2120.483) (-2121.198) (-2124.273) -- 0:00:52 244500 -- (-2119.971) (-2120.659) [-2119.917] (-2119.895) * (-2119.884) (-2120.360) [-2121.198] (-2121.078) -- 0:00:52 245000 -- (-2122.546) (-2124.375) (-2120.348) [-2120.226] * (-2121.303) (-2120.357) (-2122.175) [-2120.524] -- 0:00:52 Average standard deviation of split frequencies: 0.015043 245500 -- (-2121.333) (-2123.669) (-2119.872) [-2119.273] * (-2120.544) [-2122.271] (-2122.418) (-2119.776) -- 0:00:52 246000 -- [-2120.209] (-2120.493) (-2119.909) (-2121.514) * (-2120.831) (-2119.416) [-2121.869] (-2120.714) -- 0:00:52 246500 -- (-2120.295) [-2121.291] (-2121.893) (-2120.831) * (-2120.674) [-2119.538] (-2121.508) (-2121.537) -- 0:00:51 247000 -- (-2120.965) (-2120.517) [-2119.071] (-2120.597) * (-2120.680) (-2120.752) (-2124.061) [-2120.215] -- 0:00:51 247500 -- (-2119.845) (-2119.857) [-2119.078] (-2122.508) * (-2120.770) (-2120.545) (-2122.656) [-2123.369] -- 0:00:51 248000 -- [-2120.284] (-2119.823) (-2119.768) (-2121.246) * (-2120.427) [-2121.111] (-2119.117) (-2119.705) -- 0:00:51 248500 -- (-2119.610) [-2119.827] (-2121.986) (-2119.448) * (-2120.532) (-2120.251) [-2118.992] (-2119.829) -- 0:00:51 249000 -- (-2121.568) [-2120.736] (-2119.690) (-2121.608) * (-2121.094) (-2121.494) (-2120.007) [-2122.139] -- 0:00:51 249500 -- (-2120.923) (-2126.748) [-2119.908] (-2122.200) * (-2119.964) [-2120.190] (-2121.084) (-2122.599) -- 0:00:51 250000 -- [-2121.349] (-2120.265) (-2120.167) (-2124.831) * [-2120.276] (-2120.170) (-2124.231) (-2119.989) -- 0:00:51 Average standard deviation of split frequencies: 0.015936 250500 -- (-2120.376) [-2120.086] (-2120.334) (-2118.901) * [-2120.890] (-2122.353) (-2124.721) (-2120.001) -- 0:00:50 251000 -- (-2120.431) (-2121.006) [-2121.524] (-2119.209) * (-2121.014) [-2120.119] (-2123.546) (-2119.861) -- 0:00:50 251500 -- [-2121.370] (-2122.805) (-2122.435) (-2120.318) * (-2120.470) [-2120.136] (-2126.734) (-2123.057) -- 0:00:50 252000 -- (-2121.051) (-2124.964) (-2122.955) [-2120.129] * [-2120.142] (-2119.296) (-2121.299) (-2120.538) -- 0:00:50 252500 -- [-2120.802] (-2125.540) (-2119.195) (-2120.543) * [-2120.185] (-2119.641) (-2121.299) (-2124.140) -- 0:00:50 253000 -- (-2121.580) (-2122.629) (-2119.708) [-2120.244] * (-2121.253) (-2121.725) (-2122.042) [-2119.641] -- 0:00:50 253500 -- (-2120.309) (-2123.372) [-2120.154] (-2120.206) * (-2121.009) (-2121.416) (-2124.082) [-2120.141] -- 0:00:50 254000 -- [-2120.462] (-2122.784) (-2122.466) (-2120.115) * (-2121.294) (-2121.442) (-2123.017) [-2120.656] -- 0:00:49 254500 -- (-2122.830) [-2121.769] (-2122.584) (-2121.479) * [-2120.524] (-2124.440) (-2121.343) (-2119.118) -- 0:00:49 255000 -- [-2122.717] (-2122.621) (-2122.030) (-2121.496) * (-2123.085) [-2120.398] (-2121.607) (-2121.657) -- 0:00:49 Average standard deviation of split frequencies: 0.015376 255500 -- (-2121.811) (-2122.841) [-2120.770] (-2119.965) * (-2123.677) [-2120.481] (-2120.999) (-2122.254) -- 0:00:49 256000 -- (-2121.467) (-2122.010) (-2119.782) [-2119.083] * (-2124.144) (-2121.340) [-2119.499] (-2119.748) -- 0:00:52 256500 -- (-2122.575) (-2121.658) (-2124.103) [-2120.279] * (-2120.953) (-2120.631) (-2119.716) [-2119.698] -- 0:00:52 257000 -- (-2120.099) (-2120.538) [-2124.603] (-2120.957) * (-2122.189) (-2124.871) (-2119.569) [-2118.884] -- 0:00:52 257500 -- [-2119.795] (-2121.021) (-2119.807) (-2121.266) * (-2122.169) [-2124.937] (-2120.182) (-2119.992) -- 0:00:51 258000 -- [-2119.745] (-2123.646) (-2120.073) (-2122.878) * (-2119.969) [-2122.536] (-2121.700) (-2119.856) -- 0:00:51 258500 -- (-2120.595) (-2123.862) [-2118.624] (-2120.853) * [-2121.068] (-2129.776) (-2121.934) (-2119.944) -- 0:00:51 259000 -- (-2119.370) [-2122.099] (-2119.596) (-2122.495) * (-2121.461) (-2128.425) (-2121.744) [-2119.827] -- 0:00:51 259500 -- (-2119.108) [-2120.418] (-2121.771) (-2122.279) * (-2120.974) [-2122.303] (-2122.503) (-2120.927) -- 0:00:51 260000 -- (-2120.982) (-2120.007) (-2120.183) [-2121.048] * (-2122.720) (-2123.786) (-2123.358) [-2124.686] -- 0:00:51 Average standard deviation of split frequencies: 0.014848 260500 -- (-2121.822) [-2123.891] (-2121.462) (-2127.278) * (-2127.249) (-2120.973) (-2122.412) [-2124.498] -- 0:00:51 261000 -- (-2120.481) (-2123.225) (-2125.869) [-2120.337] * [-2123.267] (-2120.973) (-2121.001) (-2125.972) -- 0:00:50 261500 -- (-2120.438) [-2121.850] (-2124.458) (-2119.987) * (-2119.890) (-2118.749) [-2119.165] (-2123.077) -- 0:00:50 262000 -- [-2119.884] (-2121.771) (-2123.907) (-2120.934) * (-2120.123) [-2120.642] (-2120.111) (-2122.911) -- 0:00:50 262500 -- (-2119.350) [-2121.096] (-2123.907) (-2125.228) * [-2119.273] (-2123.328) (-2123.835) (-2122.794) -- 0:00:50 263000 -- (-2119.276) (-2119.730) [-2122.745] (-2125.303) * [-2119.655] (-2121.743) (-2124.112) (-2121.035) -- 0:00:50 263500 -- (-2119.600) (-2122.575) (-2124.904) [-2120.878] * [-2123.074] (-2122.741) (-2126.104) (-2119.488) -- 0:00:50 264000 -- (-2119.973) [-2121.613] (-2121.479) (-2120.878) * (-2121.291) (-2121.581) (-2119.940) [-2120.013] -- 0:00:50 264500 -- (-2119.789) (-2120.275) [-2121.345] (-2120.766) * [-2118.869] (-2123.016) (-2122.804) (-2119.487) -- 0:00:50 265000 -- (-2120.955) (-2122.343) (-2122.373) [-2121.754] * (-2120.375) [-2121.119] (-2121.923) (-2119.245) -- 0:00:49 Average standard deviation of split frequencies: 0.014644 265500 -- [-2119.501] (-2122.798) (-2122.864) (-2119.639) * (-2122.917) (-2120.320) (-2120.051) [-2120.332] -- 0:00:49 266000 -- (-2120.405) (-2122.375) [-2123.068] (-2120.135) * (-2121.605) (-2121.318) [-2122.840] (-2121.393) -- 0:00:49 266500 -- [-2120.327] (-2122.422) (-2118.902) (-2120.154) * [-2120.058] (-2120.642) (-2122.836) (-2120.702) -- 0:00:49 267000 -- (-2120.489) (-2120.176) (-2121.552) [-2120.951] * (-2119.440) (-2121.375) [-2119.435] (-2120.889) -- 0:00:49 267500 -- (-2120.535) (-2118.658) (-2123.099) [-2120.604] * [-2120.241] (-2122.286) (-2123.922) (-2122.285) -- 0:00:49 268000 -- (-2120.504) [-2119.421] (-2120.850) (-2119.935) * [-2121.386] (-2122.604) (-2123.068) (-2126.376) -- 0:00:49 268500 -- [-2123.139] (-2120.878) (-2121.738) (-2119.787) * [-2120.536] (-2119.905) (-2120.836) (-2121.406) -- 0:00:49 269000 -- (-2122.574) (-2118.901) (-2121.641) [-2121.663] * (-2120.725) [-2120.188] (-2122.660) (-2124.551) -- 0:00:48 269500 -- (-2121.261) (-2119.750) [-2123.430] (-2121.005) * [-2120.207] (-2126.078) (-2120.192) (-2125.528) -- 0:00:51 270000 -- (-2122.970) (-2119.742) [-2119.272] (-2121.871) * (-2121.605) (-2123.725) (-2119.456) [-2122.535] -- 0:00:51 Average standard deviation of split frequencies: 0.013585 270500 -- (-2122.359) (-2119.008) [-2121.279] (-2122.681) * (-2121.921) (-2121.983) [-2121.719] (-2122.096) -- 0:00:51 271000 -- [-2120.323] (-2121.746) (-2120.703) (-2121.088) * (-2122.160) [-2120.334] (-2121.449) (-2123.056) -- 0:00:51 271500 -- (-2121.288) (-2120.755) [-2122.886] (-2121.365) * (-2120.658) (-2120.131) (-2122.313) [-2123.046] -- 0:00:50 272000 -- (-2120.247) (-2121.416) [-2122.698] (-2120.837) * (-2122.718) [-2119.472] (-2121.290) (-2120.828) -- 0:00:50 272500 -- (-2120.104) [-2122.051] (-2120.422) (-2119.914) * (-2123.127) [-2119.791] (-2120.021) (-2121.649) -- 0:00:50 273000 -- [-2123.002] (-2122.164) (-2122.607) (-2121.001) * (-2122.863) (-2119.261) (-2119.677) [-2120.584] -- 0:00:50 273500 -- [-2119.734] (-2123.669) (-2123.535) (-2121.118) * (-2123.628) (-2119.999) [-2120.831] (-2122.371) -- 0:00:50 274000 -- (-2119.807) [-2121.459] (-2123.519) (-2120.081) * (-2125.608) [-2122.056] (-2119.406) (-2119.166) -- 0:00:50 274500 -- [-2120.349] (-2121.476) (-2121.704) (-2119.593) * (-2124.826) (-2119.854) (-2123.707) [-2119.065] -- 0:00:50 275000 -- [-2120.889] (-2121.607) (-2120.127) (-2120.120) * (-2122.515) (-2121.985) (-2124.434) [-2119.062] -- 0:00:50 Average standard deviation of split frequencies: 0.012136 275500 -- (-2121.947) (-2125.284) (-2119.531) [-2120.089] * (-2121.004) [-2119.922] (-2122.950) (-2119.431) -- 0:00:49 276000 -- (-2124.971) (-2122.717) [-2120.509] (-2120.207) * (-2120.915) (-2121.780) [-2120.523] (-2120.223) -- 0:00:49 276500 -- [-2124.795] (-2126.531) (-2123.062) (-2120.528) * (-2121.139) (-2124.925) (-2120.982) [-2120.479] -- 0:00:49 277000 -- [-2122.475] (-2119.325) (-2123.252) (-2120.150) * (-2122.878) (-2120.022) (-2120.820) [-2119.241] -- 0:00:49 277500 -- [-2121.747] (-2119.157) (-2123.293) (-2119.854) * (-2120.699) [-2122.015] (-2122.467) (-2119.063) -- 0:00:49 278000 -- [-2121.840] (-2121.545) (-2124.453) (-2119.957) * (-2121.027) (-2121.753) [-2124.930] (-2120.291) -- 0:00:49 278500 -- (-2122.740) (-2122.022) (-2123.951) [-2119.676] * (-2122.631) [-2122.012] (-2124.871) (-2120.896) -- 0:00:49 279000 -- (-2122.208) (-2119.934) (-2121.587) [-2119.460] * (-2121.085) [-2120.037] (-2119.777) (-2121.277) -- 0:00:49 279500 -- (-2122.939) (-2119.284) (-2123.073) [-2120.823] * (-2125.692) [-2120.042] (-2119.384) (-2119.454) -- 0:00:48 280000 -- [-2125.310] (-2120.000) (-2123.328) (-2120.812) * [-2122.776] (-2122.071) (-2121.847) (-2120.046) -- 0:00:48 Average standard deviation of split frequencies: 0.010785 280500 -- (-2121.391) [-2121.302] (-2119.325) (-2120.861) * (-2120.698) (-2125.655) [-2120.079] (-2120.417) -- 0:00:48 281000 -- [-2123.091] (-2119.526) (-2122.496) (-2120.016) * (-2121.018) (-2124.338) (-2119.344) [-2119.919] -- 0:00:48 281500 -- [-2122.268] (-2120.962) (-2123.998) (-2122.007) * (-2121.494) (-2121.427) [-2120.649] (-2123.748) -- 0:00:48 282000 -- [-2121.823] (-2121.616) (-2122.948) (-2124.960) * [-2120.701] (-2120.498) (-2124.084) (-2122.166) -- 0:00:48 282500 -- [-2119.780] (-2118.993) (-2123.681) (-2125.414) * [-2119.356] (-2120.227) (-2123.812) (-2125.190) -- 0:00:50 283000 -- (-2120.811) [-2121.012] (-2125.891) (-2127.749) * (-2120.235) [-2121.472] (-2122.611) (-2123.144) -- 0:00:50 283500 -- (-2120.811) [-2120.932] (-2120.752) (-2123.377) * (-2121.277) [-2120.615] (-2120.239) (-2120.535) -- 0:00:50 284000 -- (-2119.035) (-2120.317) (-2121.921) [-2120.924] * (-2123.381) [-2120.618] (-2119.908) (-2120.878) -- 0:00:50 284500 -- (-2120.540) (-2122.251) [-2123.955] (-2118.922) * (-2120.418) (-2120.874) [-2121.892] (-2120.878) -- 0:00:50 285000 -- (-2119.994) (-2121.548) (-2119.365) [-2118.929] * [-2120.841] (-2122.573) (-2121.446) (-2123.215) -- 0:00:50 Average standard deviation of split frequencies: 0.011080 285500 -- (-2123.027) (-2119.589) (-2123.521) [-2118.895] * (-2121.876) [-2124.087] (-2120.945) (-2124.415) -- 0:00:50 286000 -- (-2120.129) [-2119.302] (-2124.003) (-2122.248) * [-2120.048] (-2122.668) (-2124.834) (-2122.821) -- 0:00:49 286500 -- (-2121.243) (-2118.851) [-2119.584] (-2122.352) * (-2120.692) (-2121.899) [-2123.352] (-2121.297) -- 0:00:49 287000 -- (-2123.897) (-2119.594) [-2120.462] (-2122.574) * (-2120.758) (-2121.557) (-2120.823) [-2120.978] -- 0:00:49 287500 -- (-2124.642) [-2118.932] (-2124.574) (-2122.002) * (-2120.380) (-2121.921) [-2119.542] (-2123.481) -- 0:00:49 288000 -- (-2124.829) (-2124.148) [-2120.386] (-2119.445) * [-2121.222] (-2120.867) (-2119.530) (-2125.079) -- 0:00:49 288500 -- (-2122.250) (-2123.843) [-2118.899] (-2121.401) * [-2122.410] (-2121.957) (-2122.681) (-2120.753) -- 0:00:49 289000 -- [-2122.153] (-2126.140) (-2119.062) (-2119.244) * (-2120.894) (-2121.231) (-2119.948) [-2120.374] -- 0:00:49 289500 -- (-2122.535) (-2122.720) [-2119.168] (-2119.935) * [-2120.850] (-2122.603) (-2120.493) (-2121.282) -- 0:00:49 290000 -- (-2120.940) [-2122.021] (-2119.553) (-2123.904) * [-2122.912] (-2122.878) (-2120.084) (-2121.153) -- 0:00:48 Average standard deviation of split frequencies: 0.011950 290500 -- (-2120.679) (-2123.332) [-2121.238] (-2123.905) * (-2118.971) (-2123.748) [-2120.217] (-2124.674) -- 0:00:48 291000 -- (-2122.919) (-2121.910) [-2120.333] (-2122.907) * (-2119.238) [-2122.386] (-2127.465) (-2121.995) -- 0:00:48 291500 -- (-2123.191) (-2120.908) [-2120.039] (-2123.575) * (-2119.812) [-2125.475] (-2124.231) (-2121.838) -- 0:00:48 292000 -- (-2122.120) (-2120.876) (-2120.533) [-2122.677] * (-2123.582) (-2122.024) [-2123.438] (-2120.315) -- 0:00:48 292500 -- (-2119.927) (-2121.599) (-2125.825) [-2121.972] * (-2121.562) (-2121.464) (-2124.669) [-2119.788] -- 0:00:48 293000 -- (-2120.475) (-2120.539) (-2121.518) [-2122.562] * [-2120.127] (-2119.386) (-2125.974) (-2122.175) -- 0:00:48 293500 -- [-2119.628] (-2123.504) (-2120.060) (-2123.244) * (-2120.253) (-2119.337) [-2131.294] (-2120.606) -- 0:00:48 294000 -- (-2120.684) (-2121.825) (-2120.083) [-2122.211] * (-2121.374) (-2120.020) [-2123.566] (-2121.697) -- 0:00:48 294500 -- (-2122.688) (-2121.817) [-2119.984] (-2120.067) * (-2119.840) (-2122.487) [-2120.640] (-2121.832) -- 0:00:47 295000 -- [-2122.709] (-2121.631) (-2123.031) (-2120.901) * (-2120.408) (-2120.552) (-2120.325) [-2123.575] -- 0:00:47 Average standard deviation of split frequencies: 0.011400 295500 -- [-2124.242] (-2124.493) (-2119.424) (-2121.327) * [-2119.385] (-2122.744) (-2122.018) (-2121.843) -- 0:00:47 296000 -- (-2124.372) (-2120.386) [-2119.588] (-2119.640) * (-2119.043) [-2122.795] (-2121.069) (-2119.855) -- 0:00:49 296500 -- (-2123.758) [-2120.578] (-2120.334) (-2120.757) * (-2120.568) (-2122.443) [-2120.763] (-2123.010) -- 0:00:49 297000 -- [-2122.187] (-2121.041) (-2120.641) (-2120.765) * (-2122.327) (-2119.306) (-2122.334) [-2120.009] -- 0:00:49 297500 -- (-2122.833) [-2120.305] (-2119.641) (-2119.357) * (-2120.511) [-2119.600] (-2121.520) (-2124.284) -- 0:00:49 298000 -- (-2121.131) [-2120.239] (-2121.075) (-2123.572) * (-2120.490) [-2119.661] (-2126.653) (-2121.910) -- 0:00:49 298500 -- [-2120.860] (-2122.810) (-2121.747) (-2126.093) * (-2121.846) [-2119.703] (-2125.001) (-2123.720) -- 0:00:49 299000 -- (-2121.553) (-2123.232) (-2119.561) [-2121.551] * [-2119.648] (-2120.547) (-2121.782) (-2119.655) -- 0:00:49 299500 -- [-2121.207] (-2125.857) (-2120.147) (-2128.241) * (-2119.892) (-2120.547) [-2120.335] (-2119.415) -- 0:00:49 300000 -- [-2122.163] (-2123.640) (-2119.297) (-2121.420) * (-2119.836) (-2122.334) [-2120.712] (-2119.395) -- 0:00:48 Average standard deviation of split frequencies: 0.012451 300500 -- (-2122.655) (-2122.956) [-2120.308] (-2123.398) * (-2119.944) (-2120.833) (-2126.753) [-2119.479] -- 0:00:48 301000 -- (-2119.134) (-2121.486) [-2119.859] (-2120.372) * (-2119.275) (-2119.938) (-2123.046) [-2119.830] -- 0:00:48 301500 -- (-2120.288) [-2119.790] (-2120.580) (-2119.997) * (-2119.558) (-2121.057) (-2120.811) [-2119.474] -- 0:00:48 302000 -- (-2119.789) (-2121.993) [-2120.423] (-2121.086) * [-2119.558] (-2125.966) (-2121.481) (-2120.950) -- 0:00:48 302500 -- (-2119.749) (-2122.605) [-2125.764] (-2120.326) * (-2119.142) [-2122.991] (-2122.147) (-2121.110) -- 0:00:48 303000 -- [-2120.652] (-2123.654) (-2122.323) (-2121.592) * (-2121.566) (-2124.403) [-2121.341] (-2121.388) -- 0:00:48 303500 -- [-2120.579] (-2123.962) (-2121.448) (-2122.436) * (-2121.232) (-2125.384) [-2121.171] (-2119.597) -- 0:00:48 304000 -- (-2122.643) (-2126.120) (-2118.775) [-2123.106] * (-2119.875) (-2124.966) [-2121.372] (-2119.676) -- 0:00:48 304500 -- [-2123.897] (-2122.934) (-2119.877) (-2121.814) * (-2123.595) (-2121.385) [-2121.711] (-2120.094) -- 0:00:47 305000 -- (-2121.309) [-2123.127] (-2119.589) (-2123.868) * [-2118.918] (-2121.325) (-2121.557) (-2120.662) -- 0:00:47 Average standard deviation of split frequencies: 0.012405 305500 -- (-2121.494) [-2123.386] (-2118.936) (-2122.231) * [-2118.984] (-2120.569) (-2121.871) (-2120.664) -- 0:00:47 306000 -- [-2120.026] (-2124.287) (-2118.933) (-2121.497) * (-2124.353) [-2122.303] (-2119.822) (-2122.078) -- 0:00:47 306500 -- (-2119.991) [-2123.302] (-2120.656) (-2123.752) * (-2124.148) (-2123.164) [-2122.259] (-2121.535) -- 0:00:47 307000 -- [-2120.322] (-2121.844) (-2125.199) (-2122.377) * [-2124.443] (-2124.399) (-2119.654) (-2120.077) -- 0:00:47 307500 -- (-2121.652) [-2119.656] (-2122.638) (-2120.304) * (-2120.013) (-2122.241) [-2120.219] (-2120.406) -- 0:00:47 308000 -- (-2119.417) (-2122.651) [-2119.206] (-2123.663) * (-2127.258) [-2120.936] (-2120.102) (-2122.239) -- 0:00:47 308500 -- (-2121.373) (-2124.222) [-2119.158] (-2126.640) * (-2122.029) (-2125.022) [-2120.936] (-2120.598) -- 0:00:47 309000 -- (-2119.980) (-2121.527) (-2121.189) [-2122.262] * [-2120.846] (-2121.835) (-2121.317) (-2121.406) -- 0:00:46 309500 -- (-2121.016) (-2124.919) [-2119.236] (-2123.825) * (-2121.035) (-2123.394) [-2120.199] (-2120.266) -- 0:00:49 310000 -- [-2120.255] (-2123.950) (-2119.915) (-2126.083) * (-2121.741) [-2120.952] (-2122.185) (-2120.012) -- 0:00:48 Average standard deviation of split frequencies: 0.010890 310500 -- (-2123.407) (-2123.291) [-2119.660] (-2120.510) * (-2119.213) (-2122.012) (-2122.106) [-2121.082] -- 0:00:48 311000 -- [-2123.715] (-2122.850) (-2121.024) (-2120.154) * (-2119.796) (-2123.747) [-2122.907] (-2121.518) -- 0:00:48 311500 -- (-2125.050) (-2121.521) (-2122.385) [-2122.423] * (-2120.066) [-2124.943] (-2120.999) (-2120.878) -- 0:00:48 312000 -- [-2121.433] (-2123.634) (-2121.282) (-2123.446) * (-2119.132) (-2127.221) (-2120.919) [-2123.773] -- 0:00:48 312500 -- (-2126.759) [-2120.416] (-2120.107) (-2120.293) * (-2121.175) (-2122.485) (-2123.213) [-2122.743] -- 0:00:48 313000 -- (-2122.989) (-2121.110) [-2123.761] (-2123.357) * (-2122.831) (-2120.508) (-2121.137) [-2122.005] -- 0:00:48 313500 -- (-2122.348) [-2120.429] (-2129.333) (-2120.932) * (-2120.864) (-2120.567) (-2121.001) [-2120.759] -- 0:00:48 314000 -- (-2122.221) (-2121.385) (-2122.469) [-2122.631] * [-2120.041] (-2120.898) (-2129.175) (-2121.729) -- 0:00:48 314500 -- (-2122.029) [-2121.420] (-2121.336) (-2123.123) * (-2120.863) (-2121.838) [-2122.058] (-2122.344) -- 0:00:47 315000 -- [-2122.687] (-2120.032) (-2121.423) (-2120.746) * (-2121.178) [-2121.575] (-2122.524) (-2122.202) -- 0:00:47 Average standard deviation of split frequencies: 0.011603 315500 -- (-2124.607) [-2123.076] (-2122.168) (-2124.955) * (-2122.648) (-2121.133) (-2121.669) [-2122.388] -- 0:00:47 316000 -- [-2124.365] (-2123.206) (-2122.188) (-2124.429) * (-2120.408) (-2124.580) [-2121.727] (-2123.718) -- 0:00:47 316500 -- [-2121.703] (-2126.467) (-2125.755) (-2122.305) * (-2121.079) [-2121.012] (-2121.726) (-2130.027) -- 0:00:47 317000 -- [-2122.914] (-2124.322) (-2123.415) (-2122.691) * (-2119.684) (-2122.508) (-2126.735) [-2125.711] -- 0:00:47 317500 -- [-2123.120] (-2123.405) (-2122.571) (-2122.344) * (-2120.023) [-2120.067] (-2123.771) (-2119.888) -- 0:00:47 318000 -- (-2122.056) (-2121.011) (-2121.313) [-2122.236] * (-2121.968) (-2120.626) (-2119.215) [-2120.552] -- 0:00:47 318500 -- [-2121.784] (-2122.191) (-2120.472) (-2124.591) * (-2119.623) (-2120.908) [-2119.594] (-2124.454) -- 0:00:47 319000 -- (-2124.860) (-2122.074) (-2120.603) [-2120.761] * (-2119.861) [-2119.936] (-2124.782) (-2121.662) -- 0:00:46 319500 -- (-2124.011) (-2125.159) (-2123.519) [-2120.439] * (-2120.432) (-2119.936) [-2121.677] (-2124.234) -- 0:00:46 320000 -- (-2122.985) [-2120.542] (-2121.256) (-2120.807) * (-2122.444) (-2119.913) (-2119.232) [-2121.000] -- 0:00:46 Average standard deviation of split frequencies: 0.012971 320500 -- (-2122.636) (-2119.709) [-2121.061] (-2122.676) * (-2121.181) (-2120.054) [-2120.118] (-2121.443) -- 0:00:46 321000 -- (-2123.064) (-2120.606) [-2121.277] (-2123.512) * (-2125.864) (-2121.051) [-2120.441] (-2121.417) -- 0:00:46 321500 -- [-2120.268] (-2120.760) (-2119.557) (-2120.051) * (-2123.712) (-2119.227) [-2124.953] (-2120.563) -- 0:00:46 322000 -- (-2119.020) (-2120.556) [-2119.474] (-2119.830) * (-2120.972) (-2119.348) [-2121.213] (-2121.328) -- 0:00:46 322500 -- (-2118.729) (-2122.773) [-2119.676] (-2119.192) * (-2121.552) (-2119.054) [-2122.151] (-2122.561) -- 0:00:46 323000 -- (-2121.163) [-2118.791] (-2119.723) (-2120.561) * (-2124.732) (-2119.139) (-2119.827) [-2122.646] -- 0:00:46 323500 -- (-2118.922) [-2118.978] (-2119.997) (-2121.329) * (-2123.128) (-2120.051) (-2119.368) [-2121.205] -- 0:00:48 324000 -- (-2122.297) [-2119.754] (-2119.997) (-2119.735) * (-2121.545) [-2120.565] (-2119.791) (-2120.340) -- 0:00:47 324500 -- (-2121.833) [-2121.239] (-2119.730) (-2124.199) * (-2122.534) [-2119.854] (-2120.065) (-2121.379) -- 0:00:47 325000 -- (-2121.716) [-2119.156] (-2119.260) (-2121.306) * (-2129.703) [-2119.476] (-2122.226) (-2120.327) -- 0:00:47 Average standard deviation of split frequencies: 0.012773 325500 -- (-2120.176) (-2120.683) [-2118.931] (-2120.364) * (-2121.357) (-2120.281) (-2124.291) [-2120.222] -- 0:00:47 326000 -- [-2121.448] (-2120.094) (-2122.513) (-2121.162) * (-2121.362) [-2119.787] (-2119.689) (-2122.526) -- 0:00:47 326500 -- [-2121.969] (-2123.698) (-2120.262) (-2119.356) * [-2120.441] (-2123.824) (-2119.698) (-2120.816) -- 0:00:47 327000 -- [-2124.947] (-2122.709) (-2120.186) (-2123.631) * (-2119.045) [-2120.358] (-2121.999) (-2121.741) -- 0:00:47 327500 -- [-2121.645] (-2119.260) (-2120.053) (-2124.290) * (-2120.076) (-2122.001) (-2122.682) [-2121.413] -- 0:00:47 328000 -- [-2120.482] (-2119.206) (-2123.400) (-2121.886) * [-2119.824] (-2121.956) (-2122.164) (-2119.975) -- 0:00:47 328500 -- (-2121.621) (-2118.957) [-2122.667] (-2123.006) * (-2119.819) (-2122.280) (-2122.483) [-2119.227] -- 0:00:47 329000 -- (-2120.810) (-2118.957) (-2121.235) [-2128.758] * (-2120.913) [-2122.641] (-2121.435) (-2119.742) -- 0:00:46 329500 -- [-2120.564] (-2120.027) (-2123.810) (-2124.451) * (-2121.430) (-2122.175) (-2120.157) [-2120.316] -- 0:00:46 330000 -- (-2123.308) [-2119.734] (-2121.146) (-2120.355) * (-2121.393) [-2120.812] (-2120.298) (-2123.238) -- 0:00:46 Average standard deviation of split frequencies: 0.013860 330500 -- (-2124.108) (-2121.695) (-2123.229) [-2120.262] * (-2121.432) (-2122.370) (-2123.519) [-2120.839] -- 0:00:46 331000 -- (-2122.632) (-2118.870) (-2119.553) [-2120.980] * (-2119.126) [-2120.681] (-2123.519) (-2124.169) -- 0:00:46 331500 -- (-2124.470) [-2120.556] (-2119.409) (-2120.091) * [-2120.826] (-2122.287) (-2119.930) (-2120.796) -- 0:00:46 332000 -- (-2122.182) (-2120.648) (-2119.439) [-2120.136] * (-2121.068) (-2120.324) (-2120.075) [-2120.641] -- 0:00:46 332500 -- (-2122.331) [-2120.115] (-2119.714) (-2124.785) * (-2121.053) [-2121.392] (-2120.196) (-2121.048) -- 0:00:46 333000 -- [-2121.464] (-2119.523) (-2122.894) (-2121.328) * (-2124.279) (-2121.421) (-2119.933) [-2119.340] -- 0:00:46 333500 -- (-2121.287) (-2120.441) (-2124.000) [-2120.270] * [-2120.630] (-2119.678) (-2121.410) (-2121.947) -- 0:00:45 334000 -- (-2122.040) (-2120.071) [-2124.727] (-2122.530) * [-2120.722] (-2118.867) (-2121.382) (-2119.912) -- 0:00:45 334500 -- (-2125.545) (-2120.546) (-2120.798) [-2120.200] * [-2121.641] (-2119.079) (-2120.594) (-2120.466) -- 0:00:45 335000 -- (-2121.569) (-2120.688) [-2121.127] (-2120.880) * (-2121.500) [-2123.775] (-2120.539) (-2121.080) -- 0:00:45 Average standard deviation of split frequencies: 0.013782 335500 -- (-2123.734) [-2120.876] (-2120.933) (-2120.846) * (-2121.792) (-2123.394) [-2120.560] (-2120.353) -- 0:00:45 336000 -- (-2120.366) [-2120.858] (-2120.529) (-2121.099) * (-2122.028) (-2127.585) [-2119.663] (-2123.300) -- 0:00:45 336500 -- (-2119.630) (-2120.667) [-2120.327] (-2124.080) * [-2119.418] (-2126.485) (-2120.225) (-2122.899) -- 0:00:45 337000 -- (-2120.885) (-2122.066) [-2122.134] (-2123.657) * (-2119.629) (-2123.627) (-2120.205) [-2122.629] -- 0:00:45 337500 -- [-2122.326] (-2119.683) (-2122.562) (-2124.540) * (-2122.891) (-2120.465) (-2120.981) [-2132.330] -- 0:00:47 338000 -- (-2120.581) (-2122.640) [-2123.903] (-2123.738) * (-2123.979) (-2120.919) [-2120.463] (-2125.273) -- 0:00:47 338500 -- (-2119.393) [-2121.827] (-2119.593) (-2124.562) * (-2124.527) (-2120.059) [-2121.172] (-2122.593) -- 0:00:46 339000 -- (-2120.884) [-2124.428] (-2119.260) (-2123.280) * [-2121.402] (-2120.315) (-2120.641) (-2121.629) -- 0:00:46 339500 -- (-2119.986) (-2122.316) [-2118.993] (-2119.816) * (-2120.938) (-2120.422) (-2123.341) [-2122.413] -- 0:00:46 340000 -- (-2124.579) (-2120.060) [-2120.797] (-2120.179) * [-2119.446] (-2120.733) (-2121.941) (-2121.178) -- 0:00:46 Average standard deviation of split frequencies: 0.012942 340500 -- (-2123.621) (-2121.068) [-2119.902] (-2120.007) * (-2122.342) [-2120.894] (-2120.474) (-2121.178) -- 0:00:46 341000 -- (-2123.666) (-2121.651) (-2120.491) [-2122.267] * (-2122.200) (-2121.840) (-2120.439) [-2125.480] -- 0:00:46 341500 -- (-2119.153) [-2121.325] (-2122.534) (-2121.346) * (-2120.636) (-2126.866) (-2120.525) [-2124.801] -- 0:00:46 342000 -- (-2118.997) [-2119.427] (-2121.878) (-2122.145) * [-2121.515] (-2120.781) (-2119.966) (-2122.346) -- 0:00:46 342500 -- (-2119.671) (-2120.006) [-2119.830] (-2120.920) * (-2121.388) [-2120.721] (-2122.914) (-2120.640) -- 0:00:46 343000 -- (-2119.985) (-2120.631) (-2121.178) [-2120.752] * (-2122.308) (-2120.833) [-2122.837] (-2121.923) -- 0:00:45 343500 -- (-2120.318) (-2120.772) (-2121.483) [-2119.511] * (-2121.015) [-2121.057] (-2120.641) (-2122.747) -- 0:00:45 344000 -- (-2119.952) [-2119.172] (-2120.142) (-2123.426) * (-2119.738) (-2120.196) [-2120.504] (-2121.276) -- 0:00:45 344500 -- (-2118.962) (-2119.681) (-2120.894) [-2122.418] * (-2121.584) (-2120.237) [-2125.030] (-2120.138) -- 0:00:45 345000 -- (-2122.965) [-2119.705] (-2124.885) (-2122.666) * [-2120.940] (-2126.739) (-2122.894) (-2120.769) -- 0:00:45 Average standard deviation of split frequencies: 0.011808 345500 -- (-2122.828) [-2119.283] (-2125.737) (-2122.071) * (-2120.419) (-2120.753) (-2120.439) [-2120.964] -- 0:00:45 346000 -- (-2122.042) (-2122.054) (-2120.714) [-2122.645] * [-2120.650] (-2120.949) (-2120.283) (-2120.953) -- 0:00:45 346500 -- (-2121.674) [-2119.531] (-2121.432) (-2121.212) * [-2119.921] (-2119.307) (-2121.921) (-2120.521) -- 0:00:45 347000 -- (-2120.471) (-2123.226) (-2121.982) [-2123.027] * (-2119.090) (-2122.775) (-2119.879) [-2119.543] -- 0:00:45 347500 -- (-2120.053) (-2122.943) (-2120.338) [-2122.955] * (-2123.922) [-2119.932] (-2120.171) (-2122.278) -- 0:00:45 348000 -- [-2121.475] (-2120.059) (-2120.727) (-2123.829) * [-2120.481] (-2119.686) (-2119.557) (-2122.795) -- 0:00:44 348500 -- [-2119.527] (-2121.733) (-2122.025) (-2119.623) * (-2123.525) (-2120.973) (-2121.190) [-2120.712] -- 0:00:44 349000 -- (-2121.936) [-2119.569] (-2126.126) (-2122.203) * (-2120.787) (-2122.831) [-2119.382] (-2120.696) -- 0:00:44 349500 -- (-2119.354) (-2119.573) (-2119.106) [-2122.133] * [-2123.877] (-2121.818) (-2119.496) (-2120.965) -- 0:00:44 350000 -- (-2119.097) [-2120.840] (-2120.397) (-2125.056) * (-2122.354) (-2122.056) [-2121.005] (-2125.105) -- 0:00:44 Average standard deviation of split frequencies: 0.011352 350500 -- [-2119.206] (-2122.346) (-2122.247) (-2121.228) * [-2122.213] (-2123.733) (-2122.564) (-2127.776) -- 0:00:44 351000 -- (-2120.206) (-2120.490) [-2121.042] (-2121.385) * (-2124.302) (-2119.805) (-2119.373) [-2126.404] -- 0:00:44 351500 -- (-2119.701) [-2121.063] (-2120.505) (-2121.295) * (-2122.325) [-2120.061] (-2119.352) (-2124.554) -- 0:00:46 352000 -- (-2121.185) (-2120.778) [-2121.657] (-2122.172) * (-2122.072) (-2120.328) [-2120.491] (-2120.436) -- 0:00:46 352500 -- [-2121.278] (-2121.583) (-2122.101) (-2123.234) * (-2123.163) (-2122.338) [-2120.383] (-2120.807) -- 0:00:45 353000 -- [-2121.403] (-2123.800) (-2120.738) (-2122.274) * (-2120.757) [-2121.585] (-2119.248) (-2127.414) -- 0:00:45 353500 -- [-2121.544] (-2122.261) (-2119.162) (-2121.917) * (-2122.067) (-2122.274) [-2119.615] (-2125.081) -- 0:00:45 354000 -- (-2127.382) [-2123.439] (-2120.589) (-2121.788) * (-2122.298) [-2119.998] (-2121.762) (-2124.726) -- 0:00:45 354500 -- [-2120.204] (-2125.776) (-2121.372) (-2121.500) * (-2120.599) (-2119.195) [-2121.971] (-2120.312) -- 0:00:45 355000 -- (-2121.056) (-2121.711) [-2122.984] (-2122.585) * (-2120.066) (-2119.054) [-2120.366] (-2118.829) -- 0:00:45 Average standard deviation of split frequencies: 0.011329 355500 -- [-2120.917] (-2119.597) (-2120.561) (-2121.350) * (-2120.274) (-2120.286) [-2119.909] (-2119.209) -- 0:00:45 356000 -- (-2120.388) [-2121.980] (-2124.422) (-2119.913) * (-2121.167) (-2119.297) (-2122.129) [-2119.195] -- 0:00:45 356500 -- (-2119.963) (-2121.981) (-2124.964) [-2119.506] * [-2119.310] (-2122.090) (-2121.562) (-2119.185) -- 0:00:45 357000 -- (-2120.262) (-2121.219) (-2120.688) [-2121.399] * (-2120.175) (-2123.919) (-2125.484) [-2120.227] -- 0:00:45 357500 -- (-2121.324) (-2120.079) [-2119.541] (-2121.404) * (-2123.391) (-2124.288) [-2121.271] (-2120.254) -- 0:00:44 358000 -- (-2119.678) (-2119.318) [-2119.570] (-2121.698) * [-2120.286] (-2128.661) (-2121.319) (-2119.769) -- 0:00:44 358500 -- [-2119.141] (-2120.188) (-2123.082) (-2122.519) * (-2119.998) (-2121.483) (-2123.842) [-2118.830] -- 0:00:44 359000 -- (-2119.526) [-2122.289] (-2122.868) (-2122.459) * (-2121.874) [-2121.215] (-2119.452) (-2118.841) -- 0:00:44 359500 -- (-2121.200) (-2122.794) (-2120.407) [-2122.064] * (-2124.092) (-2121.917) (-2121.090) [-2119.463] -- 0:00:44 360000 -- (-2120.566) (-2122.156) (-2120.803) [-2121.047] * (-2127.071) [-2120.025] (-2120.453) (-2119.550) -- 0:00:44 Average standard deviation of split frequencies: 0.010747 360500 -- (-2121.176) (-2122.293) [-2119.494] (-2120.931) * (-2122.375) [-2126.177] (-2123.241) (-2120.395) -- 0:00:44 361000 -- (-2121.568) (-2119.391) [-2121.554] (-2121.769) * [-2120.193] (-2125.100) (-2123.195) (-2120.778) -- 0:00:44 361500 -- (-2121.364) (-2119.791) (-2120.151) [-2121.084] * [-2120.705] (-2121.831) (-2121.665) (-2123.650) -- 0:00:44 362000 -- [-2123.237] (-2119.589) (-2124.104) (-2121.543) * (-2120.601) (-2120.409) (-2120.863) [-2119.481] -- 0:00:44 362500 -- (-2121.326) (-2120.217) (-2121.834) [-2123.017] * (-2122.179) [-2120.158] (-2120.949) (-2121.440) -- 0:00:43 363000 -- (-2122.821) (-2120.190) (-2123.331) [-2121.187] * (-2124.640) [-2120.171] (-2120.173) (-2122.841) -- 0:00:43 363500 -- [-2120.907] (-2119.600) (-2123.192) (-2121.415) * [-2124.301] (-2120.492) (-2121.908) (-2120.688) -- 0:00:43 364000 -- (-2119.757) (-2119.599) (-2123.902) [-2120.832] * (-2123.148) (-2123.104) (-2121.529) [-2123.780] -- 0:00:43 364500 -- [-2120.470] (-2120.473) (-2121.913) (-2122.072) * (-2120.909) (-2123.031) [-2123.324] (-2119.457) -- 0:00:43 365000 -- (-2120.419) (-2120.921) (-2120.676) [-2122.213] * (-2121.389) (-2120.993) (-2128.355) [-2120.651] -- 0:00:43 Average standard deviation of split frequencies: 0.010805 365500 -- (-2122.735) (-2118.967) [-2121.704] (-2121.697) * (-2120.494) [-2120.587] (-2124.443) (-2121.362) -- 0:00:45 366000 -- (-2120.629) (-2119.692) (-2121.940) [-2122.936] * (-2121.554) [-2120.524] (-2121.816) (-2120.867) -- 0:00:45 366500 -- (-2119.663) [-2119.229] (-2120.052) (-2119.944) * (-2121.481) [-2119.266] (-2123.058) (-2120.707) -- 0:00:44 367000 -- (-2123.279) (-2119.485) (-2121.244) [-2120.197] * (-2123.526) (-2119.812) [-2122.375] (-2120.843) -- 0:00:44 367500 -- (-2122.331) (-2120.059) (-2120.823) [-2120.496] * (-2121.722) (-2122.589) [-2121.142] (-2122.319) -- 0:00:44 368000 -- (-2121.035) (-2123.200) (-2125.467) [-2120.952] * (-2120.065) (-2119.809) [-2120.504] (-2122.981) -- 0:00:44 368500 -- (-2123.371) (-2122.235) [-2120.019] (-2119.481) * (-2123.108) [-2119.798] (-2119.020) (-2122.116) -- 0:00:44 369000 -- [-2120.584] (-2122.476) (-2121.180) (-2120.429) * (-2121.129) (-2120.057) [-2120.047] (-2123.011) -- 0:00:44 369500 -- (-2120.044) [-2122.293] (-2120.895) (-2119.530) * (-2119.253) (-2120.431) (-2120.207) [-2123.646] -- 0:00:44 370000 -- (-2121.714) (-2121.008) (-2121.320) [-2119.938] * (-2119.141) (-2119.386) (-2119.791) [-2122.621] -- 0:00:44 Average standard deviation of split frequencies: 0.010773 370500 -- (-2120.604) (-2120.110) [-2122.832] (-2125.131) * (-2119.152) [-2119.272] (-2119.402) (-2122.438) -- 0:00:44 371000 -- (-2120.350) (-2119.572) (-2124.837) [-2123.043] * (-2119.814) (-2119.734) (-2120.181) [-2123.806] -- 0:00:44 371500 -- (-2120.330) (-2119.833) (-2122.327) [-2124.218] * (-2120.930) [-2123.425] (-2119.502) (-2126.064) -- 0:00:43 372000 -- (-2121.865) (-2119.878) [-2120.312] (-2120.276) * [-2121.876] (-2123.078) (-2119.236) (-2123.809) -- 0:00:43 372500 -- (-2119.566) (-2123.433) (-2121.346) [-2120.391] * (-2121.273) [-2122.790] (-2119.684) (-2119.242) -- 0:00:43 373000 -- (-2119.519) [-2121.482] (-2121.212) (-2122.248) * (-2120.321) (-2122.086) (-2119.359) [-2119.330] -- 0:00:43 373500 -- (-2121.472) (-2122.029) [-2120.843] (-2122.695) * (-2129.215) (-2122.507) [-2119.424] (-2119.807) -- 0:00:43 374000 -- (-2120.680) (-2122.153) [-2120.884] (-2125.948) * (-2124.357) (-2121.114) [-2119.201] (-2122.710) -- 0:00:43 374500 -- [-2121.710] (-2122.281) (-2120.697) (-2120.316) * [-2121.898] (-2123.946) (-2123.252) (-2128.025) -- 0:00:43 375000 -- (-2121.746) (-2124.173) (-2120.301) [-2122.772] * (-2121.116) (-2121.239) (-2121.424) [-2119.398] -- 0:00:43 Average standard deviation of split frequencies: 0.010472 375500 -- (-2120.337) [-2119.655] (-2119.961) (-2121.192) * (-2121.284) (-2121.270) (-2122.342) [-2119.325] -- 0:00:43 376000 -- (-2119.881) (-2119.631) [-2119.403] (-2122.527) * (-2122.410) (-2121.263) (-2123.771) [-2120.364] -- 0:00:43 376500 -- (-2119.913) (-2121.722) (-2123.341) [-2121.054] * (-2123.764) (-2122.632) (-2118.940) [-2122.793] -- 0:00:43 377000 -- (-2119.798) (-2119.725) (-2124.449) [-2119.668] * (-2121.195) [-2121.738] (-2119.318) (-2120.637) -- 0:00:42 377500 -- (-2122.554) (-2119.725) [-2123.319] (-2122.437) * (-2119.807) (-2126.017) [-2119.901] (-2120.659) -- 0:00:42 378000 -- (-2119.972) (-2120.316) [-2121.065] (-2125.596) * (-2120.309) (-2120.859) (-2122.180) [-2119.836] -- 0:00:42 378500 -- (-2119.750) (-2122.340) [-2120.654] (-2124.481) * (-2119.798) (-2119.481) (-2123.348) [-2119.837] -- 0:00:42 379000 -- (-2124.286) (-2125.162) (-2121.188) [-2122.000] * [-2119.180] (-2121.906) (-2123.343) (-2119.905) -- 0:00:42 379500 -- (-2120.840) (-2120.901) (-2121.351) [-2123.683] * (-2124.055) (-2120.484) (-2120.191) [-2121.804] -- 0:00:42 380000 -- (-2122.246) (-2119.216) [-2122.011] (-2126.667) * (-2125.489) (-2121.029) (-2120.647) [-2120.151] -- 0:00:44 Average standard deviation of split frequencies: 0.010417 380500 -- (-2120.910) [-2119.354] (-2121.410) (-2124.414) * (-2119.974) (-2122.188) (-2120.255) [-2119.185] -- 0:00:43 381000 -- (-2122.145) [-2119.165] (-2118.895) (-2122.672) * (-2119.229) (-2123.754) [-2119.843] (-2124.191) -- 0:00:43 381500 -- (-2122.268) [-2119.743] (-2119.045) (-2123.004) * [-2119.228] (-2123.567) (-2122.394) (-2123.744) -- 0:00:43 382000 -- (-2126.993) (-2122.747) [-2119.530] (-2123.360) * [-2119.041] (-2123.200) (-2122.099) (-2120.230) -- 0:00:43 382500 -- (-2122.158) [-2121.011] (-2119.186) (-2125.423) * (-2121.232) (-2122.197) (-2124.445) [-2120.236] -- 0:00:43 383000 -- [-2121.937] (-2122.574) (-2120.048) (-2121.161) * [-2124.912] (-2126.338) (-2123.935) (-2120.143) -- 0:00:43 383500 -- [-2122.410] (-2119.638) (-2120.032) (-2120.724) * (-2127.635) (-2122.961) (-2121.549) [-2120.287] -- 0:00:43 384000 -- (-2122.565) [-2119.824] (-2120.440) (-2122.087) * (-2125.915) [-2123.649] (-2119.966) (-2119.957) -- 0:00:43 384500 -- [-2120.077] (-2121.873) (-2123.192) (-2121.931) * (-2123.249) (-2122.370) [-2119.595] (-2120.018) -- 0:00:43 385000 -- (-2122.169) [-2120.727] (-2119.789) (-2121.913) * [-2123.638] (-2124.052) (-2119.851) (-2120.291) -- 0:00:43 Average standard deviation of split frequencies: 0.011263 385500 -- (-2121.895) [-2122.016] (-2121.793) (-2120.790) * (-2124.566) [-2120.316] (-2120.924) (-2120.726) -- 0:00:43 386000 -- (-2121.584) [-2122.053] (-2119.971) (-2120.665) * (-2122.128) (-2120.248) (-2121.151) [-2120.344] -- 0:00:42 386500 -- (-2122.051) (-2120.810) [-2119.389] (-2120.988) * (-2122.812) (-2119.161) [-2121.105] (-2127.621) -- 0:00:42 387000 -- (-2121.024) (-2120.621) (-2119.396) [-2122.327] * (-2120.753) [-2120.240] (-2124.312) (-2119.713) -- 0:00:42 387500 -- (-2120.571) (-2124.586) [-2119.525] (-2120.872) * (-2121.762) (-2119.749) (-2124.877) [-2119.713] -- 0:00:42 388000 -- (-2120.935) [-2125.865] (-2119.992) (-2122.303) * (-2122.382) [-2120.066] (-2122.218) (-2119.577) -- 0:00:42 388500 -- [-2124.868] (-2123.374) (-2122.772) (-2121.480) * (-2122.382) (-2122.606) [-2122.597] (-2120.312) -- 0:00:42 389000 -- [-2120.550] (-2120.116) (-2124.027) (-2121.828) * (-2125.691) (-2119.845) (-2120.467) [-2123.887] -- 0:00:42 389500 -- (-2120.107) (-2121.960) [-2122.077] (-2121.828) * [-2121.919] (-2122.758) (-2120.699) (-2125.512) -- 0:00:42 390000 -- (-2119.946) (-2121.305) (-2120.429) [-2120.626] * (-2121.984) (-2119.772) [-2123.971] (-2126.383) -- 0:00:42 Average standard deviation of split frequencies: 0.010434 390500 -- (-2119.572) (-2121.767) [-2119.920] (-2119.978) * (-2123.520) [-2119.475] (-2120.780) (-2121.341) -- 0:00:42 391000 -- (-2119.447) (-2119.461) [-2121.212] (-2119.824) * [-2125.037] (-2119.546) (-2120.406) (-2119.823) -- 0:00:42 391500 -- (-2119.613) [-2120.205] (-2121.966) (-2120.148) * (-2125.712) [-2121.029] (-2120.910) (-2124.460) -- 0:00:41 392000 -- (-2120.364) [-2120.844] (-2121.594) (-2120.715) * (-2122.436) (-2122.797) [-2123.227] (-2123.945) -- 0:00:41 392500 -- (-2120.505) (-2119.767) [-2123.432] (-2120.129) * (-2121.603) (-2120.311) [-2123.421] (-2123.450) -- 0:00:41 393000 -- [-2119.821] (-2119.858) (-2119.536) (-2122.422) * (-2126.546) [-2120.444] (-2120.573) (-2121.472) -- 0:00:43 393500 -- (-2120.666) [-2119.858] (-2123.213) (-2119.897) * [-2119.842] (-2122.481) (-2119.693) (-2120.545) -- 0:00:43 394000 -- (-2120.789) (-2121.120) (-2121.114) [-2118.893] * (-2120.138) (-2120.023) [-2119.710] (-2120.228) -- 0:00:43 394500 -- (-2119.339) (-2120.290) [-2121.769] (-2120.590) * (-2121.790) (-2121.632) [-2119.956] (-2121.983) -- 0:00:42 395000 -- [-2119.414] (-2120.481) (-2119.988) (-2121.605) * (-2121.454) (-2121.654) (-2123.744) [-2121.166] -- 0:00:42 Average standard deviation of split frequencies: 0.010013 395500 -- (-2120.113) (-2119.278) (-2122.675) [-2120.013] * (-2122.900) (-2121.910) (-2121.292) [-2121.224] -- 0:00:42 396000 -- (-2122.048) (-2122.941) (-2123.120) [-2121.812] * (-2121.321) [-2123.716] (-2120.493) (-2121.804) -- 0:00:42 396500 -- (-2121.076) (-2122.638) (-2121.517) [-2124.042] * (-2125.564) (-2119.886) (-2119.827) [-2120.626] -- 0:00:42 397000 -- (-2123.978) (-2121.947) [-2120.533] (-2121.942) * (-2120.655) (-2120.183) [-2121.213] (-2121.016) -- 0:00:42 397500 -- [-2120.882] (-2120.962) (-2122.063) (-2120.272) * (-2120.778) (-2122.409) (-2123.153) [-2121.416] -- 0:00:42 398000 -- (-2118.876) (-2119.748) (-2121.885) [-2119.805] * [-2119.865] (-2126.039) (-2119.337) (-2123.291) -- 0:00:42 398500 -- (-2118.981) [-2124.226] (-2124.913) (-2123.052) * (-2119.169) (-2122.962) [-2123.757] (-2122.244) -- 0:00:42 399000 -- (-2119.358) [-2121.096] (-2121.053) (-2120.431) * [-2119.041] (-2120.852) (-2123.442) (-2119.811) -- 0:00:42 399500 -- [-2119.730] (-2120.008) (-2120.057) (-2120.972) * (-2119.158) (-2122.240) (-2119.467) [-2119.413] -- 0:00:42 400000 -- (-2119.256) (-2120.349) (-2119.420) [-2123.178] * (-2119.308) [-2121.751] (-2121.545) (-2120.851) -- 0:00:41 Average standard deviation of split frequencies: 0.010243 400500 -- [-2119.963] (-2120.142) (-2119.915) (-2120.671) * (-2120.150) (-2122.286) (-2119.653) [-2121.601] -- 0:00:41 401000 -- (-2119.798) [-2120.405] (-2121.122) (-2123.862) * (-2119.395) (-2123.710) (-2121.752) [-2120.948] -- 0:00:41 401500 -- (-2119.162) (-2120.536) [-2122.651] (-2119.992) * [-2120.220] (-2120.851) (-2122.045) (-2121.030) -- 0:00:41 402000 -- (-2120.096) [-2122.751] (-2124.909) (-2121.456) * (-2119.907) [-2120.060] (-2120.167) (-2119.843) -- 0:00:41 402500 -- (-2128.055) [-2122.274] (-2123.012) (-2120.115) * (-2119.893) [-2120.206] (-2120.127) (-2122.717) -- 0:00:41 403000 -- (-2120.405) (-2122.819) (-2120.618) [-2121.894] * [-2118.854] (-2120.461) (-2120.583) (-2123.434) -- 0:00:41 403500 -- (-2120.386) [-2122.049] (-2121.836) (-2125.900) * (-2120.261) (-2122.973) (-2121.080) [-2123.259] -- 0:00:41 404000 -- (-2121.426) [-2121.856] (-2119.827) (-2125.988) * (-2121.865) (-2119.376) [-2121.075] (-2120.828) -- 0:00:41 404500 -- (-2119.598) (-2120.947) [-2123.071] (-2120.559) * (-2118.816) [-2122.039] (-2119.967) (-2123.538) -- 0:00:41 405000 -- [-2121.327] (-2119.341) (-2120.294) (-2121.070) * (-2125.818) (-2121.014) [-2119.244] (-2123.070) -- 0:00:41 Average standard deviation of split frequencies: 0.011869 405500 -- [-2121.251] (-2119.641) (-2121.939) (-2120.335) * (-2122.999) (-2121.927) [-2124.360] (-2121.105) -- 0:00:41 406000 -- [-2119.556] (-2119.246) (-2125.258) (-2120.654) * [-2125.268] (-2121.723) (-2119.523) (-2120.091) -- 0:00:40 406500 -- (-2119.806) (-2120.878) [-2120.442] (-2120.581) * [-2123.183] (-2126.159) (-2122.575) (-2120.233) -- 0:00:40 407000 -- [-2119.916] (-2120.053) (-2123.286) (-2118.723) * (-2122.159) [-2119.032] (-2122.221) (-2120.355) -- 0:00:42 407500 -- (-2122.431) (-2119.196) [-2122.970] (-2119.050) * (-2125.980) [-2120.902] (-2120.571) (-2121.061) -- 0:00:42 408000 -- (-2121.392) [-2119.514] (-2121.286) (-2119.773) * (-2124.542) (-2121.145) (-2120.802) [-2122.181] -- 0:00:42 408500 -- (-2120.389) [-2120.660] (-2120.051) (-2121.819) * [-2121.639] (-2119.414) (-2121.756) (-2120.186) -- 0:00:41 409000 -- (-2123.626) (-2123.142) [-2125.230] (-2119.530) * (-2119.245) (-2119.891) [-2124.582] (-2120.694) -- 0:00:41 409500 -- (-2120.314) [-2123.174] (-2120.851) (-2121.884) * (-2121.041) (-2120.166) (-2122.091) [-2123.601] -- 0:00:41 410000 -- [-2119.799] (-2120.971) (-2119.810) (-2122.918) * [-2120.488] (-2122.028) (-2121.767) (-2123.627) -- 0:00:41 Average standard deviation of split frequencies: 0.011798 410500 -- (-2119.956) (-2125.688) [-2120.011] (-2122.348) * [-2119.663] (-2124.241) (-2119.283) (-2129.020) -- 0:00:41 411000 -- (-2119.934) (-2127.665) (-2120.806) [-2122.384] * [-2122.072] (-2120.321) (-2119.593) (-2122.434) -- 0:00:41 411500 -- [-2119.837] (-2119.458) (-2119.513) (-2121.602) * (-2119.865) [-2120.472] (-2121.334) (-2121.993) -- 0:00:41 412000 -- [-2120.308] (-2119.868) (-2120.844) (-2121.284) * (-2119.456) (-2120.619) (-2121.090) [-2121.764] -- 0:00:41 412500 -- [-2119.354] (-2120.110) (-2120.749) (-2121.022) * [-2119.456] (-2119.275) (-2120.185) (-2121.743) -- 0:00:41 413000 -- (-2119.607) (-2119.481) [-2119.550] (-2124.946) * (-2122.607) [-2121.291] (-2122.244) (-2121.163) -- 0:00:41 413500 -- (-2121.221) [-2119.281] (-2119.550) (-2122.579) * (-2120.972) [-2120.090] (-2119.859) (-2121.754) -- 0:00:41 414000 -- (-2120.073) [-2119.253] (-2120.125) (-2119.049) * (-2121.078) [-2124.892] (-2121.115) (-2122.849) -- 0:00:41 414500 -- (-2120.214) [-2119.144] (-2122.704) (-2119.470) * (-2121.975) (-2120.987) [-2120.728] (-2126.530) -- 0:00:40 415000 -- [-2120.544] (-2119.193) (-2121.791) (-2119.806) * (-2122.836) (-2122.505) (-2121.747) [-2124.580] -- 0:00:40 Average standard deviation of split frequencies: 0.012024 415500 -- (-2121.633) (-2120.009) [-2120.516] (-2120.804) * (-2120.490) [-2123.636] (-2122.419) (-2121.456) -- 0:00:40 416000 -- (-2120.478) (-2120.021) (-2124.991) [-2120.741] * (-2122.111) (-2123.528) (-2119.812) [-2122.423] -- 0:00:40 416500 -- (-2121.435) (-2120.084) (-2119.401) [-2123.415] * (-2121.195) (-2122.524) [-2119.867] (-2123.672) -- 0:00:40 417000 -- (-2122.387) (-2120.387) (-2120.084) [-2122.868] * (-2119.980) (-2122.653) (-2118.958) [-2119.713] -- 0:00:40 417500 -- (-2119.973) (-2122.577) (-2119.606) [-2121.365] * (-2121.288) (-2122.006) [-2120.647] (-2119.751) -- 0:00:40 418000 -- (-2120.142) [-2121.588] (-2119.847) (-2121.372) * (-2121.626) [-2120.393] (-2122.220) (-2123.099) -- 0:00:40 418500 -- (-2119.583) [-2122.597] (-2120.295) (-2120.943) * [-2121.978] (-2120.170) (-2122.006) (-2120.536) -- 0:00:40 419000 -- (-2119.261) [-2120.911] (-2120.513) (-2121.717) * (-2124.866) (-2120.091) (-2125.819) [-2122.247] -- 0:00:40 419500 -- (-2120.726) (-2124.321) [-2119.642] (-2122.132) * (-2120.606) [-2119.727] (-2120.476) (-2123.798) -- 0:00:40 420000 -- (-2119.888) (-2120.837) [-2120.169] (-2121.940) * (-2121.830) (-2120.402) [-2121.424] (-2120.280) -- 0:00:40 Average standard deviation of split frequencies: 0.011829 420500 -- (-2119.822) (-2119.967) (-2120.052) [-2119.529] * (-2122.358) (-2121.939) [-2128.915] (-2120.050) -- 0:00:39 421000 -- (-2122.373) (-2120.126) (-2120.712) [-2119.315] * [-2121.226] (-2124.761) (-2120.032) (-2123.876) -- 0:00:39 421500 -- (-2120.237) (-2122.646) [-2123.833] (-2121.089) * [-2121.478] (-2120.640) (-2122.500) (-2119.155) -- 0:00:39 422000 -- (-2120.237) (-2120.620) (-2123.245) [-2121.185] * (-2120.114) [-2120.081] (-2120.006) (-2119.527) -- 0:00:41 422500 -- (-2119.079) [-2119.338] (-2121.247) (-2124.054) * [-2119.795] (-2120.720) (-2122.428) (-2120.842) -- 0:00:41 423000 -- [-2119.981] (-2120.866) (-2120.982) (-2122.753) * (-2119.795) (-2119.418) [-2121.954] (-2119.717) -- 0:00:40 423500 -- (-2120.033) [-2119.268] (-2123.751) (-2122.377) * [-2120.123] (-2119.358) (-2121.427) (-2120.216) -- 0:00:40 424000 -- [-2121.018] (-2119.268) (-2121.319) (-2122.155) * (-2120.442) [-2120.174] (-2122.667) (-2125.651) -- 0:00:40 424500 -- (-2121.339) (-2121.687) [-2119.990] (-2121.502) * [-2119.082] (-2123.329) (-2121.747) (-2120.178) -- 0:00:40 425000 -- (-2124.365) (-2121.295) (-2120.582) [-2121.070] * (-2121.165) (-2121.031) (-2122.014) [-2122.775] -- 0:00:40 Average standard deviation of split frequencies: 0.011988 425500 -- (-2124.354) (-2119.994) (-2119.485) [-2119.089] * (-2121.162) (-2121.580) (-2124.376) [-2122.246] -- 0:00:40 426000 -- (-2121.853) [-2120.138] (-2125.126) (-2118.803) * (-2121.271) [-2119.603] (-2124.739) (-2121.987) -- 0:00:40 426500 -- (-2120.594) (-2125.171) (-2125.134) [-2118.923] * (-2121.275) (-2119.569) (-2125.064) [-2120.412] -- 0:00:40 427000 -- [-2120.608] (-2121.351) (-2119.210) (-2121.070) * (-2119.736) (-2120.789) [-2120.342] (-2119.885) -- 0:00:40 427500 -- (-2121.086) (-2120.497) [-2120.478] (-2119.034) * [-2119.721] (-2123.383) (-2120.105) (-2119.805) -- 0:00:40 428000 -- (-2121.632) (-2122.321) [-2119.992] (-2120.568) * (-2120.845) [-2122.173] (-2119.082) (-2119.694) -- 0:00:40 428500 -- (-2122.651) (-2121.634) [-2119.504] (-2123.410) * (-2119.002) (-2121.376) [-2119.413] (-2119.739) -- 0:00:40 429000 -- [-2119.355] (-2121.568) (-2120.687) (-2123.568) * [-2119.218] (-2121.330) (-2119.863) (-2119.222) -- 0:00:39 429500 -- (-2121.126) [-2122.379] (-2122.297) (-2122.925) * (-2119.753) [-2119.159] (-2120.943) (-2119.822) -- 0:00:39 430000 -- (-2122.358) (-2122.137) (-2125.029) [-2119.534] * (-2119.066) [-2119.258] (-2120.561) (-2119.666) -- 0:00:39 Average standard deviation of split frequencies: 0.011250 430500 -- (-2124.161) (-2123.500) [-2124.177] (-2120.758) * (-2121.588) [-2119.770] (-2120.991) (-2125.388) -- 0:00:39 431000 -- (-2124.159) [-2119.107] (-2121.531) (-2125.056) * (-2119.561) (-2119.823) [-2121.679] (-2120.147) -- 0:00:39 431500 -- (-2119.708) [-2120.984] (-2122.088) (-2123.873) * (-2119.177) (-2119.541) (-2121.820) [-2120.244] -- 0:00:39 432000 -- [-2122.180] (-2126.815) (-2122.455) (-2124.890) * (-2119.002) (-2120.647) (-2119.625) [-2119.409] -- 0:00:39 432500 -- [-2120.400] (-2120.769) (-2119.702) (-2119.341) * (-2119.880) (-2123.468) [-2122.686] (-2123.907) -- 0:00:39 433000 -- (-2121.027) (-2125.465) [-2121.419] (-2119.310) * (-2119.872) [-2122.379] (-2120.552) (-2119.306) -- 0:00:39 433500 -- [-2119.148] (-2121.422) (-2121.720) (-2124.359) * (-2121.545) [-2125.282] (-2125.094) (-2119.883) -- 0:00:39 434000 -- (-2118.785) [-2121.809] (-2119.438) (-2120.702) * (-2120.994) (-2123.056) [-2122.140] (-2121.112) -- 0:00:39 434500 -- (-2118.651) (-2122.307) [-2120.143] (-2121.371) * (-2121.365) (-2123.098) (-2122.064) [-2122.501] -- 0:00:39 435000 -- (-2118.928) [-2121.452] (-2125.615) (-2122.576) * (-2120.366) (-2120.192) [-2118.844] (-2122.089) -- 0:00:38 Average standard deviation of split frequencies: 0.011593 435500 -- (-2119.809) (-2122.723) [-2125.068] (-2119.438) * (-2120.805) (-2122.313) (-2120.553) [-2123.821] -- 0:00:38 436000 -- (-2119.809) [-2121.794] (-2123.730) (-2120.461) * [-2123.213] (-2120.808) (-2121.359) (-2125.305) -- 0:00:38 436500 -- (-2119.853) [-2119.115] (-2121.141) (-2118.985) * (-2121.245) (-2121.375) (-2120.388) [-2124.084] -- 0:00:38 437000 -- (-2120.038) (-2119.009) (-2122.125) [-2119.007] * (-2122.728) (-2119.304) (-2121.470) [-2124.572] -- 0:00:39 437500 -- (-2122.276) [-2121.899] (-2121.696) (-2124.463) * (-2122.099) (-2120.133) [-2118.988] (-2122.529) -- 0:00:39 438000 -- [-2121.389] (-2121.507) (-2122.547) (-2126.053) * (-2123.422) (-2119.795) (-2119.298) [-2120.721] -- 0:00:39 438500 -- (-2123.008) (-2121.835) [-2120.272] (-2123.295) * (-2123.644) (-2118.840) (-2120.646) [-2120.665] -- 0:00:39 439000 -- [-2121.656] (-2121.349) (-2119.929) (-2123.191) * (-2123.412) (-2119.846) [-2120.081] (-2120.104) -- 0:00:39 439500 -- (-2120.831) (-2120.804) [-2118.966] (-2122.173) * (-2122.819) (-2120.434) (-2120.069) [-2119.674] -- 0:00:39 440000 -- (-2121.990) (-2121.748) (-2120.795) [-2119.467] * (-2123.179) (-2120.583) (-2119.292) [-2120.701] -- 0:00:39 Average standard deviation of split frequencies: 0.011411 440500 -- (-2121.788) [-2119.807] (-2125.190) (-2120.659) * [-2123.386] (-2119.954) (-2120.895) (-2120.633) -- 0:00:39 441000 -- (-2120.325) (-2122.819) (-2121.215) [-2120.226] * (-2122.725) (-2119.956) (-2124.881) [-2120.838] -- 0:00:39 441500 -- (-2121.105) (-2123.114) [-2120.218] (-2121.394) * (-2121.002) (-2119.995) (-2119.734) [-2118.883] -- 0:00:39 442000 -- (-2121.292) (-2121.304) [-2123.208] (-2123.439) * (-2119.741) (-2120.829) [-2120.731] (-2118.871) -- 0:00:39 442500 -- (-2123.540) [-2121.307] (-2124.658) (-2124.178) * [-2119.695] (-2119.543) (-2125.002) (-2119.474) -- 0:00:39 443000 -- (-2120.062) [-2119.604] (-2121.354) (-2122.513) * [-2119.734] (-2119.539) (-2123.047) (-2119.920) -- 0:00:38 443500 -- (-2122.187) (-2121.209) [-2128.290] (-2121.527) * (-2119.759) [-2122.860] (-2122.167) (-2121.361) -- 0:00:38 444000 -- (-2120.999) (-2120.300) (-2126.948) [-2122.191] * (-2120.165) (-2120.172) (-2122.055) [-2122.693] -- 0:00:38 444500 -- (-2119.883) (-2120.827) (-2120.197) [-2121.876] * (-2120.474) (-2120.618) [-2121.829] (-2128.305) -- 0:00:38 445000 -- (-2119.804) (-2122.235) (-2123.558) [-2120.461] * [-2122.027] (-2120.805) (-2121.767) (-2122.487) -- 0:00:38 Average standard deviation of split frequencies: 0.011333 445500 -- (-2119.364) (-2121.674) [-2122.560] (-2121.973) * (-2121.864) [-2124.000] (-2122.911) (-2122.485) -- 0:00:38 446000 -- (-2119.689) [-2119.279] (-2121.090) (-2119.727) * (-2124.849) (-2123.007) [-2121.696] (-2122.009) -- 0:00:38 446500 -- [-2120.771] (-2120.424) (-2122.190) (-2123.383) * (-2121.354) [-2120.239] (-2121.685) (-2125.147) -- 0:00:38 447000 -- (-2121.628) [-2120.779] (-2121.209) (-2120.120) * [-2120.596] (-2120.435) (-2124.599) (-2122.111) -- 0:00:38 447500 -- (-2122.864) (-2121.928) (-2121.284) [-2121.551] * (-2124.403) [-2122.703] (-2122.845) (-2120.578) -- 0:00:38 448000 -- (-2120.290) (-2119.650) (-2122.641) [-2119.871] * (-2121.682) (-2121.143) [-2121.543] (-2119.904) -- 0:00:38 448500 -- [-2120.164] (-2123.201) (-2124.298) (-2121.857) * (-2120.637) (-2119.954) [-2123.098] (-2120.012) -- 0:00:38 449000 -- (-2120.137) [-2121.072] (-2120.486) (-2124.843) * (-2122.211) (-2121.763) (-2119.610) [-2121.929] -- 0:00:38 449500 -- (-2123.873) (-2121.083) [-2119.456] (-2125.326) * (-2119.877) [-2120.917] (-2121.539) (-2124.960) -- 0:00:37 450000 -- (-2124.447) (-2124.280) [-2119.023] (-2121.427) * (-2120.830) [-2122.594] (-2121.359) (-2122.603) -- 0:00:37 Average standard deviation of split frequencies: 0.011855 450500 -- (-2121.115) (-2121.331) (-2119.671) [-2121.580] * (-2124.521) (-2122.107) (-2119.418) [-2121.960] -- 0:00:37 451000 -- (-2125.649) [-2119.578] (-2120.139) (-2122.832) * (-2122.326) [-2121.010] (-2119.537) (-2120.705) -- 0:00:37 451500 -- (-2121.834) (-2121.208) [-2120.236] (-2122.089) * (-2120.569) (-2125.557) (-2119.579) [-2122.027] -- 0:00:37 452000 -- (-2119.240) (-2123.493) [-2119.731] (-2119.899) * (-2122.187) (-2119.920) [-2120.819] (-2121.298) -- 0:00:38 452500 -- (-2119.238) (-2125.137) [-2120.885] (-2119.419) * (-2122.359) [-2119.767] (-2120.789) (-2121.880) -- 0:00:38 453000 -- (-2118.913) (-2122.165) [-2121.931] (-2120.937) * (-2121.959) (-2119.144) [-2121.787] (-2122.848) -- 0:00:38 453500 -- (-2119.034) (-2121.652) [-2125.940] (-2122.445) * [-2124.065] (-2119.194) (-2121.128) (-2120.313) -- 0:00:38 454000 -- (-2120.921) [-2122.255] (-2123.060) (-2121.683) * (-2120.921) [-2118.990] (-2121.079) (-2120.150) -- 0:00:38 454500 -- (-2124.235) (-2121.188) (-2126.384) [-2119.421] * (-2124.994) (-2119.724) [-2119.350] (-2122.521) -- 0:00:38 455000 -- (-2120.918) (-2121.512) (-2119.924) [-2119.394] * (-2123.177) (-2121.503) (-2119.874) [-2122.583] -- 0:00:38 Average standard deviation of split frequencies: 0.012233 455500 -- (-2119.470) (-2122.296) (-2120.083) [-2119.703] * (-2122.333) (-2119.728) (-2122.335) [-2122.434] -- 0:00:38 456000 -- (-2122.777) [-2119.305] (-2120.189) (-2120.384) * (-2125.284) (-2120.420) (-2124.469) [-2121.257] -- 0:00:38 456500 -- (-2119.830) [-2119.662] (-2122.216) (-2119.543) * [-2121.455] (-2119.292) (-2123.197) (-2121.241) -- 0:00:38 457000 -- (-2120.213) (-2122.717) (-2120.632) [-2120.464] * [-2119.140] (-2119.070) (-2124.288) (-2122.077) -- 0:00:38 457500 -- (-2119.685) (-2121.601) [-2121.930] (-2121.173) * (-2125.520) [-2120.428] (-2122.934) (-2121.992) -- 0:00:37 458000 -- (-2121.889) (-2120.461) [-2121.061] (-2120.350) * [-2119.609] (-2119.790) (-2122.581) (-2122.174) -- 0:00:37 458500 -- (-2120.373) [-2121.275] (-2119.986) (-2124.532) * (-2121.299) [-2122.885] (-2120.418) (-2121.800) -- 0:00:37 459000 -- (-2121.464) [-2120.840] (-2120.280) (-2121.132) * (-2119.995) [-2125.581] (-2123.226) (-2120.702) -- 0:00:37 459500 -- (-2121.585) (-2122.830) [-2119.904] (-2124.434) * (-2120.762) (-2122.155) [-2119.761] (-2121.576) -- 0:00:37 460000 -- [-2121.474] (-2121.823) (-2120.387) (-2122.086) * (-2121.093) (-2120.711) (-2118.902) [-2119.202] -- 0:00:37 Average standard deviation of split frequencies: 0.012450 460500 -- (-2121.954) (-2119.050) [-2123.480] (-2119.334) * (-2123.349) [-2119.426] (-2121.588) (-2121.060) -- 0:00:37 461000 -- (-2122.760) [-2121.458] (-2120.940) (-2120.074) * (-2123.007) (-2119.116) [-2120.946] (-2120.687) -- 0:00:37 461500 -- (-2120.674) (-2120.389) [-2121.407] (-2121.683) * (-2123.012) (-2118.904) [-2120.738] (-2122.327) -- 0:00:37 462000 -- [-2119.401] (-2121.002) (-2123.007) (-2120.068) * (-2121.391) (-2121.558) (-2122.775) [-2122.593] -- 0:00:37 462500 -- [-2120.346] (-2122.485) (-2124.144) (-2120.355) * (-2122.504) [-2122.032] (-2120.517) (-2120.265) -- 0:00:37 463000 -- [-2120.843] (-2121.729) (-2119.841) (-2124.032) * (-2124.007) [-2119.349] (-2119.482) (-2119.369) -- 0:00:37 463500 -- (-2120.814) [-2121.090] (-2119.351) (-2120.407) * (-2123.888) [-2121.569] (-2121.797) (-2122.047) -- 0:00:37 464000 -- [-2120.878] (-2121.789) (-2120.479) (-2122.461) * (-2123.166) [-2119.336] (-2120.794) (-2122.279) -- 0:00:36 464500 -- (-2121.627) (-2123.379) [-2120.061] (-2119.660) * (-2121.863) (-2120.214) (-2120.389) [-2120.996] -- 0:00:36 465000 -- (-2119.276) [-2121.527] (-2120.318) (-2119.745) * (-2121.544) (-2118.956) (-2121.135) [-2121.368] -- 0:00:36 Average standard deviation of split frequencies: 0.012672 465500 -- (-2120.356) (-2123.020) [-2119.618] (-2123.786) * (-2121.499) [-2119.193] (-2120.902) (-2121.378) -- 0:00:36 466000 -- [-2120.565] (-2121.343) (-2119.618) (-2122.591) * [-2121.895] (-2122.047) (-2121.128) (-2122.008) -- 0:00:36 466500 -- (-2119.935) (-2123.110) (-2124.454) [-2123.321] * (-2120.244) (-2122.163) (-2120.442) [-2122.328] -- 0:00:36 467000 -- (-2119.326) [-2121.407] (-2122.050) (-2122.189) * (-2120.805) (-2121.092) (-2120.894) [-2123.595] -- 0:00:37 467500 -- (-2122.638) (-2121.011) (-2120.807) [-2122.542] * (-2121.001) [-2121.092] (-2121.963) (-2120.279) -- 0:00:37 468000 -- [-2123.155] (-2122.151) (-2120.747) (-2121.724) * (-2120.402) (-2122.339) [-2120.189] (-2120.400) -- 0:00:37 468500 -- (-2119.900) [-2120.070] (-2119.794) (-2122.355) * [-2119.896] (-2121.596) (-2120.257) (-2120.174) -- 0:00:37 469000 -- (-2119.683) (-2121.772) (-2121.965) [-2120.611] * (-2121.780) (-2121.941) (-2121.375) [-2121.161] -- 0:00:37 469500 -- (-2122.570) [-2120.795] (-2124.982) (-2119.882) * (-2121.997) [-2120.663] (-2121.365) (-2121.249) -- 0:00:37 470000 -- (-2122.640) (-2120.335) (-2122.404) [-2119.643] * (-2120.326) (-2120.306) (-2125.163) [-2121.248] -- 0:00:37 Average standard deviation of split frequencies: 0.012177 470500 -- (-2119.933) (-2119.933) [-2121.780] (-2120.627) * (-2121.971) (-2121.914) (-2123.026) [-2122.412] -- 0:00:37 471000 -- [-2120.459] (-2119.513) (-2123.128) (-2120.185) * (-2121.801) [-2120.347] (-2123.947) (-2123.677) -- 0:00:37 471500 -- [-2121.304] (-2121.232) (-2123.357) (-2120.180) * (-2120.638) (-2120.313) (-2123.944) [-2124.157] -- 0:00:36 472000 -- (-2121.919) [-2121.063] (-2121.497) (-2122.355) * [-2119.659] (-2121.383) (-2125.658) (-2123.910) -- 0:00:36 472500 -- (-2119.602) [-2120.900] (-2121.642) (-2121.507) * (-2123.166) [-2120.438] (-2121.513) (-2120.491) -- 0:00:36 473000 -- (-2119.711) (-2123.561) [-2123.365] (-2120.631) * (-2121.473) [-2121.848] (-2122.462) (-2120.480) -- 0:00:36 473500 -- (-2120.156) [-2119.985] (-2121.681) (-2120.096) * (-2122.786) (-2122.683) [-2119.379] (-2126.634) -- 0:00:36 474000 -- (-2119.909) (-2120.992) (-2121.768) [-2119.841] * [-2121.339] (-2122.296) (-2121.259) (-2122.436) -- 0:00:36 474500 -- (-2120.470) (-2120.320) [-2124.253] (-2121.856) * (-2126.186) (-2121.057) [-2121.828] (-2120.192) -- 0:00:36 475000 -- (-2120.341) (-2119.958) [-2119.934] (-2120.440) * (-2120.649) [-2119.437] (-2121.715) (-2121.310) -- 0:00:36 Average standard deviation of split frequencies: 0.012104 475500 -- (-2120.122) [-2119.536] (-2119.518) (-2121.629) * (-2119.337) (-2123.675) [-2120.054] (-2123.777) -- 0:00:36 476000 -- (-2119.929) (-2120.286) [-2119.514] (-2120.440) * (-2119.252) (-2120.875) [-2119.538] (-2123.825) -- 0:00:36 476500 -- (-2122.402) (-2123.385) [-2119.119] (-2120.639) * [-2120.812] (-2119.300) (-2123.013) (-2122.705) -- 0:00:36 477000 -- [-2124.181] (-2121.110) (-2120.964) (-2127.894) * (-2122.869) (-2120.470) (-2119.881) [-2122.231] -- 0:00:36 477500 -- (-2119.983) [-2120.114] (-2120.964) (-2123.822) * (-2122.493) [-2120.161] (-2120.798) (-2124.983) -- 0:00:36 478000 -- (-2121.057) [-2120.799] (-2124.029) (-2123.762) * (-2119.948) (-2120.951) (-2122.172) [-2119.684] -- 0:00:36 478500 -- (-2120.552) (-2120.941) [-2119.734] (-2120.593) * (-2119.864) (-2120.469) [-2125.894] (-2118.981) -- 0:00:35 479000 -- (-2124.783) (-2120.593) [-2122.903] (-2122.408) * (-2120.759) [-2119.986] (-2120.601) (-2118.947) -- 0:00:35 479500 -- (-2124.795) (-2126.961) (-2125.425) [-2121.934] * [-2122.417] (-2120.549) (-2120.240) (-2123.497) -- 0:00:35 480000 -- (-2121.256) (-2124.352) [-2126.030] (-2122.201) * [-2125.541] (-2120.118) (-2125.237) (-2123.989) -- 0:00:35 Average standard deviation of split frequencies: 0.012695 480500 -- [-2121.333] (-2119.289) (-2122.856) (-2121.551) * (-2122.269) (-2120.214) [-2124.296] (-2120.940) -- 0:00:35 481000 -- (-2121.123) [-2119.849] (-2126.052) (-2120.201) * (-2125.814) (-2120.516) [-2122.110] (-2122.235) -- 0:00:35 481500 -- (-2120.297) [-2120.186] (-2120.651) (-2120.714) * [-2126.789] (-2123.105) (-2122.067) (-2120.865) -- 0:00:35 482000 -- (-2123.035) (-2121.654) (-2122.596) [-2119.463] * (-2124.022) (-2119.438) [-2122.415] (-2121.512) -- 0:00:36 482500 -- [-2122.852] (-2120.399) (-2122.318) (-2119.676) * (-2120.616) (-2119.228) [-2120.923] (-2120.258) -- 0:00:36 483000 -- (-2125.616) (-2120.887) [-2124.859] (-2120.109) * (-2122.954) [-2119.865] (-2123.884) (-2119.697) -- 0:00:36 483500 -- (-2125.463) (-2119.192) [-2122.847] (-2119.537) * [-2122.069] (-2120.497) (-2121.597) (-2120.638) -- 0:00:36 484000 -- (-2123.292) (-2119.587) [-2123.541] (-2119.692) * (-2125.597) (-2120.857) (-2123.587) [-2121.759] -- 0:00:36 484500 -- (-2120.584) (-2125.000) (-2124.702) [-2119.775] * (-2124.394) [-2120.710] (-2125.393) (-2125.640) -- 0:00:36 485000 -- [-2124.986] (-2122.266) (-2124.078) (-2123.479) * [-2122.445] (-2120.712) (-2126.002) (-2121.195) -- 0:00:36 Average standard deviation of split frequencies: 0.012663 485500 -- (-2121.202) (-2124.436) (-2123.242) [-2121.919] * (-2123.333) [-2121.616] (-2126.570) (-2119.973) -- 0:00:36 486000 -- [-2121.877] (-2121.815) (-2121.391) (-2119.975) * (-2121.523) (-2124.876) (-2123.111) [-2120.378] -- 0:00:35 486500 -- (-2126.906) [-2120.309] (-2120.108) (-2120.081) * (-2124.217) (-2121.594) [-2123.430] (-2120.385) -- 0:00:35 487000 -- [-2120.551] (-2121.477) (-2119.566) (-2121.668) * [-2123.696] (-2120.510) (-2125.463) (-2121.550) -- 0:00:35 487500 -- [-2122.548] (-2123.578) (-2121.250) (-2128.281) * (-2121.366) [-2119.539] (-2124.879) (-2123.531) -- 0:00:35 488000 -- (-2119.781) (-2122.451) (-2121.588) [-2120.039] * (-2120.745) [-2119.529] (-2121.233) (-2120.001) -- 0:00:35 488500 -- (-2120.730) [-2121.272] (-2120.270) (-2119.857) * (-2124.591) (-2119.604) [-2122.006] (-2122.152) -- 0:00:35 489000 -- (-2125.344) (-2122.158) [-2120.470] (-2121.623) * (-2120.294) (-2119.251) (-2125.859) [-2120.244] -- 0:00:35 489500 -- (-2123.981) (-2122.895) [-2119.825] (-2121.419) * [-2122.565] (-2119.423) (-2123.831) (-2119.050) -- 0:00:35 490000 -- (-2122.036) [-2122.518] (-2120.839) (-2123.306) * [-2123.047] (-2121.389) (-2122.556) (-2122.795) -- 0:00:35 Average standard deviation of split frequencies: 0.012169 490500 -- (-2121.599) (-2120.857) (-2120.838) [-2121.001] * (-2120.996) (-2120.832) [-2120.975] (-2122.011) -- 0:00:35 491000 -- (-2122.038) [-2121.543] (-2120.838) (-2119.858) * [-2120.500] (-2120.670) (-2119.762) (-2122.773) -- 0:00:35 491500 -- [-2122.653] (-2120.342) (-2120.125) (-2119.911) * (-2120.985) (-2122.621) [-2123.266] (-2123.933) -- 0:00:35 492000 -- (-2121.506) [-2121.524] (-2122.330) (-2122.868) * (-2125.051) (-2121.791) [-2125.474] (-2121.170) -- 0:00:35 492500 -- (-2120.915) (-2120.946) [-2123.359] (-2122.069) * (-2126.028) (-2121.924) (-2126.208) [-2121.471] -- 0:00:35 493000 -- [-2119.816] (-2120.977) (-2125.830) (-2120.008) * [-2123.324] (-2122.456) (-2120.075) (-2121.460) -- 0:00:34 493500 -- [-2120.765] (-2121.674) (-2122.053) (-2121.288) * (-2119.736) [-2121.756] (-2120.557) (-2123.257) -- 0:00:34 494000 -- (-2120.860) (-2119.377) [-2119.184] (-2119.309) * [-2119.963] (-2122.473) (-2122.833) (-2123.713) -- 0:00:34 494500 -- (-2122.505) [-2121.864] (-2123.443) (-2119.427) * [-2120.002] (-2121.087) (-2120.023) (-2120.324) -- 0:00:34 495000 -- (-2119.500) [-2121.526] (-2120.238) (-2119.953) * (-2120.231) (-2121.341) (-2122.666) [-2121.310] -- 0:00:34 Average standard deviation of split frequencies: 0.011933 495500 -- (-2120.189) (-2120.558) (-2119.878) [-2121.409] * (-2119.483) (-2120.841) (-2122.659) [-2121.162] -- 0:00:34 496000 -- (-2120.189) [-2122.269] (-2119.376) (-2121.057) * (-2119.284) [-2122.256] (-2121.044) (-2122.940) -- 0:00:34 496500 -- (-2119.943) [-2122.028] (-2119.369) (-2123.088) * (-2121.440) (-2119.653) [-2122.165] (-2122.791) -- 0:00:34 497000 -- (-2119.883) [-2120.491] (-2125.240) (-2120.211) * (-2119.898) (-2122.543) [-2125.164] (-2124.358) -- 0:00:35 497500 -- (-2122.947) (-2121.093) (-2123.882) [-2121.907] * (-2118.965) (-2120.339) (-2125.707) [-2122.092] -- 0:00:35 498000 -- (-2119.143) [-2120.389] (-2123.298) (-2119.698) * [-2119.347] (-2126.617) (-2121.363) (-2125.342) -- 0:00:35 498500 -- (-2119.740) (-2120.698) (-2122.943) [-2119.563] * (-2121.276) (-2119.884) [-2121.919] (-2122.999) -- 0:00:35 499000 -- (-2120.564) [-2120.755] (-2121.403) (-2120.556) * (-2122.498) [-2119.884] (-2122.899) (-2119.887) -- 0:00:35 499500 -- (-2127.177) (-2123.896) [-2122.037] (-2119.226) * (-2123.683) [-2120.628] (-2122.257) (-2124.190) -- 0:00:35 500000 -- (-2121.616) [-2123.694] (-2120.308) (-2120.235) * (-2122.605) (-2119.047) [-2121.069] (-2122.988) -- 0:00:35 Average standard deviation of split frequencies: 0.010302 500500 -- [-2121.406] (-2119.888) (-2122.213) (-2118.728) * (-2123.300) (-2123.266) [-2121.329] (-2119.963) -- 0:00:34 501000 -- (-2124.843) (-2119.890) (-2120.465) [-2120.625] * (-2120.875) [-2120.106] (-2120.247) (-2119.780) -- 0:00:34 501500 -- (-2121.848) [-2121.530] (-2120.391) (-2119.492) * (-2121.547) [-2120.106] (-2119.401) (-2119.840) -- 0:00:34 502000 -- (-2121.229) (-2119.542) [-2120.286] (-2119.325) * (-2120.155) (-2122.768) (-2121.795) [-2120.480] -- 0:00:34 502500 -- (-2119.512) [-2120.832] (-2120.338) (-2119.886) * (-2122.359) (-2121.107) [-2121.975] (-2120.771) -- 0:00:34 503000 -- [-2120.076] (-2123.119) (-2121.621) (-2121.352) * (-2123.840) (-2120.203) (-2121.346) [-2121.916] -- 0:00:34 503500 -- (-2122.976) (-2123.092) [-2120.520] (-2120.624) * (-2124.313) (-2120.069) (-2124.445) [-2119.214] -- 0:00:34 504000 -- [-2121.709] (-2125.597) (-2121.500) (-2121.203) * (-2120.499) (-2120.580) [-2121.567] (-2119.480) -- 0:00:34 504500 -- [-2122.054] (-2124.860) (-2120.845) (-2121.825) * (-2120.022) (-2121.212) (-2119.361) [-2122.318] -- 0:00:34 505000 -- (-2123.767) (-2125.230) (-2122.109) [-2120.826] * (-2121.422) (-2120.471) [-2119.579] (-2120.464) -- 0:00:34 Average standard deviation of split frequencies: 0.011490 505500 -- [-2124.322] (-2121.790) (-2119.515) (-2120.980) * (-2120.158) (-2122.515) (-2121.259) [-2121.155] -- 0:00:34 506000 -- (-2119.859) (-2120.462) (-2119.733) [-2122.961] * [-2120.769] (-2120.622) (-2119.571) (-2119.786) -- 0:00:34 506500 -- (-2119.640) (-2121.191) (-2123.053) [-2119.787] * [-2120.732] (-2123.617) (-2120.766) (-2119.786) -- 0:00:34 507000 -- (-2120.277) (-2120.699) [-2118.802] (-2121.833) * (-2120.605) (-2122.088) (-2121.357) [-2120.404] -- 0:00:34 507500 -- [-2119.767] (-2120.157) (-2125.062) (-2119.535) * (-2123.877) [-2121.578] (-2120.720) (-2120.203) -- 0:00:33 508000 -- (-2125.907) (-2121.008) [-2120.378] (-2119.833) * (-2123.646) (-2123.500) (-2118.898) [-2121.765] -- 0:00:33 508500 -- (-2119.901) (-2122.131) [-2119.592] (-2120.157) * (-2122.635) [-2122.429] (-2121.149) (-2121.676) -- 0:00:33 509000 -- (-2126.314) (-2119.286) [-2119.158] (-2120.059) * (-2123.384) (-2124.577) (-2121.476) [-2121.593] -- 0:00:33 509500 -- (-2121.004) (-2119.350) [-2119.142] (-2119.281) * (-2122.256) (-2125.300) (-2118.905) [-2120.594] -- 0:00:33 510000 -- (-2120.366) [-2119.180] (-2119.160) (-2119.774) * (-2121.560) (-2123.765) (-2121.446) [-2120.532] -- 0:00:33 Average standard deviation of split frequencies: 0.011892 510500 -- [-2119.347] (-2119.319) (-2120.417) (-2120.337) * (-2119.913) (-2126.570) [-2120.711] (-2122.336) -- 0:00:33 511000 -- (-2122.196) (-2120.500) (-2123.886) [-2120.017] * (-2123.829) [-2120.263] (-2120.666) (-2120.402) -- 0:00:33 511500 -- (-2125.426) (-2120.315) (-2123.772) [-2122.362] * (-2123.531) (-2123.430) (-2120.040) [-2120.090] -- 0:00:33 512000 -- [-2120.721] (-2120.315) (-2120.863) (-2120.956) * (-2120.801) (-2121.758) (-2121.854) [-2120.374] -- 0:00:33 512500 -- (-2122.501) [-2121.735] (-2122.989) (-2121.030) * (-2119.426) [-2119.500] (-2119.865) (-2121.719) -- 0:00:34 513000 -- (-2125.708) (-2126.042) [-2121.009] (-2123.182) * (-2119.869) (-2119.724) (-2119.548) [-2121.754] -- 0:00:34 513500 -- [-2122.394] (-2120.418) (-2120.091) (-2124.016) * (-2126.130) (-2120.691) [-2119.765] (-2121.392) -- 0:00:34 514000 -- (-2122.960) (-2120.723) (-2125.016) [-2122.366] * [-2124.854] (-2120.741) (-2120.271) (-2120.914) -- 0:00:34 514500 -- [-2121.926] (-2120.757) (-2119.963) (-2121.336) * (-2121.890) (-2122.829) [-2119.610] (-2119.877) -- 0:00:33 515000 -- (-2119.839) [-2119.723] (-2123.463) (-2121.208) * [-2120.484] (-2124.540) (-2120.660) (-2120.123) -- 0:00:33 Average standard deviation of split frequencies: 0.011876 515500 -- (-2122.576) [-2120.426] (-2122.469) (-2120.196) * (-2120.487) (-2125.495) (-2121.372) [-2121.237] -- 0:00:33 516000 -- (-2119.121) (-2120.519) [-2121.606] (-2118.749) * (-2120.113) (-2120.013) (-2121.709) [-2119.684] -- 0:00:33 516500 -- (-2120.153) (-2120.276) [-2122.078] (-2120.128) * (-2119.947) (-2122.845) [-2120.770] (-2124.742) -- 0:00:33 517000 -- [-2120.017] (-2124.133) (-2120.861) (-2124.346) * (-2120.945) (-2122.199) (-2120.848) [-2120.568] -- 0:00:33 517500 -- (-2120.046) (-2119.930) [-2123.253] (-2121.438) * (-2119.493) (-2121.516) (-2119.534) [-2121.097] -- 0:00:33 518000 -- (-2119.316) [-2118.862] (-2121.873) (-2119.895) * (-2124.414) [-2120.798] (-2122.655) (-2122.970) -- 0:00:33 518500 -- [-2121.450] (-2119.385) (-2123.141) (-2119.229) * (-2119.624) (-2125.564) (-2119.733) [-2125.387] -- 0:00:33 519000 -- (-2120.468) [-2119.777] (-2121.492) (-2121.514) * (-2119.107) [-2121.427] (-2119.860) (-2121.278) -- 0:00:33 519500 -- (-2122.083) [-2120.969] (-2122.483) (-2120.122) * [-2119.612] (-2120.944) (-2120.886) (-2119.743) -- 0:00:33 520000 -- (-2122.505) [-2119.942] (-2120.102) (-2121.137) * (-2121.314) [-2122.957] (-2120.175) (-2121.661) -- 0:00:33 Average standard deviation of split frequencies: 0.011204 520500 -- (-2125.031) [-2123.078] (-2119.642) (-2119.251) * [-2120.727] (-2121.838) (-2120.334) (-2121.331) -- 0:00:33 521000 -- (-2126.344) (-2125.906) (-2122.403) [-2120.884] * [-2121.438] (-2122.202) (-2123.019) (-2122.730) -- 0:00:33 521500 -- (-2119.238) (-2124.720) [-2121.730] (-2119.672) * [-2121.277] (-2119.850) (-2123.431) (-2122.173) -- 0:00:33 522000 -- (-2120.964) (-2123.186) (-2120.682) [-2119.877] * (-2121.277) (-2119.721) (-2120.609) [-2123.943] -- 0:00:32 522500 -- [-2121.601] (-2120.593) (-2124.821) (-2119.376) * (-2122.983) (-2122.838) (-2119.972) [-2126.027] -- 0:00:32 523000 -- [-2123.065] (-2120.885) (-2119.785) (-2119.396) * (-2120.634) (-2120.094) (-2123.900) [-2120.531] -- 0:00:32 523500 -- (-2128.653) (-2120.053) [-2119.314] (-2119.388) * (-2118.888) (-2121.359) (-2119.664) [-2120.512] -- 0:00:32 524000 -- (-2126.538) (-2119.702) (-2120.815) [-2120.948] * (-2120.674) [-2121.413] (-2119.618) (-2124.607) -- 0:00:32 524500 -- (-2121.276) [-2121.578] (-2124.362) (-2120.596) * (-2120.628) (-2119.627) (-2121.309) [-2122.184] -- 0:00:32 525000 -- (-2126.838) [-2120.184] (-2125.255) (-2118.842) * [-2118.704] (-2121.220) (-2119.869) (-2122.579) -- 0:00:32 Average standard deviation of split frequencies: 0.011176 525500 -- [-2121.360] (-2124.049) (-2123.379) (-2122.265) * (-2121.595) (-2120.758) [-2121.052] (-2124.433) -- 0:00:32 526000 -- (-2123.223) (-2123.509) (-2119.906) [-2120.387] * (-2124.003) (-2120.556) [-2122.440] (-2123.674) -- 0:00:32 526500 -- (-2121.392) [-2120.408] (-2120.385) (-2120.264) * (-2124.342) [-2118.969] (-2120.638) (-2126.615) -- 0:00:32 527000 -- (-2121.156) [-2120.407] (-2119.837) (-2121.449) * (-2125.147) (-2120.116) [-2121.997] (-2124.599) -- 0:00:32 527500 -- [-2122.510] (-2119.793) (-2119.494) (-2121.535) * (-2125.078) (-2120.461) [-2121.257] (-2121.897) -- 0:00:33 528000 -- [-2119.979] (-2119.432) (-2120.503) (-2121.534) * (-2119.879) (-2120.985) (-2121.867) [-2121.524] -- 0:00:33 528500 -- (-2120.835) [-2119.595] (-2119.769) (-2121.332) * (-2120.803) [-2121.349] (-2121.353) (-2120.674) -- 0:00:33 529000 -- [-2119.212] (-2119.992) (-2120.617) (-2121.666) * [-2125.210] (-2120.759) (-2122.034) (-2120.019) -- 0:00:32 529500 -- (-2120.084) (-2124.068) (-2119.534) [-2121.109] * [-2120.654] (-2122.010) (-2119.091) (-2120.112) -- 0:00:32 530000 -- [-2119.846] (-2124.294) (-2122.858) (-2121.174) * (-2124.463) [-2121.238] (-2119.030) (-2119.258) -- 0:00:32 Average standard deviation of split frequencies: 0.011992 530500 -- (-2118.957) [-2119.850] (-2121.637) (-2119.296) * (-2126.722) [-2119.684] (-2119.343) (-2121.777) -- 0:00:32 531000 -- (-2121.486) (-2123.738) (-2119.655) [-2119.571] * (-2120.558) (-2121.122) [-2118.828] (-2123.964) -- 0:00:32 531500 -- (-2120.442) (-2120.199) (-2120.325) [-2121.853] * (-2121.552) [-2122.818] (-2118.835) (-2119.575) -- 0:00:32 532000 -- (-2121.834) (-2125.142) [-2121.176] (-2122.105) * (-2119.794) (-2120.475) [-2122.197] (-2121.393) -- 0:00:32 532500 -- (-2119.940) (-2123.997) (-2121.053) [-2123.601] * (-2119.976) (-2120.059) (-2122.779) [-2123.367] -- 0:00:32 533000 -- (-2120.719) (-2124.304) (-2121.044) [-2119.100] * (-2120.654) [-2123.174] (-2123.087) (-2125.292) -- 0:00:32 533500 -- (-2120.654) (-2123.548) (-2124.215) [-2119.578] * (-2121.605) (-2120.381) [-2119.956] (-2124.333) -- 0:00:32 534000 -- [-2119.100] (-2122.665) (-2122.793) (-2120.795) * [-2119.222] (-2120.042) (-2119.408) (-2119.379) -- 0:00:32 534500 -- (-2120.221) [-2120.977] (-2126.844) (-2121.981) * (-2122.050) (-2124.260) (-2120.152) [-2120.996] -- 0:00:32 535000 -- (-2118.791) (-2121.526) (-2127.923) [-2119.612] * (-2120.904) (-2125.014) [-2121.610] (-2122.241) -- 0:00:32 Average standard deviation of split frequencies: 0.011818 535500 -- (-2120.744) [-2120.469] (-2128.265) (-2121.049) * (-2121.027) (-2122.489) (-2124.851) [-2120.750] -- 0:00:32 536000 -- (-2122.286) (-2119.286) (-2123.931) [-2120.392] * (-2120.520) (-2120.202) [-2124.133] (-2120.884) -- 0:00:32 536500 -- (-2123.335) [-2120.598] (-2123.607) (-2119.485) * (-2121.370) (-2121.011) [-2120.707] (-2121.135) -- 0:00:31 537000 -- (-2123.352) (-2120.899) [-2120.339] (-2120.908) * (-2121.158) [-2120.550] (-2123.065) (-2123.797) -- 0:00:31 537500 -- (-2125.460) (-2121.178) [-2119.647] (-2121.347) * (-2120.207) (-2120.438) [-2122.307] (-2123.242) -- 0:00:31 538000 -- [-2124.157] (-2120.347) (-2119.732) (-2120.729) * [-2121.709] (-2120.147) (-2120.186) (-2119.127) -- 0:00:31 538500 -- [-2119.973] (-2121.400) (-2119.558) (-2120.741) * (-2121.315) (-2121.340) (-2119.763) [-2119.516] -- 0:00:31 539000 -- [-2119.168] (-2122.361) (-2121.730) (-2120.620) * (-2120.370) (-2119.108) [-2120.861] (-2119.580) -- 0:00:31 539500 -- (-2120.354) (-2122.211) (-2120.392) [-2121.233] * (-2119.891) [-2119.223] (-2120.210) (-2119.589) -- 0:00:31 540000 -- (-2120.459) (-2119.426) (-2120.223) [-2119.824] * (-2119.838) (-2119.387) [-2121.582] (-2123.683) -- 0:00:31 Average standard deviation of split frequencies: 0.011171 540500 -- (-2121.305) (-2119.872) (-2124.354) [-2121.584] * (-2124.921) (-2119.415) [-2121.251] (-2122.639) -- 0:00:31 541000 -- (-2125.758) [-2119.037] (-2121.029) (-2120.694) * (-2126.065) [-2119.394] (-2120.455) (-2121.802) -- 0:00:31 541500 -- (-2121.175) [-2119.231] (-2120.860) (-2120.800) * (-2125.079) [-2120.717] (-2120.692) (-2123.976) -- 0:00:31 542000 -- (-2120.110) (-2123.218) [-2123.444] (-2122.846) * (-2124.709) (-2120.792) [-2122.344] (-2119.641) -- 0:00:31 542500 -- [-2119.824] (-2121.621) (-2123.022) (-2123.572) * (-2125.325) (-2122.338) [-2124.606] (-2119.619) -- 0:00:31 543000 -- (-2122.597) (-2122.442) [-2121.468] (-2122.444) * (-2122.256) [-2120.103] (-2122.903) (-2121.619) -- 0:00:31 543500 -- [-2121.470] (-2120.336) (-2121.949) (-2120.650) * (-2121.504) (-2120.571) (-2121.278) [-2122.605] -- 0:00:31 544000 -- (-2121.474) (-2119.567) (-2121.251) [-2125.333] * [-2120.348] (-2119.462) (-2121.247) (-2124.520) -- 0:00:31 544500 -- (-2123.360) (-2123.642) (-2119.635) [-2121.712] * (-2124.322) (-2118.957) [-2123.204] (-2124.943) -- 0:00:31 545000 -- (-2123.113) [-2122.750] (-2121.988) (-2121.495) * (-2121.943) (-2125.211) (-2124.527) [-2123.107] -- 0:00:31 Average standard deviation of split frequencies: 0.011116 545500 -- [-2121.013] (-2121.342) (-2120.825) (-2120.801) * (-2123.228) (-2121.108) [-2122.198] (-2122.085) -- 0:00:31 546000 -- [-2120.343] (-2123.097) (-2130.936) (-2122.021) * (-2121.745) (-2124.399) (-2119.784) [-2121.691] -- 0:00:31 546500 -- (-2124.244) [-2121.864] (-2122.760) (-2120.859) * [-2123.230] (-2119.237) (-2120.073) (-2125.048) -- 0:00:31 547000 -- (-2119.729) (-2119.011) (-2124.418) [-2119.380] * (-2121.481) (-2122.526) [-2121.115] (-2121.109) -- 0:00:31 547500 -- [-2119.998] (-2119.335) (-2122.629) (-2122.236) * (-2121.415) (-2119.745) [-2124.375] (-2121.699) -- 0:00:31 548000 -- (-2119.474) (-2121.102) [-2123.102] (-2121.714) * (-2120.242) [-2119.570] (-2123.469) (-2121.954) -- 0:00:31 548500 -- [-2121.378] (-2121.400) (-2121.363) (-2125.126) * (-2122.141) (-2123.347) (-2119.975) [-2122.293] -- 0:00:31 549000 -- [-2120.026] (-2122.293) (-2121.385) (-2127.186) * (-2119.754) (-2120.758) [-2120.180] (-2124.353) -- 0:00:31 549500 -- [-2121.885] (-2126.195) (-2122.879) (-2125.009) * (-2120.838) (-2124.587) [-2119.467] (-2122.396) -- 0:00:31 550000 -- [-2120.611] (-2122.560) (-2120.315) (-2122.671) * [-2123.600] (-2122.889) (-2119.304) (-2120.315) -- 0:00:31 Average standard deviation of split frequencies: 0.011557 550500 -- (-2123.002) (-2123.624) (-2120.966) [-2121.319] * (-2124.988) (-2122.012) (-2122.138) [-2119.016] -- 0:00:31 551000 -- (-2119.546) [-2120.777] (-2121.115) (-2120.807) * (-2124.250) [-2122.293] (-2121.351) (-2118.985) -- 0:00:30 551500 -- (-2121.132) (-2123.614) [-2119.735] (-2120.783) * (-2119.262) (-2120.847) (-2120.709) [-2119.163] -- 0:00:30 552000 -- [-2119.795] (-2121.459) (-2119.756) (-2121.834) * (-2120.457) (-2120.502) (-2124.092) [-2120.706] -- 0:00:30 552500 -- [-2119.054] (-2120.260) (-2121.244) (-2123.475) * (-2120.607) (-2119.831) (-2120.987) [-2121.945] -- 0:00:30 553000 -- [-2119.087] (-2120.994) (-2120.321) (-2121.058) * [-2120.638] (-2120.990) (-2122.632) (-2121.062) -- 0:00:30 553500 -- (-2119.072) (-2123.242) (-2119.039) [-2121.498] * (-2119.633) (-2119.836) (-2121.981) [-2119.837] -- 0:00:30 554000 -- (-2121.460) (-2123.802) [-2119.015] (-2123.263) * [-2123.969] (-2121.348) (-2119.270) (-2123.803) -- 0:00:30 554500 -- (-2120.979) (-2122.979) [-2119.766] (-2121.445) * (-2125.632) (-2121.868) [-2121.585] (-2122.432) -- 0:00:30 555000 -- (-2123.727) (-2122.552) [-2119.414] (-2122.730) * (-2124.685) [-2120.456] (-2121.844) (-2123.827) -- 0:00:30 Average standard deviation of split frequencies: 0.011393 555500 -- (-2122.662) (-2122.241) (-2121.171) [-2122.803] * (-2120.286) [-2121.891] (-2121.424) (-2122.166) -- 0:00:30 556000 -- [-2121.857] (-2121.805) (-2121.637) (-2121.980) * [-2122.894] (-2128.480) (-2122.243) (-2123.368) -- 0:00:30 556500 -- (-2121.435) [-2119.811] (-2119.667) (-2124.247) * [-2123.862] (-2121.102) (-2121.710) (-2122.656) -- 0:00:30 557000 -- [-2120.031] (-2123.957) (-2120.080) (-2121.162) * [-2120.837] (-2120.568) (-2121.640) (-2121.177) -- 0:00:31 557500 -- (-2120.054) (-2122.826) [-2120.517] (-2123.132) * (-2120.162) (-2119.868) (-2124.157) [-2119.789] -- 0:00:30 558000 -- (-2121.557) (-2124.848) [-2120.630] (-2122.857) * (-2124.236) (-2129.339) (-2125.831) [-2120.440] -- 0:00:30 558500 -- [-2123.970] (-2123.542) (-2119.495) (-2124.785) * (-2119.565) (-2120.818) (-2124.766) [-2121.186] -- 0:00:30 559000 -- [-2120.048] (-2121.385) (-2118.796) (-2122.266) * (-2120.664) [-2120.468] (-2125.985) (-2123.994) -- 0:00:30 559500 -- (-2120.304) (-2121.647) [-2127.114] (-2124.148) * (-2123.898) [-2121.739] (-2123.556) (-2121.561) -- 0:00:30 560000 -- [-2121.270] (-2120.849) (-2121.080) (-2119.442) * (-2121.402) (-2122.275) (-2125.324) [-2121.005] -- 0:00:30 Average standard deviation of split frequencies: 0.010878 560500 -- (-2119.285) [-2120.691] (-2119.982) (-2125.182) * [-2119.614] (-2122.429) (-2127.743) (-2121.109) -- 0:00:30 561000 -- (-2123.437) [-2120.465] (-2120.902) (-2120.029) * (-2121.389) (-2126.621) (-2121.838) [-2119.711] -- 0:00:30 561500 -- [-2120.476] (-2121.508) (-2121.517) (-2120.521) * (-2123.256) (-2119.791) [-2124.855] (-2121.305) -- 0:00:30 562000 -- (-2121.183) (-2120.800) (-2124.030) [-2119.714] * [-2120.334] (-2119.672) (-2121.825) (-2119.859) -- 0:00:30 562500 -- (-2121.020) (-2120.967) [-2120.386] (-2120.353) * (-2123.367) (-2122.343) (-2121.354) [-2120.834] -- 0:00:30 563000 -- (-2119.253) [-2122.045] (-2120.414) (-2120.353) * (-2120.225) (-2120.160) (-2121.035) [-2120.292] -- 0:00:30 563500 -- (-2121.035) (-2121.365) [-2120.034] (-2121.291) * (-2120.348) (-2120.033) (-2122.997) [-2120.904] -- 0:00:30 564000 -- (-2121.450) [-2122.078] (-2120.174) (-2120.038) * (-2120.149) (-2119.975) (-2125.169) [-2119.114] -- 0:00:30 564500 -- (-2119.879) (-2120.698) (-2120.666) [-2121.390] * (-2121.378) (-2120.293) [-2123.158] (-2119.155) -- 0:00:30 565000 -- (-2119.880) [-2120.518] (-2119.680) (-2121.363) * (-2121.724) (-2122.302) (-2124.706) [-2119.421] -- 0:00:30 Average standard deviation of split frequencies: 0.010775 565500 -- (-2122.157) (-2120.285) (-2120.066) [-2120.379] * (-2121.064) (-2122.576) [-2122.257] (-2120.656) -- 0:00:29 566000 -- (-2119.900) [-2122.825] (-2118.938) (-2119.675) * (-2122.359) (-2124.101) (-2120.445) [-2122.152] -- 0:00:29 566500 -- [-2122.757] (-2120.665) (-2120.766) (-2123.687) * (-2121.507) [-2119.017] (-2121.322) (-2120.052) -- 0:00:29 567000 -- (-2120.615) (-2120.702) (-2121.520) [-2121.782] * (-2120.410) (-2121.315) [-2120.817] (-2121.547) -- 0:00:29 567500 -- (-2121.322) (-2121.452) [-2121.284] (-2121.000) * (-2121.572) [-2119.073] (-2120.404) (-2119.902) -- 0:00:29 568000 -- (-2119.960) (-2121.305) [-2119.890] (-2119.810) * (-2123.301) (-2121.030) (-2123.746) [-2121.102] -- 0:00:29 568500 -- (-2119.807) (-2121.440) [-2123.422] (-2119.747) * [-2119.349] (-2128.119) (-2126.922) (-2120.233) -- 0:00:30 569000 -- (-2120.977) (-2119.995) (-2121.776) [-2119.829] * (-2119.359) (-2121.578) (-2123.343) [-2120.412] -- 0:00:30 569500 -- (-2121.099) (-2120.636) (-2124.564) [-2119.857] * [-2120.070] (-2119.879) (-2119.567) (-2120.786) -- 0:00:30 570000 -- (-2121.854) (-2122.852) (-2120.345) [-2119.097] * [-2119.345] (-2119.898) (-2121.752) (-2119.819) -- 0:00:30 Average standard deviation of split frequencies: 0.010945 570500 -- (-2122.475) [-2121.235] (-2122.631) (-2121.031) * [-2121.053] (-2119.713) (-2123.033) (-2119.674) -- 0:00:30 571000 -- (-2119.812) (-2122.103) (-2122.648) [-2124.605] * [-2119.608] (-2120.456) (-2120.016) (-2120.652) -- 0:00:30 571500 -- (-2124.453) (-2123.442) [-2121.812] (-2119.791) * (-2120.079) (-2127.340) [-2120.079] (-2121.563) -- 0:00:29 572000 -- (-2121.317) (-2120.081) (-2119.691) [-2121.482] * (-2120.426) (-2124.728) (-2119.841) [-2121.223] -- 0:00:29 572500 -- (-2120.228) [-2122.577] (-2125.501) (-2121.643) * (-2120.346) (-2125.943) (-2119.370) [-2122.196] -- 0:00:29 573000 -- (-2119.595) (-2119.314) (-2121.183) [-2119.902] * [-2120.327] (-2122.228) (-2122.889) (-2120.396) -- 0:00:29 573500 -- (-2119.081) (-2119.235) (-2123.479) [-2120.252] * (-2125.551) (-2119.513) (-2120.558) [-2118.859] -- 0:00:29 574000 -- (-2120.147) (-2119.996) [-2121.074] (-2120.849) * (-2121.473) [-2119.832] (-2124.399) (-2124.269) -- 0:00:29 574500 -- (-2119.730) [-2122.666] (-2123.429) (-2120.203) * (-2123.700) [-2119.877] (-2119.755) (-2119.780) -- 0:00:29 575000 -- (-2122.891) (-2120.563) (-2121.412) [-2120.967] * (-2121.992) [-2121.769] (-2121.022) (-2121.815) -- 0:00:29 Average standard deviation of split frequencies: 0.010793 575500 -- (-2122.476) [-2120.580] (-2120.044) (-2120.185) * [-2121.794] (-2121.770) (-2119.548) (-2123.137) -- 0:00:29 576000 -- [-2120.528] (-2121.023) (-2121.107) (-2122.013) * [-2121.572] (-2121.777) (-2119.649) (-2122.945) -- 0:00:29 576500 -- (-2120.478) [-2121.022] (-2121.033) (-2120.772) * (-2123.208) [-2121.325] (-2123.183) (-2125.643) -- 0:00:29 577000 -- (-2120.458) [-2121.022] (-2119.726) (-2120.356) * (-2120.914) (-2127.359) (-2120.030) [-2122.123] -- 0:00:29 577500 -- [-2119.658] (-2120.239) (-2121.931) (-2124.604) * (-2121.879) [-2121.920] (-2119.614) (-2122.985) -- 0:00:29 578000 -- [-2123.462] (-2119.964) (-2121.437) (-2121.608) * (-2121.710) [-2120.942] (-2120.029) (-2122.303) -- 0:00:29 578500 -- (-2121.049) (-2119.565) (-2119.702) [-2121.326] * (-2120.594) (-2122.858) [-2125.823] (-2124.404) -- 0:00:29 579000 -- [-2119.052] (-2120.113) (-2120.882) (-2120.940) * (-2120.542) (-2123.491) (-2122.964) [-2119.901] -- 0:00:29 579500 -- (-2119.407) [-2120.863] (-2121.388) (-2119.850) * [-2119.721] (-2121.861) (-2121.994) (-2120.088) -- 0:00:29 580000 -- (-2119.703) [-2120.379] (-2119.528) (-2121.074) * (-2122.010) (-2120.405) (-2123.151) [-2119.274] -- 0:00:28 Average standard deviation of split frequencies: 0.010300 580500 -- [-2119.367] (-2119.717) (-2119.511) (-2123.027) * (-2118.993) (-2122.405) [-2125.662] (-2121.157) -- 0:00:28 581000 -- [-2120.303] (-2122.254) (-2119.503) (-2119.804) * (-2121.927) [-2121.135] (-2123.723) (-2120.773) -- 0:00:28 581500 -- (-2124.020) (-2120.632) [-2121.475] (-2121.672) * (-2124.860) (-2120.912) [-2121.486] (-2126.095) -- 0:00:29 582000 -- (-2122.452) (-2120.781) [-2120.434] (-2120.503) * (-2121.765) [-2121.034] (-2119.512) (-2123.323) -- 0:00:29 582500 -- (-2121.821) [-2121.123] (-2122.301) (-2119.229) * (-2123.529) (-2120.332) (-2119.078) [-2119.233] -- 0:00:29 583000 -- (-2119.159) (-2120.517) (-2125.398) [-2120.258] * (-2120.302) (-2120.340) [-2119.743] (-2121.690) -- 0:00:29 583500 -- [-2119.736] (-2122.517) (-2122.166) (-2120.415) * (-2120.765) (-2120.842) [-2119.987] (-2120.965) -- 0:00:29 584000 -- [-2118.787] (-2121.945) (-2120.661) (-2122.936) * (-2120.188) (-2121.789) [-2121.682] (-2120.507) -- 0:00:29 584500 -- (-2119.717) (-2119.615) (-2120.145) [-2122.435] * (-2120.022) (-2121.244) (-2125.902) [-2121.741] -- 0:00:29 585000 -- [-2119.665] (-2121.191) (-2121.246) (-2119.953) * (-2120.113) (-2119.727) (-2121.693) [-2122.342] -- 0:00:29 Average standard deviation of split frequencies: 0.010005 585500 -- (-2123.041) (-2122.211) [-2121.513] (-2122.693) * (-2120.170) (-2120.430) [-2120.856] (-2121.311) -- 0:00:29 586000 -- [-2121.409] (-2120.807) (-2122.509) (-2119.616) * (-2121.055) (-2122.180) (-2120.277) [-2121.457] -- 0:00:28 586500 -- [-2123.327] (-2120.331) (-2123.138) (-2120.487) * (-2120.460) (-2119.427) [-2124.791] (-2119.911) -- 0:00:28 587000 -- (-2123.099) (-2121.373) [-2120.018] (-2119.105) * (-2119.288) (-2120.153) (-2122.874) [-2120.131] -- 0:00:28 587500 -- (-2123.401) (-2120.638) (-2122.340) [-2119.837] * (-2119.936) [-2124.560] (-2123.125) (-2119.767) -- 0:00:28 588000 -- (-2128.071) (-2121.546) (-2119.542) [-2122.332] * (-2119.052) (-2120.347) [-2121.404] (-2119.767) -- 0:00:28 588500 -- (-2123.001) (-2119.001) [-2120.627] (-2121.825) * (-2120.494) (-2119.162) (-2124.063) [-2121.054] -- 0:00:28 589000 -- (-2120.631) (-2119.766) (-2119.432) [-2121.129] * (-2119.528) [-2119.129] (-2120.936) (-2123.185) -- 0:00:28 589500 -- (-2118.708) [-2120.425] (-2122.557) (-2119.902) * (-2121.179) (-2120.657) [-2119.980] (-2121.048) -- 0:00:28 590000 -- (-2119.576) (-2119.812) (-2123.673) [-2121.986] * (-2119.339) (-2120.808) [-2119.507] (-2122.088) -- 0:00:28 Average standard deviation of split frequencies: 0.009926 590500 -- (-2120.696) (-2119.904) (-2121.280) [-2121.454] * (-2121.015) (-2119.599) [-2120.310] (-2121.165) -- 0:00:28 591000 -- (-2124.040) (-2119.887) [-2121.207] (-2121.162) * (-2121.353) (-2119.459) (-2124.003) [-2121.078] -- 0:00:28 591500 -- [-2119.126] (-2122.179) (-2121.308) (-2120.699) * (-2122.617) [-2120.186] (-2123.111) (-2121.408) -- 0:00:28 592000 -- (-2120.528) (-2122.200) (-2122.398) [-2119.407] * (-2119.890) [-2120.364] (-2120.186) (-2120.024) -- 0:00:28 592500 -- [-2119.571] (-2120.632) (-2122.611) (-2120.092) * (-2119.921) (-2121.208) (-2121.886) [-2119.447] -- 0:00:28 593000 -- (-2119.429) [-2119.442] (-2119.914) (-2120.387) * (-2121.193) (-2121.443) (-2120.727) [-2119.449] -- 0:00:28 593500 -- (-2120.868) (-2121.681) (-2121.928) [-2119.614] * (-2119.878) [-2119.605] (-2121.340) (-2119.589) -- 0:00:28 594000 -- (-2120.550) (-2119.534) (-2120.054) [-2121.113] * [-2119.894] (-2119.713) (-2125.673) (-2123.000) -- 0:00:28 594500 -- (-2121.182) (-2120.463) (-2119.804) [-2121.853] * (-2122.046) [-2122.519] (-2127.383) (-2124.649) -- 0:00:28 595000 -- (-2120.314) (-2121.370) (-2120.926) [-2123.231] * [-2120.725] (-2121.874) (-2121.664) (-2120.008) -- 0:00:28 Average standard deviation of split frequencies: 0.009491 595500 -- [-2120.435] (-2121.199) (-2120.477) (-2123.006) * (-2121.144) [-2122.555] (-2123.987) (-2119.909) -- 0:00:28 596000 -- (-2122.163) (-2121.901) (-2121.277) [-2123.535] * (-2120.760) (-2121.791) (-2121.383) [-2119.846] -- 0:00:28 596500 -- (-2121.612) (-2121.993) (-2120.166) [-2121.752] * (-2122.209) [-2120.191] (-2122.281) (-2119.672) -- 0:00:28 597000 -- (-2126.653) (-2121.162) [-2119.666] (-2122.810) * (-2119.047) (-2119.519) [-2124.508] (-2119.584) -- 0:00:28 597500 -- [-2120.999] (-2123.813) (-2119.627) (-2120.022) * [-2119.543] (-2119.721) (-2123.701) (-2120.146) -- 0:00:28 598000 -- [-2120.507] (-2121.669) (-2120.580) (-2119.604) * [-2119.076] (-2120.325) (-2122.769) (-2122.836) -- 0:00:28 598500 -- (-2122.394) [-2120.154] (-2122.148) (-2122.626) * (-2120.708) [-2121.445] (-2119.963) (-2121.299) -- 0:00:28 599000 -- (-2122.713) (-2119.402) [-2119.472] (-2122.778) * [-2119.570] (-2122.130) (-2121.862) (-2122.500) -- 0:00:28 599500 -- [-2120.353] (-2123.514) (-2119.926) (-2121.249) * (-2120.118) (-2121.367) (-2122.029) [-2121.896] -- 0:00:28 600000 -- (-2120.456) (-2120.378) [-2120.587] (-2122.687) * (-2120.686) [-2123.188] (-2122.347) (-2121.366) -- 0:00:27 Average standard deviation of split frequencies: 0.010104 600500 -- (-2120.453) (-2121.882) (-2121.220) [-2122.809] * (-2121.372) [-2119.833] (-2119.494) (-2121.730) -- 0:00:27 601000 -- (-2121.455) (-2121.245) (-2121.874) [-2121.638] * (-2121.689) [-2122.220] (-2121.475) (-2122.068) -- 0:00:27 601500 -- (-2124.500) (-2120.359) [-2119.650] (-2119.798) * [-2121.447] (-2121.625) (-2120.478) (-2121.758) -- 0:00:27 602000 -- [-2119.295] (-2121.345) (-2120.008) (-2122.772) * (-2120.285) (-2119.539) (-2119.238) [-2121.847] -- 0:00:27 602500 -- (-2120.432) (-2121.381) [-2119.997] (-2119.122) * (-2119.952) (-2119.619) (-2119.116) [-2120.994] -- 0:00:27 603000 -- (-2124.181) (-2121.191) (-2121.649) [-2121.071] * (-2122.216) [-2121.562] (-2119.085) (-2120.743) -- 0:00:27 603500 -- (-2119.910) [-2121.441] (-2121.071) (-2121.934) * (-2120.438) (-2121.283) [-2119.629] (-2120.132) -- 0:00:27 604000 -- (-2118.916) (-2121.548) (-2122.224) [-2121.260] * (-2121.409) (-2120.338) (-2119.359) [-2120.961] -- 0:00:27 604500 -- (-2120.623) (-2121.179) [-2122.056] (-2123.477) * (-2120.497) (-2119.614) (-2120.935) [-2119.252] -- 0:00:27 605000 -- (-2121.488) (-2119.015) (-2120.410) [-2120.082] * [-2121.898] (-2119.716) (-2120.066) (-2120.775) -- 0:00:27 Average standard deviation of split frequencies: 0.010356 605500 -- (-2120.542) (-2118.762) (-2122.884) [-2122.885] * (-2124.795) (-2122.368) [-2119.385] (-2122.151) -- 0:00:27 606000 -- (-2121.036) [-2122.279] (-2123.952) (-2121.062) * [-2122.093] (-2120.030) (-2121.814) (-2122.058) -- 0:00:27 606500 -- [-2122.956] (-2121.237) (-2119.976) (-2121.839) * (-2120.092) (-2121.692) (-2126.324) [-2120.003] -- 0:00:27 607000 -- [-2121.872] (-2123.191) (-2119.674) (-2124.460) * (-2120.933) (-2121.968) [-2121.450] (-2120.000) -- 0:00:27 607500 -- [-2121.193] (-2119.019) (-2124.936) (-2123.114) * (-2121.251) (-2120.653) [-2119.143] (-2119.274) -- 0:00:27 608000 -- (-2121.434) (-2119.015) (-2124.209) [-2121.274] * (-2127.423) (-2119.390) [-2119.300] (-2120.058) -- 0:00:27 608500 -- [-2119.970] (-2119.692) (-2122.087) (-2122.157) * (-2121.934) (-2119.722) (-2120.909) [-2123.275] -- 0:00:27 609000 -- (-2119.110) (-2119.702) [-2121.560] (-2120.551) * (-2126.811) (-2121.860) (-2121.128) [-2120.661] -- 0:00:27 609500 -- (-2118.962) (-2120.983) (-2121.646) [-2121.380] * (-2124.344) (-2120.677) [-2121.218] (-2121.947) -- 0:00:27 610000 -- (-2118.908) (-2121.687) (-2122.664) [-2121.748] * (-2123.328) (-2121.418) [-2119.550] (-2119.729) -- 0:00:27 Average standard deviation of split frequencies: 0.010518 610500 -- (-2121.348) (-2124.076) (-2122.041) [-2121.182] * (-2126.804) [-2122.721] (-2121.298) (-2120.847) -- 0:00:27 611000 -- (-2125.551) (-2122.987) (-2121.209) [-2119.110] * (-2127.140) (-2122.925) [-2120.371] (-2119.755) -- 0:00:27 611500 -- (-2121.521) (-2122.133) (-2126.538) [-2119.495] * [-2124.119] (-2121.512) (-2123.610) (-2119.890) -- 0:00:27 612000 -- [-2121.778] (-2121.611) (-2126.624) (-2125.964) * (-2120.009) [-2121.842] (-2121.700) (-2121.976) -- 0:00:27 612500 -- (-2122.326) [-2123.359] (-2125.053) (-2121.150) * (-2123.892) (-2119.516) [-2125.834] (-2120.724) -- 0:00:27 613000 -- (-2122.163) [-2123.870] (-2124.084) (-2123.154) * (-2119.918) [-2119.917] (-2123.475) (-2121.865) -- 0:00:27 613500 -- (-2121.601) [-2120.397] (-2122.781) (-2124.087) * (-2121.214) (-2125.501) [-2120.483] (-2120.752) -- 0:00:27 614000 -- (-2121.097) [-2121.070] (-2121.249) (-2123.776) * [-2124.117] (-2122.221) (-2122.636) (-2120.317) -- 0:00:27 614500 -- (-2123.879) (-2120.550) (-2120.582) [-2119.808] * [-2122.472] (-2121.750) (-2124.159) (-2121.811) -- 0:00:26 615000 -- (-2122.431) [-2120.687] (-2123.419) (-2124.168) * (-2122.379) [-2124.767] (-2122.874) (-2119.837) -- 0:00:26 Average standard deviation of split frequencies: 0.011527 615500 -- (-2127.061) (-2128.433) (-2124.975) [-2121.759] * [-2121.195] (-2123.433) (-2121.925) (-2124.906) -- 0:00:26 616000 -- (-2121.852) [-2122.833] (-2123.497) (-2119.667) * (-2121.371) (-2120.805) [-2121.062] (-2123.509) -- 0:00:26 616500 -- (-2123.723) [-2122.618] (-2123.461) (-2119.646) * (-2121.564) (-2122.578) [-2120.447] (-2120.707) -- 0:00:26 617000 -- (-2123.945) (-2122.972) (-2124.377) [-2119.172] * (-2120.806) (-2120.971) (-2123.007) [-2122.332] -- 0:00:26 617500 -- (-2120.405) (-2122.479) (-2122.712) [-2118.871] * (-2121.049) (-2120.022) (-2122.597) [-2120.633] -- 0:00:26 618000 -- [-2121.809] (-2122.850) (-2122.399) (-2120.000) * (-2119.468) (-2120.181) (-2120.163) [-2120.844] -- 0:00:26 618500 -- (-2123.072) (-2122.137) (-2122.932) [-2120.429] * (-2120.790) (-2120.961) (-2119.994) [-2120.324] -- 0:00:27 619000 -- [-2119.805] (-2121.033) (-2120.565) (-2118.987) * [-2122.700] (-2119.867) (-2121.586) (-2123.035) -- 0:00:27 619500 -- (-2122.001) (-2121.387) (-2123.358) [-2120.415] * (-2121.007) [-2120.351] (-2119.898) (-2122.131) -- 0:00:27 620000 -- [-2120.481] (-2124.773) (-2120.411) (-2121.641) * [-2121.008] (-2120.373) (-2120.270) (-2123.334) -- 0:00:26 Average standard deviation of split frequencies: 0.011440 620500 -- (-2122.040) [-2126.078] (-2120.160) (-2119.598) * [-2120.662] (-2119.728) (-2120.275) (-2121.859) -- 0:00:26 621000 -- (-2125.285) (-2120.237) (-2120.160) [-2119.003] * [-2120.040] (-2118.985) (-2120.124) (-2122.550) -- 0:00:26 621500 -- (-2124.712) (-2121.323) [-2120.432] (-2120.662) * (-2125.632) [-2119.918] (-2121.798) (-2122.026) -- 0:00:26 622000 -- [-2124.311] (-2122.332) (-2120.658) (-2119.257) * [-2121.579] (-2120.221) (-2124.485) (-2130.903) -- 0:00:26 622500 -- (-2121.393) [-2122.935] (-2120.263) (-2120.751) * (-2120.759) [-2121.434] (-2122.286) (-2121.486) -- 0:00:26 623000 -- [-2119.693] (-2123.303) (-2120.191) (-2123.310) * (-2122.472) (-2121.558) (-2121.173) [-2119.173] -- 0:00:26 623500 -- (-2119.752) (-2121.070) [-2118.914] (-2120.895) * (-2121.049) [-2120.821] (-2121.172) (-2119.829) -- 0:00:26 624000 -- (-2119.323) [-2119.006] (-2121.927) (-2119.741) * [-2121.706] (-2121.563) (-2123.245) (-2119.948) -- 0:00:26 624500 -- (-2118.716) (-2118.900) (-2120.084) [-2119.931] * (-2122.023) [-2121.011] (-2121.564) (-2120.272) -- 0:00:26 625000 -- (-2121.020) (-2119.409) (-2120.619) [-2120.211] * (-2120.026) [-2121.886] (-2122.347) (-2123.016) -- 0:00:26 Average standard deviation of split frequencies: 0.012237 625500 -- (-2119.687) (-2120.602) (-2120.931) [-2121.608] * (-2119.989) (-2121.795) [-2123.880] (-2120.930) -- 0:00:26 626000 -- (-2120.697) [-2120.058] (-2123.454) (-2122.046) * [-2119.771] (-2120.808) (-2119.730) (-2121.493) -- 0:00:26 626500 -- (-2122.069) (-2119.986) (-2119.286) [-2121.049] * (-2120.151) [-2120.658] (-2119.651) (-2121.493) -- 0:00:26 627000 -- (-2123.997) (-2119.733) (-2123.592) [-2120.242] * (-2121.511) (-2118.923) (-2121.855) [-2118.839] -- 0:00:26 627500 -- [-2123.093] (-2119.841) (-2122.094) (-2123.186) * (-2118.931) (-2119.125) (-2122.894) [-2120.017] -- 0:00:26 628000 -- (-2121.194) (-2120.369) (-2122.007) [-2122.573] * (-2121.465) (-2119.003) [-2121.419] (-2119.339) -- 0:00:26 628500 -- (-2120.276) (-2125.501) [-2119.599] (-2120.287) * (-2119.649) [-2119.160] (-2121.665) (-2120.560) -- 0:00:26 629000 -- (-2121.006) (-2125.689) (-2121.849) [-2119.638] * (-2119.044) [-2120.250] (-2121.560) (-2119.853) -- 0:00:25 629500 -- (-2119.719) [-2120.981] (-2121.656) (-2119.889) * (-2119.594) (-2121.763) [-2121.807] (-2120.497) -- 0:00:25 630000 -- (-2118.812) (-2118.912) [-2120.113] (-2123.284) * [-2120.725] (-2121.472) (-2121.393) (-2120.568) -- 0:00:25 Average standard deviation of split frequencies: 0.012100 630500 -- [-2118.812] (-2119.535) (-2121.818) (-2121.304) * (-2123.697) [-2121.340] (-2121.404) (-2121.429) -- 0:00:25 631000 -- (-2122.621) [-2119.023] (-2124.239) (-2128.653) * [-2123.360] (-2121.321) (-2124.131) (-2122.702) -- 0:00:26 631500 -- (-2120.502) (-2123.519) [-2123.027] (-2123.409) * (-2122.107) (-2121.321) [-2121.522] (-2122.227) -- 0:00:26 632000 -- [-2119.756] (-2124.993) (-2120.472) (-2120.289) * (-2121.648) [-2120.625] (-2119.842) (-2123.346) -- 0:00:26 632500 -- (-2123.661) [-2123.585] (-2122.347) (-2120.872) * (-2121.109) [-2118.829] (-2123.607) (-2119.907) -- 0:00:26 633000 -- (-2119.961) [-2120.617] (-2122.934) (-2122.313) * (-2119.735) (-2118.765) (-2123.912) [-2119.843] -- 0:00:26 633500 -- [-2120.858] (-2120.102) (-2121.764) (-2120.071) * (-2119.554) (-2121.232) (-2121.269) [-2120.954] -- 0:00:26 634000 -- (-2119.598) (-2120.305) (-2120.030) [-2120.128] * (-2119.823) (-2121.847) [-2120.605] (-2120.433) -- 0:00:25 634500 -- (-2119.434) [-2120.253] (-2121.014) (-2121.181) * (-2121.646) (-2123.161) [-2120.396] (-2119.797) -- 0:00:25 635000 -- (-2119.179) (-2122.505) (-2120.602) [-2119.923] * (-2124.760) [-2122.856] (-2124.506) (-2120.142) -- 0:00:25 Average standard deviation of split frequencies: 0.011535 635500 -- (-2120.280) (-2119.566) (-2123.200) [-2120.279] * (-2123.751) [-2122.151] (-2120.394) (-2120.118) -- 0:00:25 636000 -- [-2121.347] (-2121.259) (-2121.813) (-2118.851) * (-2122.635) (-2120.660) [-2120.003] (-2120.007) -- 0:00:25 636500 -- (-2124.814) (-2124.475) [-2120.757] (-2121.100) * [-2125.000] (-2121.190) (-2121.436) (-2120.933) -- 0:00:25 637000 -- (-2121.869) (-2121.508) [-2120.649] (-2119.544) * (-2121.860) (-2122.407) (-2122.070) [-2120.245] -- 0:00:25 637500 -- (-2122.303) [-2122.223] (-2121.168) (-2123.039) * (-2123.005) (-2121.049) (-2121.667) [-2120.447] -- 0:00:25 638000 -- (-2121.102) [-2121.667] (-2122.786) (-2122.419) * (-2120.840) (-2123.191) [-2122.010] (-2121.181) -- 0:00:25 638500 -- (-2121.486) (-2121.800) [-2122.807] (-2122.211) * [-2122.614] (-2120.328) (-2124.792) (-2120.492) -- 0:00:25 639000 -- (-2121.885) (-2125.482) (-2119.705) [-2119.641] * (-2120.494) [-2119.984] (-2120.167) (-2120.125) -- 0:00:25 639500 -- (-2118.978) (-2123.245) [-2119.678] (-2123.206) * [-2119.702] (-2120.094) (-2122.743) (-2120.881) -- 0:00:25 640000 -- (-2119.744) (-2121.159) (-2120.080) [-2123.852] * (-2119.383) [-2121.130] (-2118.645) (-2122.986) -- 0:00:25 Average standard deviation of split frequencies: 0.011727 640500 -- (-2119.421) (-2123.817) (-2119.153) [-2123.736] * (-2122.136) [-2120.595] (-2119.759) (-2122.650) -- 0:00:25 641000 -- (-2119.273) (-2124.990) (-2119.772) [-2120.216] * (-2123.498) (-2122.226) (-2126.238) [-2120.320] -- 0:00:25 641500 -- (-2120.603) [-2122.043] (-2121.894) (-2120.989) * (-2121.287) [-2119.799] (-2120.782) (-2120.153) -- 0:00:25 642000 -- (-2119.605) (-2121.271) (-2120.163) [-2120.247] * (-2121.993) [-2123.644] (-2121.007) (-2120.351) -- 0:00:25 642500 -- (-2120.761) (-2124.706) [-2120.210] (-2120.694) * (-2122.690) [-2120.042] (-2125.705) (-2119.645) -- 0:00:25 643000 -- (-2123.274) (-2122.308) [-2123.677] (-2119.996) * [-2122.782] (-2131.594) (-2124.724) (-2124.407) -- 0:00:24 643500 -- [-2123.733] (-2121.393) (-2123.340) (-2119.085) * (-2122.615) [-2119.889] (-2120.640) (-2123.764) -- 0:00:24 644000 -- (-2122.085) [-2123.311] (-2120.477) (-2119.237) * (-2119.728) (-2122.280) (-2119.580) [-2120.286] -- 0:00:25 644500 -- [-2120.000] (-2119.870) (-2123.436) (-2118.993) * (-2119.259) (-2122.852) [-2120.917] (-2118.896) -- 0:00:25 645000 -- (-2119.511) (-2122.670) [-2120.512] (-2122.163) * [-2122.555] (-2121.346) (-2121.686) (-2124.145) -- 0:00:25 Average standard deviation of split frequencies: 0.012405 645500 -- [-2120.431] (-2120.519) (-2120.660) (-2120.130) * [-2122.490] (-2122.162) (-2121.457) (-2124.904) -- 0:00:25 646000 -- (-2121.606) (-2119.961) (-2121.372) [-2119.635] * (-2122.690) [-2119.539] (-2121.353) (-2123.299) -- 0:00:25 646500 -- (-2121.028) [-2122.438] (-2121.331) (-2118.681) * (-2120.684) (-2119.670) [-2121.645] (-2122.783) -- 0:00:25 647000 -- (-2119.472) (-2121.009) [-2120.961] (-2120.121) * [-2121.267] (-2122.206) (-2120.550) (-2121.623) -- 0:00:25 647500 -- [-2119.844] (-2123.556) (-2119.806) (-2120.121) * (-2120.459) (-2121.255) [-2120.550] (-2121.290) -- 0:00:25 648000 -- (-2119.031) (-2122.219) (-2119.252) [-2126.027] * (-2122.735) (-2122.467) (-2120.134) [-2126.335] -- 0:00:24 648500 -- (-2119.682) (-2121.434) [-2119.671] (-2120.818) * (-2121.989) [-2120.843] (-2119.661) (-2122.805) -- 0:00:24 649000 -- [-2124.559] (-2123.982) (-2120.171) (-2121.285) * (-2120.695) [-2121.329] (-2124.717) (-2124.146) -- 0:00:24 649500 -- (-2122.294) [-2123.250] (-2120.849) (-2119.149) * (-2119.320) (-2123.055) (-2122.263) [-2120.195] -- 0:00:24 650000 -- (-2121.249) (-2121.896) [-2122.635] (-2119.376) * (-2119.388) [-2121.587] (-2124.463) (-2120.864) -- 0:00:24 Average standard deviation of split frequencies: 0.012572 650500 -- [-2124.386] (-2120.669) (-2122.837) (-2120.760) * (-2125.777) (-2123.490) (-2120.700) [-2121.706] -- 0:00:24 651000 -- [-2121.534] (-2119.722) (-2120.002) (-2122.816) * (-2122.176) [-2122.323] (-2122.477) (-2120.405) -- 0:00:24 651500 -- [-2120.754] (-2120.609) (-2120.268) (-2125.151) * [-2123.674] (-2122.269) (-2122.177) (-2122.141) -- 0:00:24 652000 -- (-2120.434) [-2122.962] (-2122.515) (-2120.039) * (-2120.951) [-2119.143] (-2120.493) (-2121.039) -- 0:00:24 652500 -- (-2119.454) [-2123.391] (-2122.078) (-2121.350) * [-2119.902] (-2119.947) (-2119.971) (-2121.186) -- 0:00:24 653000 -- [-2120.356] (-2122.400) (-2121.397) (-2123.200) * (-2120.365) [-2123.201] (-2119.754) (-2120.473) -- 0:00:24 653500 -- (-2121.017) (-2123.896) (-2120.352) [-2121.180] * (-2119.686) (-2121.417) (-2120.867) [-2121.038] -- 0:00:24 654000 -- (-2121.017) (-2120.637) (-2121.176) [-2120.659] * (-2119.849) (-2121.286) [-2119.961] (-2121.020) -- 0:00:24 654500 -- (-2122.840) [-2122.523] (-2120.548) (-2120.196) * (-2119.933) [-2120.117] (-2122.496) (-2122.125) -- 0:00:24 655000 -- [-2123.591] (-2125.054) (-2120.539) (-2124.198) * (-2121.723) [-2120.014] (-2120.083) (-2119.774) -- 0:00:24 Average standard deviation of split frequencies: 0.012126 655500 -- (-2118.846) [-2125.734] (-2122.108) (-2122.013) * [-2119.142] (-2121.900) (-2120.859) (-2119.680) -- 0:00:24 656000 -- (-2119.013) (-2126.257) (-2122.876) [-2122.840] * (-2119.311) (-2119.917) (-2121.067) [-2121.464] -- 0:00:24 656500 -- (-2119.147) (-2120.258) (-2119.554) [-2122.860] * [-2119.317] (-2121.625) (-2120.736) (-2119.756) -- 0:00:24 657000 -- (-2119.049) [-2120.280] (-2119.591) (-2119.937) * (-2119.366) (-2124.665) [-2121.707] (-2121.031) -- 0:00:24 657500 -- (-2123.040) [-2121.137] (-2121.443) (-2121.422) * (-2122.016) (-2121.356) [-2124.637] (-2121.957) -- 0:00:24 658000 -- (-2123.525) [-2119.079] (-2121.048) (-2120.913) * [-2121.598] (-2121.471) (-2124.190) (-2120.233) -- 0:00:24 658500 -- (-2120.774) (-2121.097) [-2121.302] (-2120.972) * [-2123.100] (-2123.236) (-2125.037) (-2120.827) -- 0:00:24 659000 -- (-2119.568) (-2122.029) [-2120.430] (-2121.846) * (-2123.763) (-2121.118) (-2121.969) [-2120.265] -- 0:00:24 659500 -- (-2123.046) (-2120.698) [-2120.218] (-2120.838) * (-2121.299) [-2121.122] (-2124.961) (-2123.456) -- 0:00:24 660000 -- [-2121.315] (-2121.045) (-2119.741) (-2121.002) * [-2124.457] (-2120.890) (-2119.840) (-2120.188) -- 0:00:24 Average standard deviation of split frequencies: 0.012718 660500 -- (-2118.776) (-2122.922) (-2122.960) [-2121.540] * (-2121.642) (-2120.896) (-2119.568) [-2120.188] -- 0:00:24 661000 -- (-2120.405) [-2121.518] (-2120.143) (-2120.309) * [-2121.784] (-2120.539) (-2121.287) (-2123.855) -- 0:00:24 661500 -- (-2119.747) (-2123.615) (-2121.639) [-2120.980] * (-2120.378) (-2123.117) [-2120.028] (-2119.786) -- 0:00:24 662000 -- (-2120.145) (-2122.622) (-2120.876) [-2120.980] * (-2119.790) [-2120.686] (-2121.887) (-2120.038) -- 0:00:23 662500 -- [-2122.070] (-2120.385) (-2120.908) (-2121.181) * (-2120.279) (-2122.920) (-2119.577) [-2120.594] -- 0:00:23 663000 -- (-2121.508) [-2119.688] (-2119.040) (-2124.241) * (-2119.548) (-2122.602) [-2120.421] (-2126.130) -- 0:00:23 663500 -- (-2122.259) [-2120.743] (-2122.406) (-2123.332) * [-2119.740] (-2120.392) (-2121.724) (-2126.055) -- 0:00:23 664000 -- (-2121.750) [-2119.708] (-2121.725) (-2121.722) * [-2119.772] (-2122.133) (-2120.248) (-2120.634) -- 0:00:23 664500 -- (-2120.702) (-2120.297) [-2120.685] (-2120.451) * (-2119.431) (-2119.617) [-2122.586] (-2120.439) -- 0:00:23 665000 -- (-2120.735) (-2119.158) [-2119.150] (-2120.156) * (-2118.965) (-2122.635) [-2119.976] (-2120.706) -- 0:00:23 Average standard deviation of split frequencies: 0.012866 665500 -- (-2120.464) (-2121.976) [-2120.051] (-2120.275) * (-2120.227) [-2120.981] (-2119.869) (-2124.472) -- 0:00:23 666000 -- (-2121.518) (-2120.735) [-2119.376] (-2120.101) * (-2119.565) [-2120.042] (-2120.725) (-2125.567) -- 0:00:23 666500 -- (-2122.790) [-2119.782] (-2120.293) (-2120.208) * [-2120.985] (-2122.663) (-2122.637) (-2122.154) -- 0:00:23 667000 -- [-2125.034] (-2119.778) (-2121.031) (-2119.676) * [-2121.672] (-2122.807) (-2122.675) (-2121.316) -- 0:00:23 667500 -- (-2127.666) [-2125.647] (-2121.251) (-2123.336) * (-2123.512) (-2120.970) (-2122.191) [-2120.997] -- 0:00:23 668000 -- (-2123.301) [-2119.707] (-2120.835) (-2121.911) * (-2121.457) [-2119.480] (-2121.402) (-2120.567) -- 0:00:23 668500 -- (-2121.744) [-2122.735] (-2121.088) (-2120.985) * (-2120.107) [-2120.411] (-2122.110) (-2120.138) -- 0:00:23 669000 -- (-2120.653) [-2120.836] (-2119.055) (-2121.935) * (-2120.073) (-2119.496) (-2120.721) [-2121.783] -- 0:00:23 669500 -- (-2120.163) [-2120.777] (-2119.324) (-2124.105) * (-2118.870) (-2120.061) [-2123.212] (-2120.345) -- 0:00:23 670000 -- (-2119.425) (-2124.343) (-2121.328) [-2120.254] * (-2118.769) (-2121.103) (-2125.973) [-2119.589] -- 0:00:23 Average standard deviation of split frequencies: 0.012693 670500 -- [-2121.959] (-2121.491) (-2121.643) (-2119.647) * (-2120.256) [-2123.525] (-2119.405) (-2120.664) -- 0:00:23 671000 -- (-2122.444) [-2119.519] (-2122.034) (-2119.745) * (-2121.172) [-2120.221] (-2119.146) (-2119.422) -- 0:00:23 671500 -- (-2120.119) (-2120.561) [-2121.976] (-2119.687) * (-2123.590) (-2119.850) [-2124.521] (-2120.105) -- 0:00:23 672000 -- [-2120.124] (-2124.027) (-2121.849) (-2120.986) * [-2120.206] (-2120.452) (-2120.727) (-2122.063) -- 0:00:23 672500 -- [-2120.042] (-2125.460) (-2123.086) (-2120.773) * (-2119.820) [-2121.149] (-2120.967) (-2124.385) -- 0:00:23 673000 -- [-2121.106] (-2122.231) (-2121.299) (-2119.063) * (-2121.172) (-2120.456) [-2119.987] (-2124.812) -- 0:00:23 673500 -- (-2120.384) (-2121.924) (-2124.963) [-2119.429] * (-2120.164) (-2122.360) [-2120.235] (-2123.922) -- 0:00:23 674000 -- (-2121.025) (-2122.189) [-2124.717] (-2119.729) * (-2125.730) (-2122.476) (-2122.246) [-2120.942] -- 0:00:23 674500 -- (-2122.571) [-2121.061] (-2120.877) (-2119.484) * [-2121.077] (-2121.293) (-2120.337) (-2118.920) -- 0:00:23 675000 -- (-2121.773) (-2119.739) (-2120.164) [-2119.261] * (-2121.934) [-2120.935] (-2119.850) (-2120.456) -- 0:00:23 Average standard deviation of split frequencies: 0.011986 675500 -- [-2120.317] (-2119.601) (-2123.951) (-2120.742) * [-2120.083] (-2127.986) (-2120.662) (-2120.775) -- 0:00:23 676000 -- (-2120.283) (-2119.599) [-2119.443] (-2119.813) * [-2119.438] (-2124.018) (-2123.114) (-2120.929) -- 0:00:23 676500 -- (-2123.159) [-2119.263] (-2119.348) (-2119.108) * (-2120.015) (-2122.346) [-2122.097] (-2121.843) -- 0:00:22 677000 -- (-2119.964) (-2120.727) [-2119.269] (-2120.896) * (-2121.000) (-2122.357) (-2119.753) [-2121.517] -- 0:00:22 677500 -- (-2124.555) (-2120.394) [-2119.423] (-2121.084) * (-2122.272) [-2119.613] (-2121.446) (-2122.859) -- 0:00:22 678000 -- (-2122.523) [-2119.723] (-2121.661) (-2125.276) * (-2123.837) [-2121.183] (-2120.559) (-2124.516) -- 0:00:22 678500 -- (-2121.747) [-2118.844] (-2121.616) (-2121.756) * (-2126.132) (-2120.521) [-2120.619] (-2121.402) -- 0:00:22 679000 -- (-2119.417) (-2120.447) [-2119.120] (-2120.621) * (-2123.566) (-2120.217) [-2120.690] (-2120.734) -- 0:00:22 679500 -- [-2118.966] (-2120.812) (-2118.998) (-2121.053) * (-2124.150) (-2122.234) (-2120.415) [-2120.986] -- 0:00:22 680000 -- [-2118.658] (-2122.747) (-2120.481) (-2119.839) * [-2120.392] (-2122.160) (-2119.722) (-2121.212) -- 0:00:22 Average standard deviation of split frequencies: 0.011774 680500 -- (-2122.530) (-2121.975) (-2123.172) [-2119.551] * [-2120.160] (-2122.477) (-2126.964) (-2120.574) -- 0:00:22 681000 -- (-2120.449) [-2119.782] (-2119.698) (-2119.808) * (-2119.608) (-2122.254) (-2121.540) [-2120.469] -- 0:00:22 681500 -- (-2121.791) [-2124.621] (-2123.244) (-2122.366) * (-2119.562) [-2120.653] (-2122.659) (-2122.651) -- 0:00:22 682000 -- (-2122.406) (-2122.154) [-2119.536] (-2122.743) * (-2119.488) (-2122.308) [-2123.111] (-2122.390) -- 0:00:22 682500 -- (-2122.321) [-2123.068] (-2120.269) (-2123.845) * [-2122.425] (-2126.369) (-2120.661) (-2121.107) -- 0:00:22 683000 -- (-2120.880) (-2121.029) [-2123.286] (-2127.317) * [-2123.015] (-2121.653) (-2120.463) (-2119.550) -- 0:00:22 683500 -- [-2119.310] (-2121.558) (-2121.339) (-2123.018) * (-2121.816) [-2120.244] (-2125.749) (-2121.942) -- 0:00:22 684000 -- (-2119.860) (-2121.105) (-2121.598) [-2121.846] * (-2124.165) [-2121.587] (-2119.840) (-2124.205) -- 0:00:22 684500 -- (-2120.059) (-2120.061) [-2125.843] (-2119.671) * (-2123.183) (-2119.986) [-2120.017] (-2122.172) -- 0:00:22 685000 -- (-2122.832) (-2121.816) (-2120.509) [-2120.838] * (-2124.798) (-2120.932) (-2119.653) [-2121.766] -- 0:00:22 Average standard deviation of split frequencies: 0.012571 685500 -- (-2123.220) (-2120.668) [-2121.073] (-2120.152) * (-2121.999) (-2121.464) (-2120.407) [-2121.425] -- 0:00:22 686000 -- (-2122.531) (-2120.052) (-2124.549) [-2121.499] * (-2122.862) [-2121.103] (-2121.947) (-2121.461) -- 0:00:22 686500 -- (-2121.867) [-2121.990] (-2120.430) (-2123.963) * [-2125.087] (-2121.602) (-2121.836) (-2121.727) -- 0:00:22 687000 -- [-2121.103] (-2120.083) (-2122.175) (-2119.648) * (-2120.444) (-2121.638) (-2122.255) [-2123.296] -- 0:00:22 687500 -- (-2124.895) (-2120.194) (-2120.954) [-2121.511] * [-2120.435] (-2119.378) (-2122.806) (-2120.375) -- 0:00:22 688000 -- [-2126.562] (-2123.187) (-2120.960) (-2120.744) * (-2118.841) [-2121.234] (-2119.259) (-2122.682) -- 0:00:22 688500 -- (-2129.600) [-2121.643] (-2121.314) (-2122.474) * (-2124.276) (-2120.421) [-2119.498] (-2122.874) -- 0:00:22 689000 -- [-2120.036] (-2123.184) (-2120.075) (-2119.679) * (-2119.529) [-2121.977] (-2120.277) (-2120.788) -- 0:00:22 689500 -- (-2120.062) [-2119.882] (-2120.233) (-2119.490) * (-2124.721) (-2119.863) (-2123.140) [-2122.552] -- 0:00:22 690000 -- (-2120.520) [-2119.665] (-2119.441) (-2122.232) * (-2124.542) (-2121.322) (-2120.259) [-2121.781] -- 0:00:22 Average standard deviation of split frequencies: 0.012486 690500 -- (-2120.229) [-2122.995] (-2120.341) (-2121.878) * [-2120.086] (-2119.000) (-2121.364) (-2119.286) -- 0:00:21 691000 -- (-2120.158) [-2125.073] (-2120.835) (-2123.281) * (-2125.260) [-2121.218] (-2120.345) (-2118.955) -- 0:00:21 691500 -- [-2120.437] (-2122.115) (-2120.255) (-2120.473) * [-2121.203] (-2121.281) (-2125.512) (-2120.001) -- 0:00:21 692000 -- (-2119.137) (-2121.426) [-2121.789] (-2123.409) * (-2121.910) [-2121.363] (-2120.619) (-2122.679) -- 0:00:21 692500 -- [-2119.826] (-2122.852) (-2121.371) (-2121.605) * [-2120.300] (-2120.928) (-2122.252) (-2122.863) -- 0:00:21 693000 -- (-2119.595) (-2120.730) (-2120.056) [-2120.634] * (-2120.795) [-2122.861] (-2120.915) (-2120.993) -- 0:00:21 693500 -- (-2120.889) [-2121.676] (-2122.112) (-2118.883) * [-2119.979] (-2122.159) (-2120.074) (-2122.980) -- 0:00:21 694000 -- (-2120.266) (-2120.202) (-2123.224) [-2119.440] * (-2120.922) [-2121.785] (-2120.058) (-2120.182) -- 0:00:21 694500 -- (-2123.072) [-2125.259] (-2122.760) (-2120.207) * (-2123.605) (-2119.366) (-2120.232) [-2120.070] -- 0:00:21 695000 -- [-2119.257] (-2122.986) (-2119.521) (-2121.270) * (-2120.535) (-2121.646) (-2119.326) [-2120.515] -- 0:00:21 Average standard deviation of split frequencies: 0.012550 695500 -- (-2123.850) (-2122.657) (-2123.120) [-2120.894] * (-2122.340) [-2121.506] (-2119.507) (-2121.225) -- 0:00:21 696000 -- (-2123.850) [-2121.628] (-2121.556) (-2125.207) * [-2122.896] (-2121.072) (-2119.416) (-2120.240) -- 0:00:21 696500 -- (-2121.484) (-2119.155) (-2121.587) [-2121.642] * (-2123.062) [-2120.551] (-2126.191) (-2120.191) -- 0:00:21 697000 -- [-2120.327] (-2119.942) (-2123.398) (-2123.384) * (-2126.883) (-2124.600) [-2122.374] (-2121.023) -- 0:00:21 697500 -- (-2119.385) [-2119.368] (-2123.678) (-2121.563) * (-2124.030) [-2128.329] (-2123.592) (-2120.314) -- 0:00:21 698000 -- [-2120.023] (-2120.278) (-2123.460) (-2119.952) * (-2125.758) [-2123.651] (-2122.120) (-2121.983) -- 0:00:21 698500 -- [-2121.790] (-2125.608) (-2122.327) (-2120.966) * (-2122.047) [-2122.404] (-2120.282) (-2121.239) -- 0:00:21 699000 -- (-2123.164) (-2119.817) [-2121.080] (-2119.928) * [-2120.212] (-2120.457) (-2122.482) (-2122.417) -- 0:00:21 699500 -- (-2120.379) [-2120.288] (-2118.625) (-2121.699) * (-2120.665) (-2120.762) (-2124.969) [-2120.220] -- 0:00:21 700000 -- (-2119.553) [-2121.039] (-2120.264) (-2121.399) * (-2119.314) (-2125.987) (-2122.867) [-2120.398] -- 0:00:21 Average standard deviation of split frequencies: 0.012825 700500 -- (-2123.258) (-2119.736) [-2123.307] (-2119.391) * (-2119.319) (-2128.027) (-2124.110) [-2121.095] -- 0:00:21 701000 -- (-2121.116) [-2127.703] (-2126.371) (-2119.246) * (-2120.626) [-2125.092] (-2120.901) (-2118.589) -- 0:00:21 701500 -- (-2121.077) [-2123.933] (-2120.296) (-2119.508) * [-2121.357] (-2119.739) (-2126.164) (-2121.373) -- 0:00:21 702000 -- (-2122.134) (-2121.207) (-2124.949) [-2122.066] * (-2121.620) [-2119.906] (-2123.788) (-2120.178) -- 0:00:21 702500 -- (-2122.123) (-2120.209) (-2122.368) [-2123.440] * (-2122.965) [-2120.661] (-2128.665) (-2121.319) -- 0:00:21 703000 -- [-2119.530] (-2121.577) (-2122.492) (-2122.601) * (-2122.272) (-2121.054) (-2125.240) [-2119.523] -- 0:00:21 703500 -- (-2120.684) [-2121.174] (-2121.780) (-2122.656) * [-2120.804] (-2122.541) (-2124.170) (-2119.269) -- 0:00:21 704000 -- (-2128.537) (-2122.652) [-2119.698] (-2123.587) * (-2126.247) (-2123.395) [-2122.764] (-2123.291) -- 0:00:21 704500 -- (-2123.069) (-2121.310) (-2120.157) [-2119.510] * [-2122.276] (-2121.741) (-2122.131) (-2125.026) -- 0:00:20 705000 -- (-2121.937) (-2121.398) [-2120.269] (-2119.510) * (-2125.502) (-2120.006) [-2121.059] (-2121.258) -- 0:00:20 Average standard deviation of split frequencies: 0.012804 705500 -- (-2120.815) (-2121.936) (-2121.273) [-2120.522] * (-2121.435) (-2120.566) (-2119.552) [-2120.887] -- 0:00:20 706000 -- (-2124.675) (-2119.988) [-2120.985] (-2122.679) * (-2120.000) (-2120.259) [-2119.868] (-2120.269) -- 0:00:20 706500 -- (-2119.740) (-2122.372) (-2120.750) [-2119.671] * [-2119.691] (-2124.011) (-2121.885) (-2121.857) -- 0:00:20 707000 -- (-2119.610) (-2119.176) [-2121.343] (-2119.260) * [-2120.877] (-2121.205) (-2122.181) (-2122.245) -- 0:00:20 707500 -- (-2119.690) (-2120.029) (-2122.030) [-2120.478] * (-2124.002) [-2120.229] (-2123.254) (-2121.009) -- 0:00:21 708000 -- (-2120.679) [-2120.921] (-2122.104) (-2120.459) * (-2123.369) (-2122.186) (-2125.115) [-2120.008] -- 0:00:21 708500 -- (-2122.997) (-2120.333) (-2122.255) [-2119.432] * (-2123.403) [-2120.874] (-2120.832) (-2119.205) -- 0:00:20 709000 -- [-2124.707] (-2118.939) (-2123.460) (-2120.368) * [-2120.432] (-2119.990) (-2120.234) (-2119.211) -- 0:00:20 709500 -- (-2125.218) (-2120.383) (-2119.314) [-2124.986] * (-2120.127) (-2120.911) [-2120.234] (-2119.211) -- 0:00:20 710000 -- (-2124.605) [-2124.236] (-2122.398) (-2121.387) * (-2121.757) (-2120.942) [-2121.302] (-2121.025) -- 0:00:20 Average standard deviation of split frequencies: 0.012681 710500 -- (-2122.130) (-2121.040) (-2122.466) [-2121.563] * (-2121.516) (-2123.379) (-2120.794) [-2120.048] -- 0:00:20 711000 -- (-2121.964) (-2124.276) [-2120.217] (-2120.299) * [-2120.718] (-2123.025) (-2125.008) (-2119.607) -- 0:00:20 711500 -- (-2119.566) (-2121.830) [-2120.207] (-2119.996) * (-2119.990) (-2121.920) (-2122.132) [-2119.712] -- 0:00:20 712000 -- (-2119.274) (-2125.689) [-2121.048] (-2120.917) * [-2120.133] (-2121.649) (-2119.805) (-2124.987) -- 0:00:20 712500 -- (-2121.834) (-2121.851) (-2124.444) [-2119.699] * (-2121.997) [-2120.508] (-2119.945) (-2120.249) -- 0:00:20 713000 -- (-2122.379) [-2122.341] (-2119.768) (-2121.033) * (-2119.217) (-2119.900) [-2120.122] (-2125.545) -- 0:00:20 713500 -- [-2120.562] (-2120.489) (-2122.468) (-2120.147) * (-2119.911) [-2123.155] (-2119.228) (-2125.023) -- 0:00:20 714000 -- (-2121.386) (-2120.328) [-2119.881] (-2123.747) * (-2119.849) (-2122.857) [-2120.284] (-2123.707) -- 0:00:20 714500 -- [-2121.487] (-2122.287) (-2125.478) (-2124.502) * (-2121.646) (-2122.808) [-2120.726] (-2121.826) -- 0:00:20 715000 -- (-2121.051) (-2120.204) [-2122.888] (-2120.943) * [-2120.183] (-2121.304) (-2121.685) (-2121.087) -- 0:00:20 Average standard deviation of split frequencies: 0.012664 715500 -- [-2120.099] (-2122.349) (-2122.129) (-2120.447) * [-2121.140] (-2119.608) (-2120.037) (-2124.348) -- 0:00:20 716000 -- (-2123.423) (-2121.827) (-2122.188) [-2120.906] * (-2120.062) (-2120.824) (-2123.864) [-2120.454] -- 0:00:20 716500 -- (-2121.124) (-2123.318) [-2121.242] (-2120.206) * (-2121.307) [-2125.004] (-2121.831) (-2120.098) -- 0:00:20 717000 -- (-2120.162) [-2120.743] (-2119.239) (-2120.272) * (-2123.759) (-2122.792) [-2119.659] (-2120.371) -- 0:00:20 717500 -- (-2120.115) [-2120.787] (-2120.624) (-2121.105) * (-2126.726) [-2120.845] (-2119.392) (-2120.953) -- 0:00:20 718000 -- [-2120.700] (-2119.727) (-2120.336) (-2124.143) * [-2122.990] (-2122.987) (-2120.653) (-2126.876) -- 0:00:20 718500 -- (-2119.459) (-2119.817) [-2119.517] (-2124.932) * (-2120.792) [-2121.144] (-2119.307) (-2121.486) -- 0:00:19 719000 -- [-2121.689] (-2119.280) (-2120.451) (-2121.555) * (-2119.502) [-2122.858] (-2119.379) (-2125.980) -- 0:00:19 719500 -- (-2119.441) (-2122.278) [-2124.008] (-2122.739) * (-2120.696) (-2120.551) (-2119.388) [-2123.510] -- 0:00:19 720000 -- [-2119.004] (-2120.386) (-2121.899) (-2124.318) * (-2122.081) (-2123.976) (-2121.555) [-2121.581] -- 0:00:19 Average standard deviation of split frequencies: 0.012060 720500 -- (-2122.117) [-2121.940] (-2121.899) (-2121.389) * (-2121.871) (-2121.591) [-2121.496] (-2119.955) -- 0:00:20 721000 -- [-2119.841] (-2121.561) (-2122.663) (-2120.761) * (-2122.188) (-2121.425) [-2121.697] (-2119.265) -- 0:00:20 721500 -- (-2123.104) (-2121.628) [-2120.470] (-2120.381) * (-2122.422) [-2124.073] (-2120.152) (-2120.299) -- 0:00:20 722000 -- [-2123.039] (-2121.337) (-2119.546) (-2121.361) * (-2121.911) (-2119.869) (-2121.787) [-2120.019] -- 0:00:20 722500 -- (-2119.905) (-2121.339) (-2120.438) [-2121.285] * (-2123.375) (-2128.072) (-2123.320) [-2121.852] -- 0:00:19 723000 -- (-2120.376) [-2120.075] (-2118.926) (-2122.144) * (-2123.300) (-2121.975) [-2120.724] (-2120.406) -- 0:00:19 723500 -- (-2120.486) (-2122.491) (-2119.691) [-2121.184] * (-2119.951) (-2120.092) (-2122.079) [-2121.557] -- 0:00:19 724000 -- [-2121.072] (-2120.987) (-2121.179) (-2123.929) * [-2120.211] (-2123.720) (-2121.299) (-2121.096) -- 0:00:19 724500 -- (-2122.217) [-2120.423] (-2123.548) (-2122.611) * (-2120.122) (-2120.765) [-2119.578] (-2122.116) -- 0:00:19 725000 -- (-2120.162) [-2121.098] (-2121.732) (-2119.781) * [-2119.490] (-2122.614) (-2119.584) (-2121.515) -- 0:00:19 Average standard deviation of split frequencies: 0.012053 725500 -- (-2119.349) (-2122.424) (-2121.330) [-2119.223] * [-2120.754] (-2119.298) (-2119.835) (-2122.948) -- 0:00:19 726000 -- (-2119.086) (-2119.666) [-2119.409] (-2120.455) * (-2121.541) (-2121.211) [-2119.470] (-2123.069) -- 0:00:19 726500 -- (-2121.875) (-2123.080) [-2119.153] (-2121.196) * (-2122.976) [-2121.446] (-2120.225) (-2120.828) -- 0:00:19 727000 -- (-2121.243) (-2121.553) [-2119.794] (-2119.520) * (-2122.340) [-2121.870] (-2122.123) (-2121.869) -- 0:00:19 727500 -- [-2121.959] (-2121.695) (-2123.536) (-2123.552) * [-2121.962] (-2120.012) (-2121.786) (-2121.303) -- 0:00:19 728000 -- (-2121.751) [-2120.874] (-2125.343) (-2121.897) * [-2121.487] (-2126.112) (-2122.941) (-2118.970) -- 0:00:19 728500 -- (-2120.196) [-2124.421] (-2123.372) (-2122.695) * (-2123.608) (-2122.134) (-2122.826) [-2119.954] -- 0:00:19 729000 -- (-2120.592) (-2124.371) (-2119.976) [-2119.435] * (-2121.277) (-2127.854) (-2121.203) [-2121.954] -- 0:00:19 729500 -- (-2120.068) [-2119.560] (-2125.603) (-2122.849) * [-2120.276] (-2123.758) (-2120.245) (-2120.383) -- 0:00:19 730000 -- (-2122.213) [-2119.158] (-2122.702) (-2122.034) * (-2124.630) (-2122.940) [-2122.235] (-2121.745) -- 0:00:19 Average standard deviation of split frequencies: 0.011774 730500 -- (-2120.444) (-2120.962) [-2122.730] (-2121.989) * (-2122.674) (-2120.096) [-2122.790] (-2122.093) -- 0:00:19 731000 -- (-2119.641) (-2122.425) (-2125.217) [-2124.670] * (-2119.981) [-2119.147] (-2121.578) (-2125.743) -- 0:00:19 731500 -- [-2119.981] (-2120.949) (-2122.570) (-2120.581) * [-2119.858] (-2121.364) (-2122.180) (-2122.266) -- 0:00:19 732000 -- (-2122.555) (-2122.372) [-2122.673] (-2121.033) * (-2119.765) (-2120.783) (-2124.185) [-2123.309] -- 0:00:19 732500 -- [-2121.857] (-2121.517) (-2121.280) (-2120.402) * [-2121.924] (-2119.758) (-2124.202) (-2122.934) -- 0:00:18 733000 -- (-2122.609) (-2119.817) (-2121.256) [-2126.188] * (-2123.633) (-2119.840) [-2123.132] (-2120.695) -- 0:00:18 733500 -- (-2121.325) (-2121.796) (-2120.276) [-2119.888] * (-2123.553) (-2121.301) [-2121.480] (-2122.205) -- 0:00:18 734000 -- (-2123.716) (-2121.233) [-2120.970] (-2119.620) * (-2120.540) (-2129.655) [-2123.813] (-2122.440) -- 0:00:19 734500 -- [-2121.020] (-2122.162) (-2119.610) (-2121.191) * (-2120.103) [-2124.728] (-2126.313) (-2122.829) -- 0:00:19 735000 -- [-2120.220] (-2122.245) (-2119.130) (-2119.912) * (-2120.985) (-2120.462) (-2125.783) [-2122.159] -- 0:00:19 Average standard deviation of split frequencies: 0.011409 735500 -- (-2120.809) (-2121.982) [-2119.159] (-2125.443) * (-2123.552) (-2125.119) [-2122.464] (-2122.698) -- 0:00:19 736000 -- (-2120.255) (-2120.056) [-2120.522] (-2123.711) * (-2120.602) (-2121.252) [-2120.271] (-2122.756) -- 0:00:19 736500 -- (-2119.720) (-2122.656) [-2122.884] (-2120.918) * [-2119.883] (-2124.126) (-2121.665) (-2122.247) -- 0:00:18 737000 -- (-2120.466) (-2126.299) (-2126.343) [-2120.821] * [-2120.750] (-2119.260) (-2121.961) (-2120.079) -- 0:00:18 737500 -- (-2120.541) (-2123.353) (-2119.228) [-2120.673] * (-2123.573) [-2119.181] (-2124.161) (-2119.848) -- 0:00:18 738000 -- [-2120.108] (-2120.044) (-2119.856) (-2125.956) * (-2121.876) (-2129.308) (-2123.056) [-2120.566] -- 0:00:18 738500 -- (-2120.007) (-2122.944) (-2123.039) [-2119.316] * (-2120.723) [-2123.319] (-2120.883) (-2122.558) -- 0:00:18 739000 -- (-2119.556) (-2119.492) [-2122.773] (-2119.329) * (-2121.008) (-2124.010) (-2120.761) [-2119.805] -- 0:00:18 739500 -- (-2119.560) [-2120.841] (-2120.720) (-2123.708) * [-2121.278] (-2119.967) (-2124.042) (-2121.000) -- 0:00:18 740000 -- [-2119.551] (-2121.141) (-2121.527) (-2124.279) * (-2121.859) [-2121.038] (-2121.851) (-2122.136) -- 0:00:18 Average standard deviation of split frequencies: 0.011775 740500 -- (-2120.010) (-2121.759) (-2122.107) [-2122.487] * (-2120.309) (-2120.448) (-2121.620) [-2120.288] -- 0:00:18 741000 -- (-2120.036) (-2121.933) (-2121.508) [-2121.953] * (-2121.118) (-2124.259) [-2119.829] (-2121.563) -- 0:00:18 741500 -- (-2120.501) [-2119.603] (-2122.178) (-2120.293) * (-2122.145) [-2121.070] (-2120.594) (-2121.203) -- 0:00:18 742000 -- (-2121.161) [-2121.573] (-2121.575) (-2119.640) * (-2122.979) [-2121.020] (-2121.530) (-2122.681) -- 0:00:18 742500 -- (-2121.236) (-2122.096) [-2121.730] (-2119.400) * [-2121.070] (-2119.218) (-2125.691) (-2124.273) -- 0:00:18 743000 -- (-2121.531) (-2120.162) [-2120.250] (-2122.321) * (-2124.732) (-2120.790) [-2119.967] (-2119.964) -- 0:00:18 743500 -- (-2132.266) (-2123.163) (-2119.864) [-2124.483] * (-2122.237) [-2120.039] (-2119.806) (-2118.998) -- 0:00:18 744000 -- (-2131.984) (-2121.897) (-2120.712) [-2119.366] * (-2120.600) (-2121.938) [-2120.136] (-2118.998) -- 0:00:18 744500 -- (-2128.349) (-2121.328) [-2125.293] (-2120.473) * [-2119.632] (-2122.047) (-2121.421) (-2120.432) -- 0:00:18 745000 -- (-2122.980) (-2119.412) [-2126.846] (-2120.339) * [-2120.670] (-2120.366) (-2122.576) (-2121.288) -- 0:00:18 Average standard deviation of split frequencies: 0.011572 745500 -- (-2120.044) [-2119.950] (-2120.229) (-2121.613) * (-2122.197) (-2124.507) [-2119.980] (-2124.490) -- 0:00:18 746000 -- (-2119.330) (-2121.567) [-2119.037] (-2124.900) * (-2132.802) (-2120.732) (-2121.770) [-2122.279] -- 0:00:18 746500 -- [-2119.665] (-2124.534) (-2122.134) (-2126.460) * (-2124.258) (-2123.963) [-2119.656] (-2122.940) -- 0:00:17 747000 -- (-2120.192) (-2121.959) (-2121.255) [-2122.091] * [-2122.054] (-2121.781) (-2119.716) (-2125.278) -- 0:00:17 747500 -- (-2120.514) [-2120.957] (-2120.616) (-2120.859) * [-2122.245] (-2119.905) (-2119.037) (-2125.900) -- 0:00:18 748000 -- (-2122.737) [-2120.691] (-2120.194) (-2120.500) * (-2121.453) (-2122.151) (-2121.693) [-2121.066] -- 0:00:18 748500 -- (-2123.824) (-2122.023) [-2123.071] (-2120.500) * (-2121.568) (-2119.729) (-2126.166) [-2121.664] -- 0:00:18 749000 -- [-2119.244] (-2121.979) (-2120.581) (-2122.678) * (-2123.459) (-2119.309) (-2122.794) [-2120.828] -- 0:00:18 749500 -- [-2119.246] (-2119.798) (-2121.501) (-2122.375) * (-2123.225) (-2121.867) (-2119.317) [-2120.671] -- 0:00:18 750000 -- (-2119.965) [-2120.147] (-2118.982) (-2121.677) * (-2122.171) (-2119.987) (-2119.903) [-2124.204] -- 0:00:18 Average standard deviation of split frequencies: 0.011775 750500 -- (-2119.014) [-2119.455] (-2123.664) (-2119.854) * (-2122.117) [-2122.568] (-2120.133) (-2120.841) -- 0:00:17 751000 -- (-2122.561) [-2120.996] (-2120.005) (-2119.531) * (-2121.245) (-2123.824) [-2121.986] (-2119.832) -- 0:00:17 751500 -- (-2121.032) [-2120.478] (-2122.823) (-2121.901) * (-2119.590) (-2126.971) [-2120.582] (-2122.648) -- 0:00:17 752000 -- (-2124.350) [-2121.144] (-2120.058) (-2124.273) * (-2122.683) (-2123.154) [-2119.461] (-2120.571) -- 0:00:17 752500 -- [-2121.899] (-2121.391) (-2119.113) (-2123.743) * (-2123.986) (-2121.060) [-2120.672] (-2120.399) -- 0:00:17 753000 -- (-2123.847) (-2124.101) (-2121.643) [-2124.461] * (-2121.503) (-2121.159) (-2123.740) [-2120.397] -- 0:00:17 753500 -- (-2124.667) (-2120.330) (-2119.720) [-2123.580] * (-2122.156) [-2121.091] (-2122.407) (-2120.514) -- 0:00:17 754000 -- (-2120.856) (-2121.646) (-2122.225) [-2119.901] * (-2123.802) [-2119.981] (-2122.221) (-2126.058) -- 0:00:17 754500 -- [-2121.542] (-2122.019) (-2122.979) (-2119.821) * (-2122.963) (-2119.701) [-2120.745] (-2121.839) -- 0:00:17 755000 -- [-2119.590] (-2122.759) (-2122.018) (-2119.618) * (-2120.401) (-2119.136) (-2123.729) [-2121.427] -- 0:00:17 Average standard deviation of split frequencies: 0.011847 755500 -- (-2119.428) (-2122.924) (-2121.688) [-2123.402] * (-2121.109) [-2119.698] (-2121.462) (-2127.137) -- 0:00:17 756000 -- (-2120.334) (-2125.969) [-2121.411] (-2121.812) * (-2120.359) (-2120.380) (-2123.748) [-2123.371] -- 0:00:17 756500 -- (-2120.430) (-2121.078) [-2121.378] (-2119.395) * (-2121.835) (-2121.952) (-2122.228) [-2126.033] -- 0:00:17 757000 -- (-2120.549) (-2120.349) [-2119.945] (-2121.663) * (-2123.422) (-2120.559) [-2123.541] (-2122.168) -- 0:00:17 757500 -- [-2121.200] (-2120.849) (-2119.942) (-2121.052) * (-2120.701) [-2120.612] (-2124.254) (-2126.940) -- 0:00:17 758000 -- [-2122.030] (-2119.178) (-2119.905) (-2122.077) * [-2120.702] (-2121.322) (-2123.032) (-2125.059) -- 0:00:17 758500 -- [-2120.198] (-2120.885) (-2125.286) (-2119.790) * [-2119.292] (-2119.770) (-2119.313) (-2123.866) -- 0:00:17 759000 -- [-2121.807] (-2122.489) (-2121.680) (-2121.433) * (-2120.714) [-2123.268] (-2120.615) (-2122.934) -- 0:00:17 759500 -- (-2120.141) (-2119.881) (-2123.902) [-2121.271] * [-2119.821] (-2123.153) (-2119.605) (-2122.317) -- 0:00:17 760000 -- [-2125.487] (-2118.906) (-2123.243) (-2123.468) * (-2120.597) (-2122.020) [-2119.799] (-2122.473) -- 0:00:17 Average standard deviation of split frequencies: 0.011816 760500 -- [-2120.207] (-2121.020) (-2120.152) (-2120.219) * [-2119.252] (-2122.059) (-2119.799) (-2124.008) -- 0:00:17 761000 -- (-2123.083) (-2122.735) [-2119.728] (-2121.484) * [-2120.013] (-2119.021) (-2123.207) (-2121.789) -- 0:00:17 761500 -- (-2121.102) (-2121.328) [-2120.077] (-2121.222) * [-2120.859] (-2118.929) (-2120.050) (-2121.091) -- 0:00:17 762000 -- (-2122.540) (-2121.578) [-2120.644] (-2120.802) * [-2118.823] (-2119.276) (-2119.627) (-2124.375) -- 0:00:17 762500 -- (-2119.350) (-2123.410) [-2120.036] (-2121.472) * (-2123.271) (-2119.249) [-2119.836] (-2123.973) -- 0:00:17 763000 -- (-2119.947) [-2119.339] (-2120.456) (-2121.164) * [-2122.336] (-2120.303) (-2121.534) (-2119.757) -- 0:00:17 763500 -- (-2119.203) (-2119.303) (-2121.311) [-2121.174] * [-2119.556] (-2122.259) (-2119.383) (-2120.401) -- 0:00:17 764000 -- (-2120.268) [-2121.663] (-2121.547) (-2119.914) * [-2119.805] (-2120.156) (-2122.362) (-2119.277) -- 0:00:16 764500 -- (-2120.239) (-2123.658) [-2119.459] (-2121.826) * (-2120.463) (-2119.337) [-2121.616] (-2119.480) -- 0:00:16 765000 -- (-2118.822) [-2120.385] (-2120.067) (-2120.340) * (-2124.142) [-2120.465] (-2120.624) (-2119.439) -- 0:00:16 Average standard deviation of split frequencies: 0.011324 765500 -- [-2119.890] (-2120.001) (-2121.602) (-2120.263) * (-2121.286) [-2120.441] (-2122.615) (-2119.863) -- 0:00:16 766000 -- (-2119.842) (-2120.010) [-2120.157] (-2121.199) * (-2123.391) [-2121.097] (-2119.510) (-2119.415) -- 0:00:16 766500 -- (-2119.927) [-2120.399] (-2119.514) (-2123.543) * [-2118.807] (-2121.278) (-2119.282) (-2119.036) -- 0:00:16 767000 -- (-2120.824) [-2119.481] (-2120.229) (-2122.613) * (-2122.078) (-2121.112) [-2122.241] (-2119.022) -- 0:00:16 767500 -- (-2119.214) (-2122.396) [-2119.927] (-2121.226) * (-2124.905) (-2121.652) (-2122.631) [-2118.644] -- 0:00:16 768000 -- (-2121.937) (-2121.915) [-2120.276] (-2124.135) * (-2122.358) (-2121.332) [-2123.897] (-2118.777) -- 0:00:16 768500 -- (-2121.516) [-2120.737] (-2119.469) (-2123.074) * [-2121.740] (-2119.956) (-2122.691) (-2119.018) -- 0:00:16 769000 -- (-2121.292) (-2125.800) (-2123.498) [-2120.268] * (-2119.978) [-2120.853] (-2123.856) (-2119.522) -- 0:00:16 769500 -- (-2119.549) [-2121.590] (-2119.784) (-2120.750) * (-2119.512) [-2119.030] (-2123.560) (-2125.671) -- 0:00:16 770000 -- (-2123.241) [-2119.135] (-2120.110) (-2126.166) * (-2119.026) (-2119.136) (-2127.105) [-2121.340] -- 0:00:16 Average standard deviation of split frequencies: 0.011785 770500 -- (-2123.127) [-2120.481] (-2119.970) (-2123.053) * (-2119.583) (-2121.354) (-2123.327) [-2121.553] -- 0:00:16 771000 -- (-2125.474) (-2121.091) [-2120.520] (-2124.502) * (-2119.366) (-2121.609) (-2125.000) [-2120.304] -- 0:00:16 771500 -- (-2124.093) (-2121.146) [-2119.396] (-2125.724) * (-2119.528) [-2120.244] (-2121.477) (-2120.596) -- 0:00:16 772000 -- [-2120.964] (-2120.545) (-2119.736) (-2120.481) * (-2121.513) [-2119.393] (-2123.673) (-2122.303) -- 0:00:16 772500 -- [-2120.232] (-2118.748) (-2119.994) (-2121.640) * (-2122.456) [-2121.890] (-2126.387) (-2120.957) -- 0:00:16 773000 -- (-2120.967) (-2120.930) (-2119.727) [-2122.596] * [-2120.687] (-2122.966) (-2125.429) (-2119.389) -- 0:00:16 773500 -- (-2121.067) (-2121.659) (-2119.674) [-2119.319] * (-2121.561) (-2123.448) (-2121.258) [-2121.234] -- 0:00:16 774000 -- [-2123.047] (-2121.336) (-2121.180) (-2122.717) * (-2121.140) (-2123.063) [-2120.209] (-2120.191) -- 0:00:16 774500 -- (-2120.052) [-2122.211] (-2122.451) (-2119.276) * (-2121.647) (-2119.848) [-2122.053] (-2120.883) -- 0:00:16 775000 -- [-2119.941] (-2119.622) (-2121.396) (-2120.625) * (-2121.408) (-2121.905) (-2122.362) [-2119.703] -- 0:00:16 Average standard deviation of split frequencies: 0.011502 775500 -- [-2119.337] (-2120.321) (-2132.004) (-2119.208) * [-2120.711] (-2120.335) (-2120.219) (-2121.611) -- 0:00:16 776000 -- [-2120.573] (-2120.818) (-2120.309) (-2120.241) * (-2122.179) (-2121.378) [-2120.488] (-2121.394) -- 0:00:16 776500 -- (-2120.357) (-2126.063) [-2121.501] (-2122.657) * (-2121.049) [-2122.187] (-2127.106) (-2121.246) -- 0:00:16 777000 -- (-2119.625) (-2124.701) [-2120.704] (-2120.621) * (-2120.858) (-2124.456) (-2121.207) [-2119.649] -- 0:00:16 777500 -- (-2120.075) (-2127.788) (-2120.140) [-2124.784] * [-2122.711] (-2121.938) (-2123.174) (-2121.587) -- 0:00:16 778000 -- (-2120.451) [-2123.805] (-2120.772) (-2124.271) * (-2123.150) [-2122.754] (-2121.087) (-2124.151) -- 0:00:15 778500 -- (-2120.560) (-2121.279) [-2119.576] (-2121.632) * (-2121.096) (-2119.324) (-2121.052) [-2120.504] -- 0:00:15 779000 -- (-2119.895) [-2119.480] (-2119.044) (-2125.518) * [-2119.923] (-2120.476) (-2121.551) (-2119.558) -- 0:00:15 779500 -- [-2119.473] (-2120.570) (-2118.600) (-2125.921) * (-2119.072) [-2119.809] (-2122.043) (-2120.195) -- 0:00:15 780000 -- (-2119.933) [-2121.208] (-2121.840) (-2125.034) * (-2120.762) (-2120.105) (-2120.394) [-2119.604] -- 0:00:15 Average standard deviation of split frequencies: 0.011594 780500 -- (-2120.803) (-2124.222) (-2119.591) [-2121.934] * [-2120.990] (-2120.260) (-2123.734) (-2120.150) -- 0:00:15 781000 -- (-2122.133) (-2120.689) [-2120.152] (-2124.291) * (-2121.942) (-2121.070) [-2120.836] (-2120.885) -- 0:00:15 781500 -- (-2119.142) (-2121.755) (-2123.298) [-2120.276] * [-2121.370] (-2120.912) (-2123.380) (-2119.612) -- 0:00:15 782000 -- (-2124.434) (-2119.434) (-2120.392) [-2122.534] * (-2121.395) (-2120.329) [-2119.361] (-2119.434) -- 0:00:15 782500 -- (-2118.869) (-2122.991) (-2121.381) [-2122.673] * (-2118.968) (-2120.293) (-2122.120) [-2120.204] -- 0:00:15 783000 -- (-2122.041) (-2119.372) (-2121.146) [-2120.736] * (-2121.586) (-2122.417) (-2122.579) [-2120.806] -- 0:00:15 783500 -- (-2120.534) [-2121.880] (-2120.680) (-2123.531) * (-2123.380) (-2123.650) [-2120.695] (-2122.068) -- 0:00:15 784000 -- (-2120.323) (-2120.596) [-2123.172] (-2121.600) * [-2120.166] (-2121.774) (-2119.643) (-2123.549) -- 0:00:15 784500 -- (-2122.611) (-2121.041) (-2122.600) [-2121.592] * (-2121.365) [-2122.916] (-2121.805) (-2123.964) -- 0:00:15 785000 -- [-2124.649] (-2123.201) (-2121.758) (-2126.824) * (-2120.372) (-2123.997) [-2121.337] (-2120.056) -- 0:00:15 Average standard deviation of split frequencies: 0.011115 785500 -- (-2120.802) [-2120.551] (-2121.874) (-2123.053) * [-2122.788] (-2119.763) (-2125.911) (-2119.945) -- 0:00:15 786000 -- (-2122.856) [-2121.013] (-2120.153) (-2121.517) * (-2119.821) [-2121.194] (-2125.997) (-2119.762) -- 0:00:15 786500 -- (-2123.843) (-2119.166) [-2121.598] (-2121.965) * (-2120.626) (-2120.348) (-2122.583) [-2120.029] -- 0:00:15 787000 -- (-2122.657) (-2121.515) (-2120.734) [-2120.872] * (-2121.287) (-2119.387) [-2119.850] (-2125.037) -- 0:00:15 787500 -- (-2120.662) (-2125.858) (-2120.390) [-2119.130] * [-2120.096] (-2120.159) (-2121.556) (-2120.751) -- 0:00:15 788000 -- [-2119.363] (-2126.010) (-2120.889) (-2122.474) * (-2120.113) (-2123.409) [-2119.973] (-2120.065) -- 0:00:15 788500 -- (-2120.563) (-2120.069) (-2120.120) [-2121.792] * [-2119.618] (-2120.433) (-2121.587) (-2125.477) -- 0:00:15 789000 -- (-2122.737) (-2119.946) [-2120.932] (-2121.322) * (-2122.351) (-2121.337) [-2122.242] (-2121.788) -- 0:00:15 789500 -- (-2121.118) [-2120.999] (-2122.757) (-2120.725) * (-2121.229) (-2126.353) (-2121.478) [-2119.460] -- 0:00:15 790000 -- (-2121.325) (-2120.803) [-2122.270] (-2121.287) * (-2125.019) [-2121.523] (-2120.483) (-2119.618) -- 0:00:15 Average standard deviation of split frequencies: 0.010493 790500 -- [-2123.223] (-2120.844) (-2121.949) (-2123.876) * (-2127.977) [-2119.670] (-2120.158) (-2119.648) -- 0:00:15 791000 -- (-2120.481) (-2120.922) (-2123.179) [-2119.997] * (-2122.474) (-2119.362) (-2125.559) [-2119.049] -- 0:00:15 791500 -- (-2121.032) (-2121.298) (-2121.379) [-2124.873] * (-2120.215) (-2119.882) [-2120.542] (-2119.020) -- 0:00:15 792000 -- (-2120.806) [-2120.408] (-2123.403) (-2121.234) * (-2120.335) (-2121.071) (-2121.258) [-2121.317] -- 0:00:14 792500 -- [-2120.039] (-2124.678) (-2123.645) (-2120.888) * (-2120.612) (-2119.716) (-2122.370) [-2119.915] -- 0:00:14 793000 -- [-2122.372] (-2120.511) (-2122.540) (-2123.285) * (-2120.247) [-2126.321] (-2124.887) (-2120.653) -- 0:00:14 793500 -- [-2120.341] (-2123.539) (-2121.109) (-2119.538) * (-2119.628) (-2131.874) (-2128.608) [-2120.271] -- 0:00:14 794000 -- (-2122.936) [-2120.524] (-2122.701) (-2119.950) * [-2122.243] (-2120.922) (-2119.345) (-2124.695) -- 0:00:14 794500 -- (-2120.071) (-2124.758) [-2122.844] (-2124.860) * (-2121.812) [-2124.889] (-2119.345) (-2127.601) -- 0:00:14 795000 -- [-2122.900] (-2121.873) (-2121.591) (-2121.134) * [-2120.956] (-2125.090) (-2121.417) (-2119.883) -- 0:00:14 Average standard deviation of split frequencies: 0.010778 795500 -- (-2122.954) [-2120.759] (-2122.074) (-2119.525) * (-2121.080) [-2120.373] (-2123.366) (-2122.825) -- 0:00:14 796000 -- [-2123.219] (-2121.667) (-2124.393) (-2120.051) * [-2120.322] (-2120.859) (-2119.653) (-2120.324) -- 0:00:14 796500 -- (-2121.985) [-2120.820] (-2118.860) (-2120.215) * [-2120.911] (-2120.996) (-2124.318) (-2120.008) -- 0:00:14 797000 -- (-2122.670) (-2120.089) [-2119.453] (-2118.787) * (-2123.099) [-2121.152] (-2120.965) (-2120.467) -- 0:00:14 797500 -- (-2120.051) (-2120.223) (-2123.689) [-2120.696] * (-2120.203) [-2122.258] (-2119.619) (-2122.522) -- 0:00:14 798000 -- (-2120.036) (-2120.444) [-2122.465] (-2124.957) * (-2120.802) [-2124.283] (-2120.697) (-2124.850) -- 0:00:14 798500 -- (-2125.448) (-2121.813) (-2122.859) [-2120.783] * (-2120.175) [-2120.966] (-2122.371) (-2120.139) -- 0:00:14 799000 -- [-2121.934] (-2119.447) (-2126.345) (-2120.745) * (-2119.369) (-2120.568) [-2122.230] (-2118.918) -- 0:00:14 799500 -- [-2118.975] (-2119.552) (-2126.551) (-2121.303) * (-2119.790) [-2120.987] (-2121.775) (-2120.858) -- 0:00:14 800000 -- (-2118.948) [-2119.418] (-2120.858) (-2123.499) * [-2121.731] (-2122.134) (-2121.905) (-2119.011) -- 0:00:14 Average standard deviation of split frequencies: 0.010951 800500 -- (-2119.254) [-2119.381] (-2119.296) (-2122.451) * [-2121.323] (-2123.370) (-2121.317) (-2120.243) -- 0:00:14 801000 -- (-2119.284) [-2119.428] (-2119.506) (-2122.354) * (-2121.103) [-2120.109] (-2119.278) (-2120.115) -- 0:00:14 801500 -- (-2120.942) (-2121.078) [-2121.345] (-2121.674) * [-2119.267] (-2120.211) (-2122.995) (-2125.456) -- 0:00:14 802000 -- (-2129.097) (-2121.023) (-2121.303) [-2120.809] * (-2122.543) (-2119.605) (-2123.236) [-2125.794] -- 0:00:14 802500 -- (-2120.967) (-2120.858) [-2120.308] (-2121.459) * (-2121.452) (-2122.338) [-2122.425] (-2126.428) -- 0:00:14 803000 -- [-2120.053] (-2118.810) (-2125.971) (-2123.287) * (-2120.268) (-2121.410) [-2122.290] (-2121.959) -- 0:00:13 803500 -- (-2120.292) (-2118.890) [-2124.399] (-2121.744) * [-2122.512] (-2119.571) (-2121.350) (-2120.423) -- 0:00:13 804000 -- (-2122.395) (-2120.017) (-2121.407) [-2124.733] * (-2120.144) (-2120.869) [-2121.398] (-2120.254) -- 0:00:14 804500 -- (-2122.885) (-2124.946) (-2120.297) [-2122.432] * (-2120.732) (-2122.375) (-2120.829) [-2120.471] -- 0:00:14 805000 -- (-2120.933) [-2120.335] (-2121.461) (-2119.967) * (-2121.154) [-2121.596] (-2120.166) (-2121.366) -- 0:00:14 Average standard deviation of split frequencies: 0.010996 805500 -- (-2122.212) (-2120.145) (-2126.833) [-2120.893] * (-2119.247) [-2119.206] (-2119.777) (-2121.045) -- 0:00:14 806000 -- [-2121.826] (-2120.895) (-2125.889) (-2124.665) * (-2122.283) (-2119.914) [-2120.421] (-2119.725) -- 0:00:13 806500 -- [-2123.940] (-2124.060) (-2118.981) (-2121.502) * (-2120.515) [-2119.312] (-2124.602) (-2121.604) -- 0:00:13 807000 -- (-2120.784) (-2124.577) [-2127.424] (-2120.596) * (-2122.854) [-2121.382] (-2122.017) (-2121.442) -- 0:00:13 807500 -- (-2121.357) (-2122.903) (-2119.652) [-2119.899] * [-2119.147] (-2121.989) (-2121.645) (-2120.986) -- 0:00:13 808000 -- (-2122.144) (-2119.065) [-2119.844] (-2119.949) * (-2119.079) (-2121.241) (-2120.633) [-2120.055] -- 0:00:13 808500 -- (-2121.925) (-2118.880) (-2120.910) [-2119.221] * (-2120.707) (-2120.258) (-2121.307) [-2119.263] -- 0:00:13 809000 -- [-2120.219] (-2119.407) (-2123.826) (-2120.538) * (-2121.095) (-2121.183) [-2122.059] (-2119.049) -- 0:00:13 809500 -- (-2119.514) [-2121.192] (-2125.039) (-2123.798) * (-2121.330) (-2119.834) [-2121.743] (-2119.274) -- 0:00:13 810000 -- [-2122.897] (-2122.355) (-2124.876) (-2122.247) * [-2120.620] (-2119.860) (-2119.906) (-2122.955) -- 0:00:13 Average standard deviation of split frequencies: 0.010816 810500 -- (-2122.049) (-2121.248) [-2122.442] (-2122.004) * [-2119.146] (-2121.400) (-2122.106) (-2123.345) -- 0:00:13 811000 -- (-2122.991) (-2122.259) [-2124.219] (-2122.266) * (-2119.254) (-2120.875) [-2121.409] (-2124.070) -- 0:00:13 811500 -- (-2121.565) (-2122.251) (-2122.643) [-2119.904] * (-2118.881) (-2120.572) [-2119.928] (-2121.095) -- 0:00:13 812000 -- (-2121.867) (-2121.242) [-2119.623] (-2119.822) * [-2118.968] (-2119.632) (-2120.453) (-2122.086) -- 0:00:13 812500 -- [-2119.713] (-2121.473) (-2119.817) (-2120.241) * (-2118.988) (-2120.642) (-2124.526) [-2123.276] -- 0:00:13 813000 -- (-2119.396) (-2120.338) [-2122.307] (-2119.832) * (-2119.494) (-2121.280) (-2123.601) [-2120.048] -- 0:00:13 813500 -- [-2121.232] (-2121.455) (-2121.741) (-2121.791) * [-2119.897] (-2119.781) (-2122.936) (-2120.876) -- 0:00:13 814000 -- (-2121.670) (-2120.140) [-2121.235] (-2119.740) * (-2119.959) (-2119.606) [-2126.329] (-2119.531) -- 0:00:13 814500 -- [-2119.621] (-2122.258) (-2121.400) (-2121.334) * (-2121.087) (-2121.876) [-2119.519] (-2119.199) -- 0:00:13 815000 -- (-2121.762) (-2123.040) [-2121.310] (-2120.950) * (-2121.973) [-2119.323] (-2122.063) (-2119.673) -- 0:00:13 Average standard deviation of split frequencies: 0.010861 815500 -- (-2121.896) [-2120.296] (-2121.084) (-2119.467) * (-2121.250) [-2119.455] (-2119.568) (-2121.153) -- 0:00:13 816000 -- (-2121.609) (-2120.353) (-2121.719) [-2120.140] * (-2121.989) (-2120.135) [-2122.009] (-2119.372) -- 0:00:13 816500 -- (-2121.588) (-2119.118) (-2121.322) [-2119.319] * (-2124.646) [-2121.121] (-2119.791) (-2120.502) -- 0:00:13 817000 -- (-2119.944) (-2120.155) (-2119.814) [-2119.197] * [-2123.811] (-2122.578) (-2119.671) (-2124.234) -- 0:00:12 817500 -- (-2119.430) (-2120.528) (-2120.255) [-2120.249] * (-2123.411) [-2120.184] (-2120.545) (-2121.800) -- 0:00:12 818000 -- [-2120.867] (-2122.236) (-2120.000) (-2120.110) * [-2120.701] (-2120.140) (-2125.404) (-2121.462) -- 0:00:12 818500 -- [-2121.964] (-2123.011) (-2121.984) (-2119.531) * (-2121.150) [-2119.792] (-2123.514) (-2119.264) -- 0:00:12 819000 -- (-2119.801) (-2123.017) [-2121.606] (-2121.280) * (-2121.304) [-2122.455] (-2124.932) (-2120.813) -- 0:00:13 819500 -- [-2119.802] (-2120.727) (-2120.355) (-2121.449) * (-2120.131) (-2119.620) [-2126.845] (-2120.813) -- 0:00:12 820000 -- [-2120.114] (-2119.964) (-2123.329) (-2122.873) * (-2119.754) [-2120.044] (-2121.250) (-2122.555) -- 0:00:12 Average standard deviation of split frequencies: 0.011029 820500 -- (-2119.727) [-2119.728] (-2123.318) (-2121.394) * (-2122.682) [-2121.509] (-2119.065) (-2122.431) -- 0:00:12 821000 -- [-2122.428] (-2120.043) (-2121.398) (-2120.332) * (-2120.866) (-2120.124) [-2120.951] (-2121.596) -- 0:00:12 821500 -- (-2122.593) [-2119.562] (-2120.634) (-2121.524) * (-2122.636) (-2122.936) [-2118.968] (-2122.622) -- 0:00:12 822000 -- (-2122.151) [-2121.176] (-2125.215) (-2119.812) * (-2122.780) (-2121.407) (-2119.048) [-2120.720] -- 0:00:12 822500 -- [-2121.228] (-2120.979) (-2123.190) (-2119.283) * (-2122.819) (-2121.103) [-2120.289] (-2124.636) -- 0:00:12 823000 -- (-2119.674) (-2121.550) (-2122.679) [-2120.722] * (-2120.766) [-2121.131] (-2125.075) (-2122.822) -- 0:00:12 823500 -- [-2119.253] (-2121.636) (-2124.072) (-2125.121) * [-2121.668] (-2120.216) (-2121.396) (-2121.183) -- 0:00:12 824000 -- [-2119.031] (-2122.931) (-2120.922) (-2121.913) * (-2121.980) [-2120.670] (-2120.594) (-2120.859) -- 0:00:12 824500 -- (-2119.566) [-2122.271] (-2120.250) (-2119.626) * (-2122.799) [-2122.609] (-2119.901) (-2120.123) -- 0:00:12 825000 -- (-2120.246) (-2124.815) [-2121.301] (-2121.341) * (-2125.293) [-2119.330] (-2119.709) (-2120.883) -- 0:00:12 Average standard deviation of split frequencies: 0.011110 825500 -- (-2119.404) [-2119.567] (-2124.601) (-2121.718) * (-2121.518) (-2121.836) [-2119.290] (-2120.891) -- 0:00:12 826000 -- (-2119.382) (-2123.745) (-2122.408) [-2122.386] * (-2121.329) (-2120.322) [-2120.802] (-2119.917) -- 0:00:12 826500 -- (-2120.187) [-2119.579] (-2121.972) (-2124.606) * (-2120.451) (-2120.557) [-2124.287] (-2118.859) -- 0:00:12 827000 -- (-2119.272) [-2119.130] (-2120.070) (-2125.067) * [-2119.210] (-2121.189) (-2120.587) (-2118.622) -- 0:00:12 827500 -- (-2121.928) (-2124.787) [-2119.945] (-2124.775) * [-2121.301] (-2119.743) (-2119.966) (-2120.016) -- 0:00:12 828000 -- (-2122.747) [-2122.159] (-2121.863) (-2124.323) * (-2120.302) [-2120.887] (-2123.752) (-2123.021) -- 0:00:12 828500 -- (-2120.007) (-2121.661) [-2120.598] (-2125.096) * (-2119.519) (-2121.289) [-2121.621] (-2123.281) -- 0:00:12 829000 -- (-2119.557) [-2119.778] (-2119.968) (-2121.690) * (-2120.849) (-2119.685) (-2121.340) [-2120.310] -- 0:00:12 829500 -- [-2119.413] (-2120.189) (-2119.233) (-2121.699) * (-2120.714) [-2119.676] (-2119.015) (-2120.042) -- 0:00:12 830000 -- (-2120.097) [-2120.071] (-2121.445) (-2120.543) * (-2120.312) (-2119.829) (-2119.461) [-2119.040] -- 0:00:12 Average standard deviation of split frequencies: 0.010858 830500 -- (-2121.563) (-2120.132) (-2126.603) [-2120.253] * (-2120.793) (-2118.772) [-2119.682] (-2118.850) -- 0:00:12 831000 -- (-2121.079) (-2120.943) [-2124.776] (-2119.911) * (-2122.835) (-2119.503) (-2120.335) [-2118.887] -- 0:00:11 831500 -- [-2121.249] (-2119.868) (-2123.518) (-2120.006) * [-2119.657] (-2119.993) (-2121.023) (-2121.065) -- 0:00:11 832000 -- (-2122.393) (-2124.092) (-2121.509) [-2120.092] * [-2121.001] (-2123.857) (-2120.035) (-2121.007) -- 0:00:12 832500 -- (-2120.252) (-2123.560) [-2121.462] (-2122.093) * [-2121.108] (-2123.801) (-2120.665) (-2123.965) -- 0:00:12 833000 -- [-2119.754] (-2123.099) (-2120.955) (-2122.419) * (-2121.773) (-2124.602) [-2120.428] (-2124.010) -- 0:00:12 833500 -- (-2123.671) (-2121.178) (-2124.314) [-2123.139] * (-2119.202) (-2121.616) [-2120.456] (-2121.242) -- 0:00:11 834000 -- (-2119.496) [-2119.787] (-2120.297) (-2120.736) * (-2119.325) [-2121.209] (-2120.041) (-2122.001) -- 0:00:11 834500 -- (-2120.266) [-2119.400] (-2120.639) (-2121.428) * (-2123.104) [-2119.093] (-2124.407) (-2120.702) -- 0:00:11 835000 -- (-2120.790) (-2121.664) [-2121.154] (-2119.489) * (-2128.971) (-2122.551) (-2123.755) [-2126.868] -- 0:00:11 Average standard deviation of split frequencies: 0.010939 835500 -- [-2121.189] (-2120.558) (-2120.711) (-2119.261) * [-2121.357] (-2120.389) (-2124.356) (-2126.000) -- 0:00:11 836000 -- [-2120.600] (-2121.353) (-2121.210) (-2121.478) * (-2126.473) [-2121.458] (-2127.387) (-2127.778) -- 0:00:11 836500 -- (-2120.504) [-2123.817] (-2122.341) (-2119.146) * [-2123.470] (-2119.686) (-2126.796) (-2131.911) -- 0:00:11 837000 -- (-2119.050) (-2122.303) (-2120.489) [-2119.470] * (-2122.960) (-2118.842) [-2120.458] (-2124.800) -- 0:00:11 837500 -- (-2122.845) (-2122.110) [-2122.926] (-2119.614) * (-2122.137) (-2119.967) [-2121.341] (-2121.123) -- 0:00:11 838000 -- (-2121.165) [-2124.385] (-2121.874) (-2118.702) * (-2120.796) (-2122.079) (-2120.526) [-2119.756] -- 0:00:11 838500 -- (-2120.801) [-2124.594] (-2126.130) (-2118.672) * (-2120.450) (-2120.790) (-2124.275) [-2120.739] -- 0:00:11 839000 -- (-2122.136) (-2119.630) [-2119.894] (-2120.464) * [-2120.757] (-2120.808) (-2121.837) (-2120.986) -- 0:00:11 839500 -- [-2123.535] (-2120.297) (-2122.218) (-2119.021) * (-2123.337) (-2123.443) [-2119.291] (-2121.981) -- 0:00:11 840000 -- [-2122.676] (-2120.191) (-2120.219) (-2118.913) * [-2123.044] (-2120.722) (-2119.383) (-2123.581) -- 0:00:11 Average standard deviation of split frequencies: 0.010542 840500 -- (-2124.650) [-2120.456] (-2122.209) (-2120.828) * [-2121.986] (-2119.383) (-2122.530) (-2121.025) -- 0:00:11 841000 -- [-2122.877] (-2119.929) (-2120.328) (-2121.430) * (-2121.216) (-2119.637) (-2122.880) [-2120.539] -- 0:00:11 841500 -- (-2121.052) [-2120.562] (-2120.070) (-2130.726) * (-2121.413) (-2119.854) (-2119.769) [-2121.765] -- 0:00:11 842000 -- (-2120.727) [-2122.011] (-2120.006) (-2120.966) * [-2119.207] (-2120.676) (-2119.838) (-2119.474) -- 0:00:11 842500 -- (-2123.135) (-2120.993) [-2120.691] (-2121.426) * (-2122.528) [-2119.102] (-2120.987) (-2124.107) -- 0:00:11 843000 -- (-2120.502) (-2120.863) [-2120.029] (-2121.063) * (-2119.562) (-2122.098) [-2125.123] (-2120.402) -- 0:00:11 843500 -- [-2120.397] (-2122.650) (-2121.949) (-2125.422) * (-2121.412) (-2120.729) (-2123.766) [-2119.350] -- 0:00:11 844000 -- [-2120.491] (-2122.978) (-2123.096) (-2120.012) * (-2121.605) (-2120.605) [-2120.914] (-2121.204) -- 0:00:11 844500 -- (-2123.749) [-2121.291] (-2123.285) (-2120.626) * [-2122.051] (-2120.296) (-2120.863) (-2122.270) -- 0:00:11 845000 -- (-2120.281) (-2120.627) (-2121.550) [-2122.271] * [-2121.278] (-2122.152) (-2121.483) (-2122.369) -- 0:00:11 Average standard deviation of split frequencies: 0.010327 845500 -- [-2123.721] (-2119.553) (-2119.412) (-2123.988) * [-2121.043] (-2120.700) (-2120.569) (-2121.080) -- 0:00:11 846000 -- (-2121.814) (-2122.338) [-2119.498] (-2125.251) * [-2122.140] (-2119.319) (-2119.296) (-2122.557) -- 0:00:11 846500 -- (-2121.814) [-2122.817] (-2127.252) (-2124.032) * (-2121.364) (-2120.330) [-2121.207] (-2122.986) -- 0:00:11 847000 -- (-2121.791) (-2119.922) (-2122.273) [-2121.355] * [-2122.127] (-2121.556) (-2120.703) (-2123.092) -- 0:00:11 847500 -- [-2119.530] (-2122.854) (-2121.687) (-2121.844) * (-2122.349) (-2120.056) [-2121.997] (-2121.538) -- 0:00:10 848000 -- [-2121.767] (-2125.710) (-2120.320) (-2119.910) * (-2121.881) [-2120.417] (-2123.062) (-2121.918) -- 0:00:10 848500 -- [-2119.240] (-2121.738) (-2119.854) (-2118.825) * (-2122.621) [-2118.901] (-2121.253) (-2122.382) -- 0:00:10 849000 -- [-2120.496] (-2123.196) (-2120.304) (-2119.605) * (-2120.392) (-2120.776) [-2120.195] (-2119.477) -- 0:00:10 849500 -- (-2118.682) (-2120.716) [-2119.551] (-2120.611) * (-2120.976) (-2120.446) (-2120.988) [-2119.626] -- 0:00:10 850000 -- [-2119.635] (-2125.151) (-2119.324) (-2123.750) * (-2119.963) (-2119.406) (-2123.250) [-2121.956] -- 0:00:10 Average standard deviation of split frequencies: 0.010492 850500 -- (-2123.518) [-2125.987] (-2121.326) (-2120.384) * (-2125.017) (-2122.997) (-2121.820) [-2120.584] -- 0:00:10 851000 -- (-2120.573) (-2124.915) [-2122.248] (-2121.891) * (-2121.850) (-2127.359) [-2121.304] (-2123.322) -- 0:00:10 851500 -- (-2119.468) (-2119.558) [-2123.198] (-2123.804) * [-2120.935] (-2126.944) (-2119.959) (-2120.484) -- 0:00:10 852000 -- (-2121.755) [-2120.009] (-2124.420) (-2122.008) * (-2123.106) (-2121.782) [-2119.462] (-2119.070) -- 0:00:10 852500 -- (-2120.282) (-2122.421) (-2123.659) [-2122.269] * [-2119.731] (-2120.078) (-2119.789) (-2119.455) -- 0:00:10 853000 -- (-2123.208) [-2119.271] (-2123.202) (-2123.408) * [-2119.301] (-2119.549) (-2120.822) (-2120.343) -- 0:00:10 853500 -- (-2122.319) (-2119.715) [-2120.046] (-2121.230) * (-2119.459) [-2119.666] (-2122.557) (-2120.567) -- 0:00:10 854000 -- (-2122.314) (-2120.438) (-2120.141) [-2120.829] * [-2119.164] (-2120.579) (-2121.628) (-2119.970) -- 0:00:10 854500 -- (-2122.543) (-2120.618) [-2119.537] (-2120.358) * (-2120.314) (-2121.883) [-2122.235] (-2120.233) -- 0:00:10 855000 -- [-2120.808] (-2124.695) (-2120.205) (-2121.583) * (-2121.888) (-2120.954) (-2120.614) [-2118.849] -- 0:00:10 Average standard deviation of split frequencies: 0.009839 855500 -- (-2121.009) (-2123.114) [-2121.961] (-2121.389) * (-2119.461) [-2120.305] (-2123.002) (-2125.627) -- 0:00:10 856000 -- (-2121.653) (-2120.664) (-2119.597) [-2120.625] * (-2120.323) (-2119.153) (-2120.758) [-2119.646] -- 0:00:10 856500 -- (-2120.270) [-2121.631] (-2120.995) (-2123.437) * (-2123.278) [-2122.021] (-2121.043) (-2124.779) -- 0:00:10 857000 -- (-2122.394) (-2122.417) [-2119.979] (-2119.310) * (-2120.210) (-2122.447) [-2121.888] (-2121.947) -- 0:00:10 857500 -- (-2120.075) (-2125.766) (-2123.042) [-2119.002] * (-2120.092) (-2120.772) [-2121.978] (-2121.559) -- 0:00:10 858000 -- (-2119.510) [-2121.495] (-2119.581) (-2118.841) * (-2120.964) (-2124.231) (-2122.693) [-2119.988] -- 0:00:10 858500 -- (-2119.251) (-2119.114) [-2127.094] (-2119.317) * [-2119.409] (-2119.349) (-2123.099) (-2120.654) -- 0:00:10 859000 -- (-2122.759) (-2121.504) [-2119.873] (-2121.085) * (-2119.868) [-2119.575] (-2121.561) (-2121.791) -- 0:00:10 859500 -- (-2121.714) (-2120.722) (-2123.613) [-2120.901] * [-2119.322] (-2121.021) (-2121.437) (-2120.904) -- 0:00:10 860000 -- (-2123.735) (-2122.252) [-2120.714] (-2121.319) * (-2120.816) (-2123.051) (-2120.183) [-2123.265] -- 0:00:10 Average standard deviation of split frequencies: 0.009859 860500 -- (-2122.280) [-2120.052] (-2121.666) (-2120.732) * [-2121.555] (-2122.001) (-2120.962) (-2120.896) -- 0:00:10 861000 -- [-2119.608] (-2120.307) (-2121.600) (-2121.074) * (-2121.064) (-2125.140) [-2122.583] (-2120.852) -- 0:00:10 861500 -- (-2119.621) (-2121.463) (-2124.038) [-2121.137] * (-2119.083) (-2121.161) (-2120.026) [-2121.434] -- 0:00:09 862000 -- (-2120.210) [-2120.372] (-2121.358) (-2124.130) * (-2120.385) (-2120.040) [-2121.107] (-2120.630) -- 0:00:09 862500 -- (-2121.221) (-2119.282) [-2121.461] (-2121.166) * (-2119.371) (-2120.743) (-2121.486) [-2120.590] -- 0:00:09 863000 -- (-2119.892) (-2125.183) [-2120.216] (-2121.164) * (-2122.074) (-2123.321) (-2121.020) [-2119.847] -- 0:00:09 863500 -- (-2119.593) (-2122.882) (-2121.125) [-2120.000] * (-2120.775) (-2119.845) (-2120.220) [-2120.535] -- 0:00:09 864000 -- [-2120.529] (-2121.390) (-2123.050) (-2120.368) * [-2120.593] (-2119.987) (-2120.602) (-2123.283) -- 0:00:09 864500 -- (-2119.889) (-2120.750) (-2119.784) [-2119.979] * (-2122.451) (-2121.473) [-2121.768] (-2126.056) -- 0:00:09 865000 -- (-2119.138) [-2122.056] (-2119.356) (-2120.417) * [-2121.368] (-2120.125) (-2121.906) (-2122.875) -- 0:00:09 Average standard deviation of split frequencies: 0.010197 865500 -- (-2121.139) (-2121.999) [-2120.905] (-2121.705) * (-2119.447) (-2121.224) [-2119.266] (-2119.485) -- 0:00:09 866000 -- (-2119.942) (-2120.172) [-2120.670] (-2120.484) * (-2120.392) (-2120.104) (-2122.072) [-2119.197] -- 0:00:09 866500 -- (-2119.795) [-2119.823] (-2120.260) (-2123.934) * (-2120.379) (-2119.728) [-2122.760] (-2121.136) -- 0:00:09 867000 -- [-2120.463] (-2120.172) (-2121.338) (-2122.261) * [-2120.402] (-2123.120) (-2120.063) (-2118.693) -- 0:00:09 867500 -- (-2120.384) [-2122.227] (-2118.814) (-2119.616) * [-2121.051] (-2120.918) (-2121.421) (-2125.091) -- 0:00:09 868000 -- (-2122.297) (-2125.366) (-2119.479) [-2119.943] * (-2126.089) [-2119.782] (-2121.209) (-2121.257) -- 0:00:09 868500 -- (-2120.414) (-2122.911) (-2119.667) [-2119.014] * [-2120.093] (-2122.297) (-2120.973) (-2120.843) -- 0:00:09 869000 -- (-2120.414) (-2120.048) (-2119.870) [-2120.693] * (-2121.240) [-2121.385] (-2119.358) (-2122.891) -- 0:00:09 869500 -- (-2119.323) (-2120.544) (-2119.917) [-2122.498] * (-2125.740) (-2124.375) (-2120.930) [-2119.764] -- 0:00:09 870000 -- (-2119.187) [-2120.425] (-2121.402) (-2121.870) * (-2119.442) (-2126.237) (-2123.255) [-2123.415] -- 0:00:09 Average standard deviation of split frequencies: 0.009818 870500 -- (-2121.137) (-2121.585) [-2120.021] (-2120.939) * [-2119.443] (-2124.968) (-2123.204) (-2121.897) -- 0:00:09 871000 -- [-2121.714] (-2122.158) (-2122.942) (-2119.417) * (-2122.306) (-2122.321) (-2123.033) [-2121.419] -- 0:00:09 871500 -- (-2121.669) (-2121.959) [-2119.505] (-2119.585) * (-2119.697) (-2122.202) (-2120.258) [-2125.059] -- 0:00:09 872000 -- (-2120.373) [-2122.764] (-2127.227) (-2119.909) * (-2119.627) [-2124.733] (-2121.004) (-2124.647) -- 0:00:09 872500 -- (-2120.435) (-2123.313) (-2123.959) [-2122.287] * (-2121.327) [-2121.129] (-2122.758) (-2120.526) -- 0:00:09 873000 -- (-2120.405) (-2120.809) [-2120.469] (-2125.990) * (-2122.180) [-2121.177] (-2121.688) (-2120.415) -- 0:00:09 873500 -- (-2119.505) (-2122.554) [-2120.968] (-2120.583) * [-2120.996] (-2120.357) (-2120.879) (-2119.254) -- 0:00:09 874000 -- [-2119.505] (-2122.215) (-2128.473) (-2123.971) * (-2119.362) (-2120.516) (-2122.905) [-2119.729] -- 0:00:09 874500 -- [-2119.908] (-2120.954) (-2121.052) (-2126.753) * (-2120.042) [-2121.129] (-2126.410) (-2120.055) -- 0:00:09 875000 -- [-2122.143] (-2121.751) (-2120.269) (-2123.539) * [-2120.530] (-2124.507) (-2119.803) (-2120.346) -- 0:00:09 Average standard deviation of split frequencies: 0.009651 875500 -- (-2123.133) (-2120.620) (-2119.861) [-2123.365] * (-2122.776) [-2126.332] (-2123.354) (-2122.812) -- 0:00:08 876000 -- (-2125.473) (-2120.677) [-2120.143] (-2127.693) * (-2125.218) (-2126.414) [-2124.545] (-2121.863) -- 0:00:08 876500 -- [-2122.625] (-2118.969) (-2121.597) (-2120.102) * (-2121.828) [-2122.635] (-2121.175) (-2121.364) -- 0:00:08 877000 -- (-2119.984) (-2119.865) [-2122.322] (-2119.074) * [-2121.347] (-2123.144) (-2121.682) (-2123.318) -- 0:00:08 877500 -- (-2120.827) (-2120.853) (-2122.058) [-2119.519] * (-2122.441) [-2119.629] (-2121.251) (-2123.280) -- 0:00:08 878000 -- (-2120.534) [-2120.110] (-2119.422) (-2119.337) * [-2120.265] (-2120.868) (-2121.846) (-2121.447) -- 0:00:08 878500 -- [-2120.749] (-2121.253) (-2119.762) (-2123.443) * [-2121.081] (-2124.708) (-2119.706) (-2120.479) -- 0:00:08 879000 -- (-2121.696) [-2122.842] (-2124.718) (-2122.470) * (-2118.943) [-2121.336] (-2119.753) (-2123.603) -- 0:00:08 879500 -- (-2120.381) (-2120.760) [-2120.712] (-2122.217) * [-2118.899] (-2120.497) (-2119.889) (-2125.049) -- 0:00:08 880000 -- [-2120.876] (-2121.888) (-2119.067) (-2122.034) * (-2119.603) (-2119.475) [-2120.033] (-2122.156) -- 0:00:08 Average standard deviation of split frequencies: 0.009385 880500 -- [-2119.729] (-2120.770) (-2119.128) (-2121.708) * (-2121.934) (-2123.725) (-2121.657) [-2119.121] -- 0:00:08 881000 -- (-2121.013) (-2120.716) (-2123.396) [-2119.258] * (-2125.479) (-2123.304) [-2122.699] (-2120.131) -- 0:00:08 881500 -- (-2121.618) (-2121.109) [-2125.141] (-2121.006) * (-2123.627) [-2119.992] (-2123.782) (-2119.531) -- 0:00:08 882000 -- [-2120.096] (-2123.349) (-2124.419) (-2121.755) * (-2121.244) (-2120.570) (-2120.857) [-2119.924] -- 0:00:08 882500 -- [-2126.862] (-2120.751) (-2121.663) (-2121.555) * (-2120.008) [-2121.193] (-2119.536) (-2121.160) -- 0:00:08 883000 -- [-2123.724] (-2121.884) (-2120.807) (-2127.203) * [-2124.344] (-2121.814) (-2120.643) (-2120.484) -- 0:00:08 883500 -- [-2121.096] (-2119.114) (-2122.905) (-2119.460) * (-2123.670) [-2121.479] (-2122.805) (-2121.296) -- 0:00:08 884000 -- [-2119.773] (-2119.799) (-2121.446) (-2119.710) * (-2121.886) (-2121.321) [-2119.937] (-2122.096) -- 0:00:08 884500 -- (-2119.473) (-2120.491) (-2121.693) [-2122.986] * (-2125.139) (-2122.230) [-2119.900] (-2122.249) -- 0:00:08 885000 -- (-2120.559) [-2123.302] (-2120.959) (-2120.750) * (-2122.883) [-2119.372] (-2123.260) (-2125.953) -- 0:00:08 Average standard deviation of split frequencies: 0.009364 885500 -- (-2121.812) (-2132.058) (-2124.025) [-2120.515] * (-2119.058) (-2121.209) [-2120.560] (-2121.813) -- 0:00:08 886000 -- [-2120.045] (-2127.825) (-2122.454) (-2120.917) * [-2119.630] (-2122.626) (-2119.682) (-2119.909) -- 0:00:08 886500 -- (-2120.886) (-2122.660) (-2122.495) [-2120.032] * (-2123.027) [-2124.337] (-2124.415) (-2120.420) -- 0:00:08 887000 -- (-2120.007) (-2125.381) (-2121.651) [-2121.724] * (-2119.695) [-2122.005] (-2124.094) (-2123.743) -- 0:00:08 887500 -- [-2119.004] (-2127.997) (-2121.968) (-2121.894) * [-2120.609] (-2120.872) (-2119.198) (-2120.646) -- 0:00:07 888000 -- (-2120.185) (-2121.018) (-2122.259) [-2120.824] * (-2121.256) (-2121.712) (-2119.693) [-2121.034] -- 0:00:08 888500 -- (-2119.963) (-2121.170) [-2122.730] (-2121.422) * (-2119.136) [-2120.471] (-2121.720) (-2124.567) -- 0:00:08 889000 -- (-2121.167) (-2121.482) (-2121.482) [-2120.067] * (-2121.354) (-2120.769) [-2119.795] (-2119.429) -- 0:00:07 889500 -- (-2120.554) (-2120.038) [-2121.682] (-2119.837) * (-2120.889) (-2121.495) [-2119.884] (-2120.181) -- 0:00:07 890000 -- (-2124.908) (-2119.970) [-2121.182] (-2120.109) * (-2122.048) [-2124.100] (-2120.529) (-2119.886) -- 0:00:07 Average standard deviation of split frequencies: 0.009068 890500 -- (-2124.431) [-2119.884] (-2123.037) (-2120.005) * [-2119.559] (-2122.750) (-2121.421) (-2119.693) -- 0:00:07 891000 -- (-2120.765) (-2119.639) [-2124.687] (-2120.104) * [-2121.301] (-2120.087) (-2121.117) (-2120.588) -- 0:00:07 891500 -- (-2121.420) [-2120.166] (-2121.985) (-2121.922) * (-2119.341) [-2120.177] (-2121.905) (-2122.070) -- 0:00:07 892000 -- (-2121.720) (-2125.702) (-2122.728) [-2125.081] * [-2119.984] (-2123.504) (-2121.348) (-2123.620) -- 0:00:07 892500 -- (-2121.019) (-2122.083) [-2122.553] (-2124.622) * (-2123.979) (-2120.924) [-2121.650] (-2123.156) -- 0:00:07 893000 -- (-2121.251) (-2124.502) (-2121.978) [-2122.153] * (-2122.097) [-2123.305] (-2120.264) (-2123.536) -- 0:00:07 893500 -- [-2121.704] (-2124.497) (-2120.414) (-2122.765) * (-2123.203) (-2123.985) [-2122.825] (-2126.634) -- 0:00:07 894000 -- [-2122.429] (-2124.155) (-2121.970) (-2120.273) * (-2120.052) (-2119.966) [-2120.565] (-2120.996) -- 0:00:07 894500 -- (-2125.822) (-2126.680) [-2121.545] (-2119.783) * (-2120.192) (-2120.196) (-2125.812) [-2123.244] -- 0:00:07 895000 -- (-2119.014) [-2121.881] (-2121.563) (-2121.217) * (-2121.521) [-2119.804] (-2122.360) (-2123.581) -- 0:00:07 Average standard deviation of split frequencies: 0.008979 895500 -- (-2119.051) [-2121.600] (-2122.309) (-2123.148) * (-2123.652) (-2121.448) [-2120.467] (-2122.465) -- 0:00:07 896000 -- (-2119.841) (-2122.945) [-2121.737] (-2119.873) * (-2123.442) [-2121.707] (-2125.095) (-2121.810) -- 0:00:07 896500 -- [-2120.506] (-2120.444) (-2122.481) (-2121.497) * [-2120.077] (-2123.650) (-2120.944) (-2119.379) -- 0:00:07 897000 -- [-2120.017] (-2120.125) (-2123.683) (-2119.976) * (-2120.015) (-2120.344) [-2120.259] (-2120.437) -- 0:00:07 897500 -- (-2120.839) (-2121.612) [-2121.891] (-2121.422) * [-2121.057] (-2122.599) (-2120.296) (-2121.777) -- 0:00:07 898000 -- (-2120.841) [-2121.453] (-2122.944) (-2121.199) * (-2118.679) (-2123.450) [-2120.341] (-2124.031) -- 0:00:07 898500 -- [-2120.136] (-2120.167) (-2121.286) (-2122.113) * (-2125.560) [-2122.406] (-2119.715) (-2119.849) -- 0:00:07 899000 -- (-2119.943) (-2119.161) (-2120.958) [-2123.991] * (-2123.409) (-2121.934) [-2120.521] (-2119.860) -- 0:00:07 899500 -- (-2122.349) (-2121.708) [-2120.424] (-2126.809) * (-2121.460) (-2119.367) (-2120.536) [-2121.433] -- 0:00:07 900000 -- (-2120.697) (-2122.785) [-2118.803] (-2129.759) * [-2120.501] (-2120.030) (-2122.095) (-2120.105) -- 0:00:07 Average standard deviation of split frequencies: 0.009002 900500 -- (-2121.227) [-2121.470] (-2118.882) (-2126.451) * [-2121.615] (-2120.294) (-2121.719) (-2118.956) -- 0:00:07 901000 -- (-2120.785) (-2120.289) (-2120.014) [-2124.604] * [-2120.705] (-2119.866) (-2123.768) (-2120.733) -- 0:00:07 901500 -- (-2124.935) [-2119.832] (-2122.065) (-2125.389) * (-2119.611) (-2122.170) [-2124.279] (-2119.909) -- 0:00:06 902000 -- [-2124.894] (-2121.610) (-2124.045) (-2122.340) * (-2119.636) (-2123.301) (-2121.104) [-2119.522] -- 0:00:06 902500 -- [-2119.937] (-2119.849) (-2124.054) (-2124.778) * (-2119.255) (-2125.006) (-2119.171) [-2120.096] -- 0:00:06 903000 -- [-2120.691] (-2119.783) (-2121.451) (-2120.739) * (-2121.928) (-2120.085) [-2121.437] (-2121.431) -- 0:00:06 903500 -- [-2119.611] (-2121.967) (-2122.659) (-2119.972) * [-2122.685] (-2118.981) (-2119.849) (-2119.619) -- 0:00:06 904000 -- (-2119.622) (-2122.893) (-2123.035) [-2121.679] * (-2123.696) (-2120.670) [-2119.345] (-2119.955) -- 0:00:06 904500 -- [-2119.549] (-2121.246) (-2121.885) (-2122.462) * (-2122.815) (-2120.431) (-2120.927) [-2121.151] -- 0:00:06 905000 -- [-2123.329] (-2120.272) (-2119.871) (-2119.446) * (-2120.161) (-2123.445) (-2124.345) [-2119.936] -- 0:00:06 Average standard deviation of split frequencies: 0.008618 905500 -- (-2119.235) (-2119.440) (-2119.671) [-2121.568] * (-2121.180) (-2125.600) [-2121.341] (-2120.880) -- 0:00:06 906000 -- (-2122.249) (-2120.831) (-2123.999) [-2119.342] * (-2120.252) [-2123.302] (-2123.519) (-2120.754) -- 0:00:06 906500 -- [-2122.966] (-2120.878) (-2123.087) (-2125.386) * [-2122.072] (-2122.156) (-2119.979) (-2119.414) -- 0:00:06 907000 -- [-2120.336] (-2119.782) (-2123.304) (-2121.779) * [-2122.726] (-2121.942) (-2125.027) (-2122.330) -- 0:00:06 907500 -- [-2122.453] (-2124.038) (-2124.087) (-2119.974) * [-2120.279] (-2121.249) (-2125.301) (-2120.691) -- 0:00:06 908000 -- (-2120.467) [-2124.275] (-2122.474) (-2122.039) * (-2120.204) (-2125.711) (-2121.429) [-2119.755] -- 0:00:06 908500 -- (-2119.527) [-2119.888] (-2121.607) (-2122.056) * (-2120.587) (-2121.114) [-2121.404] (-2121.062) -- 0:00:06 909000 -- (-2121.809) [-2119.430] (-2121.086) (-2120.364) * [-2120.387] (-2125.348) (-2123.243) (-2121.086) -- 0:00:06 909500 -- (-2121.065) [-2120.211] (-2124.058) (-2120.644) * [-2120.123] (-2125.631) (-2119.100) (-2121.836) -- 0:00:06 910000 -- (-2121.342) [-2120.680] (-2123.652) (-2123.491) * (-2119.175) (-2121.375) (-2119.632) [-2121.969] -- 0:00:06 Average standard deviation of split frequencies: 0.008075 910500 -- (-2121.484) (-2121.474) (-2125.183) [-2119.407] * [-2121.848] (-2123.748) (-2120.185) (-2118.991) -- 0:00:06 911000 -- (-2120.190) (-2121.762) (-2128.922) [-2119.744] * (-2121.638) (-2122.006) (-2120.073) [-2121.420] -- 0:00:06 911500 -- (-2121.745) [-2119.055] (-2123.387) (-2123.122) * (-2119.166) (-2121.112) [-2120.007] (-2122.473) -- 0:00:06 912000 -- (-2122.399) (-2122.048) (-2122.577) [-2122.135] * (-2119.877) [-2120.969] (-2119.590) (-2121.398) -- 0:00:06 912500 -- [-2126.015] (-2121.382) (-2124.167) (-2119.639) * (-2121.430) [-2121.376] (-2118.741) (-2120.359) -- 0:00:06 913000 -- (-2120.467) [-2119.878] (-2121.667) (-2120.542) * (-2124.526) [-2121.805] (-2120.778) (-2121.963) -- 0:00:06 913500 -- (-2123.928) (-2119.554) [-2119.789] (-2121.675) * (-2122.586) (-2120.131) (-2119.879) [-2122.265] -- 0:00:06 914000 -- (-2122.261) [-2119.463] (-2120.955) (-2120.212) * [-2120.586] (-2125.103) (-2119.454) (-2122.680) -- 0:00:06 914500 -- (-2121.302) (-2119.628) (-2120.343) [-2120.931] * [-2123.829] (-2119.988) (-2122.102) (-2119.359) -- 0:00:06 915000 -- (-2120.578) (-2122.502) [-2121.047] (-2120.133) * (-2119.584) (-2119.793) [-2119.636] (-2121.960) -- 0:00:06 Average standard deviation of split frequencies: 0.007754 915500 -- (-2120.638) [-2122.479] (-2120.188) (-2120.246) * (-2119.601) [-2120.994] (-2121.702) (-2124.422) -- 0:00:05 916000 -- (-2120.343) (-2120.553) [-2122.139] (-2121.343) * (-2120.804) (-2120.894) [-2121.519] (-2120.583) -- 0:00:05 916500 -- (-2123.972) [-2118.608] (-2122.330) (-2120.778) * [-2120.900] (-2120.298) (-2121.524) (-2120.019) -- 0:00:05 917000 -- (-2120.099) (-2121.812) (-2120.820) [-2119.963] * [-2121.253] (-2121.496) (-2120.873) (-2120.321) -- 0:00:05 917500 -- (-2123.003) (-2123.670) [-2123.923] (-2119.637) * [-2121.034] (-2121.236) (-2119.672) (-2120.131) -- 0:00:05 918000 -- (-2121.248) (-2123.361) (-2123.476) [-2122.073] * (-2124.168) [-2127.103] (-2121.584) (-2125.899) -- 0:00:05 918500 -- (-2123.794) (-2123.920) [-2120.141] (-2123.258) * (-2123.688) (-2120.662) [-2119.805] (-2123.530) -- 0:00:05 919000 -- (-2122.717) (-2118.947) [-2123.157] (-2120.500) * (-2122.506) (-2121.689) [-2119.416] (-2122.057) -- 0:00:05 919500 -- (-2122.947) (-2120.732) (-2121.400) [-2120.712] * (-2119.286) [-2123.406] (-2121.423) (-2127.450) -- 0:00:05 920000 -- [-2120.603] (-2119.332) (-2120.522) (-2121.352) * (-2119.896) (-2126.575) [-2120.374] (-2121.347) -- 0:00:05 Average standard deviation of split frequencies: 0.007544 920500 -- [-2124.657] (-2119.252) (-2118.901) (-2121.203) * [-2121.303] (-2121.439) (-2122.035) (-2121.458) -- 0:00:05 921000 -- (-2122.126) [-2119.799] (-2119.218) (-2120.420) * (-2119.090) (-2119.980) (-2121.963) [-2119.424] -- 0:00:05 921500 -- (-2120.927) (-2122.894) (-2123.123) [-2122.370] * (-2124.208) (-2125.288) [-2121.231] (-2119.986) -- 0:00:05 922000 -- (-2122.641) [-2121.526] (-2122.811) (-2120.913) * [-2121.851] (-2124.371) (-2123.419) (-2119.281) -- 0:00:05 922500 -- (-2124.801) [-2121.400] (-2120.005) (-2119.874) * (-2122.666) (-2122.526) [-2122.265] (-2122.161) -- 0:00:05 923000 -- [-2123.578] (-2122.256) (-2120.369) (-2125.137) * (-2122.482) (-2122.948) [-2120.095] (-2120.053) -- 0:00:05 923500 -- (-2122.710) [-2123.066] (-2120.460) (-2119.881) * (-2119.880) (-2119.767) (-2119.505) [-2119.235] -- 0:00:05 924000 -- (-2122.194) (-2121.456) [-2121.159] (-2121.337) * (-2120.329) (-2120.677) (-2121.983) [-2119.339] -- 0:00:05 924500 -- (-2121.945) (-2121.520) [-2118.975] (-2120.038) * (-2121.408) (-2120.129) (-2120.004) [-2119.239] -- 0:00:05 925000 -- (-2121.618) [-2120.885] (-2118.997) (-2119.367) * [-2120.001] (-2119.751) (-2119.077) (-2120.086) -- 0:00:05 Average standard deviation of split frequencies: 0.007908 925500 -- (-2120.951) [-2124.740] (-2120.831) (-2119.721) * [-2121.474] (-2120.967) (-2121.193) (-2122.724) -- 0:00:05 926000 -- [-2119.882] (-2120.971) (-2121.458) (-2121.507) * (-2121.417) [-2120.928] (-2129.866) (-2123.702) -- 0:00:05 926500 -- (-2122.803) (-2119.981) (-2121.534) [-2120.626] * (-2121.327) [-2121.008] (-2121.295) (-2121.574) -- 0:00:05 927000 -- [-2118.985] (-2123.035) (-2122.761) (-2119.355) * (-2121.000) [-2124.214] (-2121.530) (-2122.152) -- 0:00:05 927500 -- (-2120.413) (-2121.444) [-2123.408] (-2120.970) * [-2120.716] (-2123.299) (-2121.916) (-2120.449) -- 0:00:05 928000 -- [-2119.079] (-2127.130) (-2119.704) (-2122.347) * [-2119.247] (-2118.828) (-2122.867) (-2120.935) -- 0:00:05 928500 -- (-2125.970) (-2121.472) (-2123.843) [-2118.861] * (-2122.876) (-2118.823) (-2121.734) [-2122.554] -- 0:00:05 929000 -- (-2119.489) (-2123.364) (-2121.226) [-2121.543] * (-2126.623) [-2120.839] (-2119.314) (-2120.577) -- 0:00:05 929500 -- [-2119.325] (-2123.593) (-2120.516) (-2124.200) * (-2120.660) (-2120.933) [-2119.229] (-2120.434) -- 0:00:05 930000 -- (-2119.697) (-2123.114) [-2119.484] (-2119.672) * (-2127.350) [-2120.007] (-2119.193) (-2120.241) -- 0:00:05 Average standard deviation of split frequencies: 0.008172 930500 -- (-2122.248) [-2119.867] (-2121.211) (-2122.754) * (-2120.181) (-2121.739) (-2121.706) [-2121.185] -- 0:00:05 931000 -- (-2120.741) (-2121.401) (-2120.931) [-2122.220] * (-2121.509) (-2120.085) [-2120.159] (-2121.973) -- 0:00:04 931500 -- (-2119.741) (-2122.467) [-2120.145] (-2122.232) * (-2120.344) [-2120.478] (-2120.460) (-2119.093) -- 0:00:04 932000 -- (-2121.560) [-2119.572] (-2120.867) (-2123.212) * [-2125.081] (-2121.195) (-2120.941) (-2120.213) -- 0:00:04 932500 -- (-2121.660) [-2119.480] (-2119.472) (-2119.247) * (-2122.629) [-2121.894] (-2121.911) (-2124.684) -- 0:00:04 933000 -- [-2121.669] (-2119.224) (-2121.015) (-2121.583) * (-2126.553) (-2120.232) (-2120.395) [-2122.220] -- 0:00:04 933500 -- [-2120.789] (-2120.645) (-2130.067) (-2121.143) * (-2121.331) [-2121.844] (-2119.710) (-2121.597) -- 0:00:04 934000 -- (-2122.214) (-2120.848) (-2122.438) [-2123.398] * (-2119.784) (-2122.165) [-2119.765] (-2122.170) -- 0:00:04 934500 -- (-2120.889) (-2121.077) (-2122.615) [-2120.622] * (-2119.585) (-2123.123) [-2119.609] (-2122.126) -- 0:00:04 935000 -- (-2120.304) (-2119.574) (-2120.623) [-2120.365] * (-2124.051) [-2120.055] (-2120.900) (-2120.614) -- 0:00:04 Average standard deviation of split frequencies: 0.008341 935500 -- (-2124.245) (-2122.141) (-2119.772) [-2119.267] * (-2119.720) (-2120.408) (-2122.101) [-2120.018] -- 0:00:04 936000 -- (-2121.415) (-2122.481) [-2120.180] (-2123.101) * (-2123.883) [-2121.478] (-2124.075) (-2119.178) -- 0:00:04 936500 -- (-2118.929) (-2120.295) [-2121.357] (-2123.754) * (-2127.531) (-2122.146) [-2120.336] (-2119.596) -- 0:00:04 937000 -- (-2119.012) (-2120.727) (-2124.003) [-2120.584] * (-2126.698) (-2119.559) [-2120.261] (-2121.636) -- 0:00:04 937500 -- [-2119.402] (-2120.721) (-2121.241) (-2121.589) * (-2122.039) (-2121.159) (-2119.399) [-2119.639] -- 0:00:04 938000 -- (-2123.008) (-2121.299) (-2119.070) [-2120.510] * [-2120.040] (-2120.634) (-2122.143) (-2118.928) -- 0:00:04 938500 -- (-2121.619) (-2121.387) (-2121.731) [-2119.424] * (-2120.844) (-2120.070) [-2120.204] (-2119.900) -- 0:00:04 939000 -- (-2122.836) (-2128.394) [-2122.062] (-2120.319) * (-2120.015) (-2119.205) [-2119.288] (-2119.900) -- 0:00:04 939500 -- (-2123.007) (-2120.015) (-2120.475) [-2120.680] * (-2120.153) (-2120.559) [-2119.090] (-2121.255) -- 0:00:04 940000 -- [-2121.525] (-2119.813) (-2123.565) (-2119.051) * (-2120.473) [-2121.043] (-2120.330) (-2119.777) -- 0:00:04 Average standard deviation of split frequencies: 0.008488 940500 -- (-2124.274) [-2122.524] (-2123.800) (-2119.908) * (-2122.023) (-2121.999) [-2119.923] (-2120.169) -- 0:00:04 941000 -- (-2122.813) (-2119.854) [-2121.773] (-2119.387) * (-2123.292) (-2121.383) (-2122.688) [-2120.699] -- 0:00:04 941500 -- (-2120.019) (-2120.821) [-2120.467] (-2120.811) * (-2121.664) (-2118.839) [-2123.780] (-2121.236) -- 0:00:04 942000 -- (-2122.095) (-2120.361) (-2120.563) [-2122.377] * (-2120.218) [-2118.945] (-2124.543) (-2119.145) -- 0:00:04 942500 -- [-2121.908] (-2123.543) (-2122.729) (-2122.688) * (-2120.877) (-2118.999) [-2125.971] (-2122.828) -- 0:00:04 943000 -- (-2124.096) [-2121.992] (-2122.383) (-2123.258) * (-2121.130) (-2123.476) (-2119.183) [-2119.896] -- 0:00:04 943500 -- (-2123.569) [-2121.365] (-2120.112) (-2124.972) * (-2120.561) (-2120.111) (-2119.276) [-2120.199] -- 0:00:04 944000 -- (-2121.900) (-2120.628) [-2120.964] (-2121.978) * (-2122.084) (-2120.046) (-2119.721) [-2121.828] -- 0:00:04 944500 -- (-2121.684) (-2123.863) [-2120.706] (-2122.608) * (-2120.565) (-2123.545) (-2121.817) [-2120.647] -- 0:00:03 945000 -- (-2121.456) (-2123.162) [-2121.391] (-2121.524) * [-2120.567] (-2125.625) (-2122.891) (-2122.154) -- 0:00:03 Average standard deviation of split frequencies: 0.008409 945500 -- (-2122.336) [-2123.089] (-2122.351) (-2123.946) * (-2121.835) [-2120.619] (-2124.688) (-2120.030) -- 0:00:03 946000 -- (-2119.403) [-2122.861] (-2122.040) (-2120.988) * [-2121.716] (-2122.993) (-2122.770) (-2122.461) -- 0:00:03 946500 -- (-2121.249) [-2124.634] (-2122.472) (-2121.375) * [-2120.864] (-2120.277) (-2121.291) (-2120.542) -- 0:00:03 947000 -- [-2121.818] (-2127.123) (-2123.683) (-2123.400) * [-2120.122] (-2119.457) (-2122.184) (-2124.448) -- 0:00:03 947500 -- (-2120.791) [-2119.942] (-2119.196) (-2120.975) * (-2119.180) (-2119.828) [-2120.036] (-2124.299) -- 0:00:03 948000 -- (-2119.559) (-2119.495) (-2122.195) [-2121.754] * [-2119.411] (-2122.505) (-2122.036) (-2121.718) -- 0:00:03 948500 -- (-2120.408) (-2119.970) [-2119.622] (-2120.749) * (-2119.477) [-2120.440] (-2120.840) (-2122.677) -- 0:00:03 949000 -- (-2121.894) [-2120.276] (-2120.634) (-2120.045) * (-2119.024) (-2121.384) [-2121.305] (-2123.175) -- 0:00:03 949500 -- (-2120.006) (-2120.167) [-2121.708] (-2121.911) * (-2122.396) (-2119.804) (-2119.854) [-2123.792] -- 0:00:03 950000 -- [-2120.856] (-2119.132) (-2121.269) (-2121.269) * (-2122.775) [-2120.348] (-2118.943) (-2119.588) -- 0:00:03 Average standard deviation of split frequencies: 0.008461 950500 -- (-2121.291) (-2120.560) [-2121.601] (-2119.100) * (-2124.139) (-2120.175) [-2119.969] (-2120.758) -- 0:00:03 951000 -- [-2121.751] (-2123.338) (-2119.832) (-2120.357) * (-2119.851) [-2119.267] (-2121.060) (-2121.191) -- 0:00:03 951500 -- (-2126.412) (-2120.876) (-2121.825) [-2119.421] * [-2120.449] (-2124.852) (-2119.678) (-2123.269) -- 0:00:03 952000 -- (-2123.287) (-2123.263) [-2120.994] (-2120.166) * (-2120.691) (-2121.225) [-2121.578] (-2123.805) -- 0:00:03 952500 -- (-2122.668) (-2122.942) [-2120.432] (-2119.751) * (-2121.642) [-2119.148] (-2120.235) (-2121.449) -- 0:00:03 953000 -- [-2122.401] (-2125.750) (-2121.156) (-2119.923) * (-2123.809) (-2120.809) (-2121.453) [-2119.969] -- 0:00:03 953500 -- (-2119.773) [-2122.226] (-2120.703) (-2120.427) * (-2121.099) [-2120.895] (-2118.881) (-2119.827) -- 0:00:03 954000 -- (-2121.802) (-2123.886) [-2123.201] (-2121.479) * (-2120.872) (-2121.707) (-2120.650) [-2120.941] -- 0:00:03 954500 -- [-2122.244] (-2122.212) (-2120.270) (-2123.428) * (-2121.644) [-2119.152] (-2119.693) (-2121.338) -- 0:00:03 955000 -- (-2119.735) (-2121.607) (-2120.774) [-2120.690] * (-2122.410) (-2119.195) [-2118.984] (-2122.340) -- 0:00:03 Average standard deviation of split frequencies: 0.008444 955500 -- (-2120.977) [-2121.303] (-2118.789) (-2123.946) * (-2121.514) [-2121.946] (-2120.044) (-2120.730) -- 0:00:03 956000 -- [-2120.575] (-2120.202) (-2119.804) (-2122.469) * (-2124.444) [-2119.931] (-2120.773) (-2125.055) -- 0:00:03 956500 -- (-2120.338) (-2120.196) (-2120.670) [-2122.742] * (-2122.570) (-2122.288) [-2122.094] (-2120.481) -- 0:00:03 957000 -- [-2120.253] (-2120.015) (-2121.134) (-2122.424) * (-2123.687) (-2122.790) (-2122.580) [-2119.990] -- 0:00:03 957500 -- (-2119.959) (-2119.695) [-2121.107] (-2123.397) * (-2121.554) (-2122.885) (-2120.352) [-2122.356] -- 0:00:03 958000 -- (-2121.261) (-2122.651) [-2120.744] (-2122.177) * (-2120.884) [-2121.084] (-2121.547) (-2120.197) -- 0:00:03 958500 -- (-2122.685) (-2121.575) [-2120.809] (-2119.903) * [-2119.334] (-2119.389) (-2120.792) (-2120.488) -- 0:00:02 959000 -- (-2123.856) (-2123.819) [-2119.845] (-2121.799) * (-2123.998) [-2119.706] (-2121.315) (-2125.138) -- 0:00:02 959500 -- (-2120.400) (-2120.735) (-2119.163) [-2125.275] * (-2124.821) [-2120.458] (-2121.916) (-2120.013) -- 0:00:02 960000 -- (-2122.103) (-2122.699) (-2120.211) [-2121.785] * [-2119.406] (-2121.518) (-2122.295) (-2119.138) -- 0:00:02 Average standard deviation of split frequencies: 0.008434 960500 -- (-2118.959) (-2120.279) [-2118.993] (-2120.728) * [-2122.951] (-2122.567) (-2123.131) (-2121.084) -- 0:00:02 961000 -- [-2120.897] (-2120.301) (-2122.131) (-2120.485) * (-2123.141) (-2122.917) (-2119.718) [-2120.999] -- 0:00:02 961500 -- (-2119.608) (-2121.035) (-2123.053) [-2122.691] * [-2119.869] (-2122.005) (-2119.862) (-2120.029) -- 0:00:02 962000 -- (-2122.498) [-2119.571] (-2122.758) (-2122.502) * (-2121.789) (-2119.590) (-2119.292) [-2122.299] -- 0:00:02 962500 -- (-2120.594) (-2121.413) (-2120.474) [-2120.885] * (-2118.879) (-2120.031) (-2119.264) [-2122.692] -- 0:00:02 963000 -- (-2119.640) (-2119.540) (-2121.860) [-2120.631] * (-2120.952) [-2121.123] (-2122.704) (-2127.231) -- 0:00:02 963500 -- (-2120.449) [-2119.762] (-2119.565) (-2120.923) * (-2119.116) (-2122.896) [-2119.970] (-2120.831) -- 0:00:02 964000 -- (-2123.002) (-2120.686) [-2121.894] (-2128.174) * (-2119.971) (-2120.143) (-2122.575) [-2120.176] -- 0:00:02 964500 -- (-2122.122) (-2119.322) (-2119.346) [-2121.628] * (-2121.230) (-2120.371) (-2122.989) [-2118.942] -- 0:00:02 965000 -- (-2125.486) (-2119.303) (-2120.250) [-2120.617] * [-2120.982] (-2119.684) (-2124.312) (-2119.553) -- 0:00:02 Average standard deviation of split frequencies: 0.007923 965500 -- (-2122.305) (-2119.309) (-2119.988) [-2120.087] * (-2118.763) (-2119.206) [-2120.098] (-2119.499) -- 0:00:02 966000 -- (-2121.025) (-2120.828) (-2119.882) [-2120.083] * [-2121.075] (-2119.912) (-2120.187) (-2120.454) -- 0:00:02 966500 -- (-2120.255) (-2120.475) [-2121.583] (-2121.014) * (-2124.301) [-2119.961] (-2120.144) (-2122.473) -- 0:00:02 967000 -- (-2121.750) [-2123.271] (-2121.253) (-2119.441) * (-2125.392) (-2122.373) [-2122.942] (-2121.747) -- 0:00:02 967500 -- (-2120.366) (-2119.911) [-2122.680] (-2120.306) * (-2122.045) [-2119.233] (-2121.304) (-2121.781) -- 0:00:02 968000 -- [-2122.450] (-2121.734) (-2119.819) (-2121.033) * (-2119.760) [-2119.834] (-2119.762) (-2121.815) -- 0:00:02 968500 -- (-2121.422) (-2122.872) [-2119.400] (-2121.401) * (-2119.589) (-2122.162) (-2120.206) [-2120.936] -- 0:00:02 969000 -- (-2119.287) (-2122.317) (-2121.162) [-2121.869] * (-2118.790) (-2121.463) [-2122.677] (-2120.128) -- 0:00:02 969500 -- (-2119.334) [-2125.974] (-2122.807) (-2119.027) * (-2120.240) [-2120.645] (-2121.479) (-2120.481) -- 0:00:02 970000 -- [-2119.946] (-2122.266) (-2121.233) (-2119.015) * (-2119.807) [-2121.517] (-2121.537) (-2120.399) -- 0:00:02 Average standard deviation of split frequencies: 0.007799 970500 -- (-2123.012) (-2123.142) (-2119.140) [-2120.722] * (-2119.365) [-2121.875] (-2120.351) (-2120.480) -- 0:00:02 971000 -- (-2121.331) (-2122.908) (-2119.737) [-2124.744] * (-2121.035) [-2121.504] (-2120.340) (-2121.481) -- 0:00:02 971500 -- [-2122.427] (-2121.412) (-2119.946) (-2123.530) * (-2122.116) [-2120.650] (-2120.988) (-2119.815) -- 0:00:02 972000 -- [-2118.975] (-2122.004) (-2123.355) (-2120.023) * [-2123.360] (-2122.000) (-2121.212) (-2121.947) -- 0:00:02 972500 -- (-2122.266) [-2123.049] (-2123.303) (-2119.526) * [-2121.853] (-2122.734) (-2121.548) (-2120.220) -- 0:00:01 973000 -- (-2122.455) [-2120.642] (-2126.454) (-2118.830) * (-2119.451) (-2119.423) (-2121.378) [-2119.687] -- 0:00:01 973500 -- (-2124.026) (-2123.514) [-2123.978] (-2119.006) * [-2121.256] (-2121.092) (-2124.583) (-2123.397) -- 0:00:01 974000 -- [-2121.938] (-2119.426) (-2121.827) (-2119.531) * [-2119.845] (-2120.066) (-2123.738) (-2121.551) -- 0:00:01 974500 -- (-2122.510) [-2119.730] (-2120.352) (-2123.617) * (-2120.862) (-2120.752) [-2122.479] (-2122.265) -- 0:00:01 975000 -- (-2122.842) (-2121.121) (-2119.285) [-2120.710] * (-2121.113) (-2126.307) [-2122.062] (-2119.883) -- 0:00:01 Average standard deviation of split frequencies: 0.008090 975500 -- (-2122.900) (-2119.019) (-2119.566) [-2120.248] * (-2126.660) [-2121.820] (-2121.026) (-2120.924) -- 0:00:01 976000 -- (-2122.176) (-2122.242) [-2119.436] (-2119.818) * (-2123.820) (-2121.285) (-2121.149) [-2121.868] -- 0:00:01 976500 -- (-2119.543) [-2120.505] (-2119.911) (-2119.465) * (-2126.490) (-2120.664) (-2122.388) [-2121.558] -- 0:00:01 977000 -- (-2119.964) (-2121.200) [-2120.128] (-2129.672) * (-2121.310) [-2119.167] (-2121.130) (-2120.899) -- 0:00:01 977500 -- (-2121.133) (-2118.849) [-2120.772] (-2120.961) * (-2120.262) [-2119.299] (-2122.586) (-2121.443) -- 0:00:01 978000 -- (-2120.000) (-2118.859) [-2121.628] (-2120.865) * (-2122.149) [-2118.884] (-2122.586) (-2120.489) -- 0:00:01 978500 -- (-2120.595) [-2119.012] (-2122.025) (-2120.023) * (-2120.965) [-2119.131] (-2120.001) (-2122.409) -- 0:00:01 979000 -- [-2119.401] (-2122.209) (-2119.273) (-2121.576) * [-2121.632] (-2123.205) (-2119.244) (-2121.157) -- 0:00:01 979500 -- (-2126.514) (-2124.538) (-2121.887) [-2120.426] * (-2123.251) (-2120.898) (-2121.432) [-2120.170] -- 0:00:01 980000 -- (-2125.235) (-2120.467) [-2120.900] (-2120.221) * [-2121.494] (-2121.467) (-2123.027) (-2118.725) -- 0:00:01 Average standard deviation of split frequencies: 0.008142 980500 -- (-2124.148) [-2123.666] (-2119.673) (-2123.120) * (-2120.353) (-2119.544) (-2120.176) [-2121.170] -- 0:00:01 981000 -- [-2120.704] (-2120.866) (-2121.029) (-2123.129) * [-2120.540] (-2120.443) (-2120.956) (-2121.694) -- 0:00:01 981500 -- [-2123.894] (-2121.567) (-2129.823) (-2122.759) * (-2128.418) (-2119.424) [-2119.303] (-2120.927) -- 0:00:01 982000 -- (-2124.042) (-2119.325) (-2120.027) [-2119.925] * (-2122.615) (-2122.796) (-2120.568) [-2120.587] -- 0:00:01 982500 -- (-2120.872) (-2122.051) (-2120.404) [-2119.843] * (-2122.495) (-2120.937) [-2120.690] (-2120.943) -- 0:00:01 983000 -- (-2123.901) (-2120.738) [-2124.219] (-2120.010) * [-2119.243] (-2120.115) (-2121.397) (-2121.506) -- 0:00:01 983500 -- [-2122.172] (-2123.189) (-2120.715) (-2121.316) * (-2120.254) (-2120.551) [-2121.199] (-2120.968) -- 0:00:01 984000 -- (-2120.026) [-2123.251] (-2120.399) (-2122.699) * [-2119.451] (-2119.213) (-2120.822) (-2119.894) -- 0:00:01 984500 -- [-2122.058] (-2120.763) (-2122.738) (-2120.436) * (-2122.987) (-2122.684) (-2120.805) [-2119.847] -- 0:00:01 985000 -- (-2119.212) (-2123.367) (-2121.685) [-2120.372] * (-2122.490) (-2125.647) [-2124.718] (-2119.379) -- 0:00:01 Average standard deviation of split frequencies: 0.008247 985500 -- [-2120.380] (-2125.806) (-2121.204) (-2120.380) * (-2120.154) (-2122.892) (-2121.802) [-2121.843] -- 0:00:01 986000 -- [-2120.112] (-2122.895) (-2119.112) (-2120.905) * (-2120.277) (-2123.960) [-2123.942] (-2125.027) -- 0:00:01 986500 -- (-2121.654) [-2120.316] (-2120.514) (-2123.103) * (-2121.540) [-2120.422] (-2121.813) (-2121.481) -- 0:00:00 987000 -- (-2118.660) (-2121.899) (-2122.161) [-2120.625] * (-2120.892) (-2120.879) [-2119.948] (-2121.682) -- 0:00:00 987500 -- (-2120.654) (-2119.179) (-2126.569) [-2120.900] * (-2120.114) (-2125.315) [-2121.749] (-2121.207) -- 0:00:00 988000 -- (-2120.304) (-2120.241) (-2121.988) [-2120.724] * [-2120.232] (-2120.624) (-2125.067) (-2122.100) -- 0:00:00 988500 -- (-2119.432) (-2120.007) [-2121.050] (-2119.021) * (-2119.229) (-2121.352) (-2121.219) [-2119.713] -- 0:00:00 989000 -- (-2121.538) [-2124.198] (-2121.906) (-2120.173) * (-2120.610) (-2124.785) (-2124.907) [-2120.262] -- 0:00:00 989500 -- (-2122.102) [-2122.513] (-2119.168) (-2120.948) * [-2123.210] (-2120.020) (-2119.875) (-2122.580) -- 0:00:00 990000 -- (-2119.757) [-2120.519] (-2118.831) (-2119.710) * (-2122.852) [-2119.482] (-2122.856) (-2121.257) -- 0:00:00 Average standard deviation of split frequencies: 0.008089 990500 -- (-2120.484) (-2123.346) [-2118.831] (-2120.659) * (-2121.753) (-2120.473) [-2122.513] (-2120.290) -- 0:00:00 991000 -- (-2120.830) (-2125.823) [-2119.601] (-2128.322) * (-2120.060) (-2119.199) [-2122.841] (-2120.379) -- 0:00:00 991500 -- (-2120.323) (-2121.138) [-2121.810] (-2123.840) * [-2119.657] (-2120.060) (-2121.892) (-2120.516) -- 0:00:00 992000 -- (-2124.052) [-2120.869] (-2120.240) (-2120.557) * (-2120.278) (-2118.823) (-2127.058) [-2120.916] -- 0:00:00 992500 -- (-2128.618) (-2124.020) [-2124.045] (-2119.564) * (-2123.547) [-2120.344] (-2118.758) (-2122.098) -- 0:00:00 993000 -- (-2122.016) [-2122.404] (-2126.182) (-2121.510) * (-2124.168) (-2124.331) [-2119.033] (-2121.770) -- 0:00:00 993500 -- (-2122.011) [-2121.070] (-2122.800) (-2119.474) * [-2120.323] (-2120.493) (-2119.555) (-2120.099) -- 0:00:00 994000 -- (-2119.764) (-2121.860) (-2121.215) [-2121.066] * (-2120.468) (-2120.391) (-2120.758) [-2119.261] -- 0:00:00 994500 -- [-2119.565] (-2118.943) (-2124.006) (-2123.016) * [-2122.095] (-2121.211) (-2119.470) (-2119.355) -- 0:00:00 995000 -- (-2120.429) (-2121.402) [-2119.843] (-2122.983) * (-2122.499) (-2121.244) (-2122.471) [-2120.392] -- 0:00:00 Average standard deviation of split frequencies: 0.008224 995500 -- (-2122.066) [-2120.733] (-2123.298) (-2120.910) * [-2121.329] (-2129.094) (-2121.370) (-2120.260) -- 0:00:00 996000 -- [-2122.674] (-2123.653) (-2119.790) (-2121.452) * (-2121.028) [-2119.124] (-2123.472) (-2120.654) -- 0:00:00 996500 -- (-2119.778) (-2120.563) (-2123.785) [-2126.223] * [-2119.294] (-2119.447) (-2127.097) (-2121.875) -- 0:00:00 997000 -- (-2120.312) [-2118.882] (-2121.490) (-2129.101) * (-2120.364) (-2120.129) [-2122.350] (-2122.699) -- 0:00:00 997500 -- (-2123.476) (-2118.794) (-2120.548) [-2124.453] * (-2119.540) (-2121.848) [-2124.573] (-2122.387) -- 0:00:00 998000 -- (-2119.401) [-2120.857] (-2122.054) (-2122.260) * (-2120.569) (-2122.863) [-2119.843] (-2127.527) -- 0:00:00 998500 -- [-2120.411] (-2119.966) (-2120.024) (-2124.609) * (-2122.114) (-2122.982) [-2119.603] (-2122.183) -- 0:00:00 999000 -- (-2121.158) (-2123.261) [-2119.990] (-2122.793) * (-2122.721) [-2120.498] (-2119.415) (-2122.515) -- 0:00:00 999500 -- (-2119.988) (-2119.547) (-2121.605) [-2121.856] * (-2121.620) [-2119.650] (-2121.401) (-2123.853) -- 0:00:00 1000000 -- (-2120.741) (-2120.954) (-2121.488) [-2121.659] * [-2119.249] (-2123.755) (-2120.759) (-2121.444) -- 0:00:00 Average standard deviation of split frequencies: 0.008197 Analysis completed in 1 mins 12 seconds Analysis used 70.61 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2118.60 Likelihood of best state for "cold" chain of run 2 was -2118.60 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.1 % ( 78 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 23.0 % ( 30 %) Dirichlet(Pi{all}) 26.0 % ( 24 %) Slider(Pi{all}) 78.8 % ( 50 %) Multiplier(Alpha{1,2}) 77.4 % ( 51 %) Multiplier(Alpha{3}) 12.9 % ( 28 %) Slider(Pinvar{all}) 98.7 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 74 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 26 %) Multiplier(V{all}) 97.4 % ( 94 %) Nodeslider(V{all}) 30.6 % ( 26 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.3 % ( 59 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 23.2 % ( 25 %) Dirichlet(Pi{all}) 26.9 % ( 31 %) Slider(Pi{all}) 78.9 % ( 53 %) Multiplier(Alpha{1,2}) 77.8 % ( 52 %) Multiplier(Alpha{3}) 13.1 % ( 22 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 78 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 87 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 30 %) Multiplier(V{all}) 97.3 % ( 99 %) Nodeslider(V{all}) 30.6 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.65 0.50 2 | 166476 0.82 0.67 3 | 166722 167047 0.84 4 | 166939 166614 166202 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.80 0.64 0.50 2 | 166974 0.82 0.66 3 | 165855 166823 0.84 4 | 167011 167227 166110 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2120.41 | 1 2 1 | | 1 1 2 | | 2 2 2 1 2 1 2 1 2| | 2 1 1 11 1 2 2 2 1 1 2 2 | | 1 2 2 2 2 | |* 1 2 1 2 2 21 | | 21 11 1 2 212 1 1 2 21 | | 1 221 1 1 1 2 1 22 | | 21 1 1 1 2 2 22 21 11 * 2 1 | | 1 1 1 2 2 1 2 2 1 2 1 1| | 2 212 1 2 2 2 2 1 1 1 | | 2 2 2 2 11 1 | | 1 | | 11 | | 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2121.93 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2120.34 -2123.28 2 -2120.36 -2125.44 -------------------------------------- TOTAL -2120.35 -2124.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899146 0.088910 0.378539 1.497152 0.862669 832.77 1140.49 1.001 r(A<->C){all} 0.157979 0.017199 0.000122 0.431004 0.123115 167.27 201.42 1.005 r(A<->G){all} 0.180790 0.021744 0.000161 0.482132 0.144867 152.98 223.34 1.007 r(A<->T){all} 0.166610 0.020798 0.000075 0.459213 0.126558 217.92 230.07 1.002 r(C<->G){all} 0.166227 0.019595 0.000144 0.452034 0.130329 102.13 138.86 1.010 r(C<->T){all} 0.159234 0.017823 0.000030 0.423067 0.126687 288.98 314.71 1.001 r(G<->T){all} 0.169161 0.021391 0.000060 0.473843 0.125348 129.16 144.76 1.001 pi(A){all} 0.195992 0.000100 0.176050 0.215564 0.195966 1119.70 1229.60 1.000 pi(C){all} 0.348534 0.000133 0.326733 0.371374 0.348518 1367.55 1383.97 1.002 pi(G){all} 0.286474 0.000125 0.265396 0.309250 0.286409 1341.25 1374.00 1.000 pi(T){all} 0.169000 0.000096 0.150566 0.188426 0.168907 1055.70 1116.64 1.000 alpha{1,2} 0.438335 0.254580 0.000109 1.417447 0.260389 1294.41 1337.33 1.000 alpha{3} 0.450780 0.240929 0.000217 1.442928 0.286566 645.12 967.68 1.000 pinvar{all} 0.999019 0.000001 0.996851 0.999998 0.999367 1018.68 1041.59 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ....** 8 -- .*...* 9 -- .**... 10 -- .*.*** 11 -- .*.*.. 12 -- ...*.* 13 -- .**.** 14 -- ...**. 15 -- ..*..* 16 -- .***.* 17 -- .*..*. 18 -- ..**.. 19 -- .****. 20 -- ..*.*. 21 -- ..**** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 469 0.156229 0.011777 0.147901 0.164557 2 8 465 0.154897 0.014604 0.144570 0.165223 2 9 445 0.148235 0.003298 0.145903 0.150566 2 10 437 0.145570 0.017430 0.133245 0.157895 2 11 432 0.143904 0.007537 0.138574 0.149234 2 12 430 0.143238 0.001884 0.141905 0.144570 2 13 428 0.142572 0.013191 0.133245 0.151899 2 14 424 0.141239 0.003769 0.138574 0.143904 2 15 422 0.140573 0.015075 0.129913 0.151233 2 16 420 0.139907 0.001884 0.138574 0.141239 2 17 419 0.139574 0.012719 0.130580 0.148568 2 18 419 0.139574 0.000471 0.139241 0.139907 2 19 416 0.138574 0.002827 0.136576 0.140573 2 20 394 0.131246 0.016017 0.119920 0.142572 2 21 393 0.130913 0.000471 0.130580 0.131246 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097917 0.009481 0.000042 0.287988 0.067161 1.000 2 length{all}[2] 0.098371 0.009584 0.000005 0.289516 0.068961 1.000 2 length{all}[3] 0.100599 0.010411 0.000042 0.300488 0.069637 1.000 2 length{all}[4] 0.099769 0.010674 0.000043 0.300904 0.068339 1.002 2 length{all}[5] 0.102510 0.010781 0.000014 0.310535 0.072070 1.000 2 length{all}[6] 0.097832 0.009363 0.000008 0.283249 0.068272 1.000 2 length{all}[7] 0.098611 0.009547 0.000043 0.279351 0.070741 0.998 2 length{all}[8] 0.098707 0.008640 0.000191 0.290404 0.068964 0.998 2 length{all}[9] 0.105252 0.011059 0.000257 0.325337 0.071448 1.000 2 length{all}[10] 0.099427 0.009301 0.000156 0.290044 0.068592 1.002 2 length{all}[11] 0.103158 0.010488 0.000093 0.329757 0.065943 1.005 2 length{all}[12] 0.103601 0.010875 0.000731 0.282045 0.075269 1.000 2 length{all}[13] 0.090523 0.007650 0.000006 0.270636 0.064120 0.998 2 length{all}[14] 0.101560 0.009243 0.000133 0.311228 0.073432 0.998 2 length{all}[15] 0.099956 0.009639 0.000008 0.306377 0.074005 0.999 2 length{all}[16] 0.096740 0.009158 0.000035 0.293660 0.069153 0.999 2 length{all}[17] 0.107985 0.010454 0.000240 0.309865 0.078416 0.998 2 length{all}[18] 0.106569 0.011902 0.000352 0.283808 0.080585 1.000 2 length{all}[19] 0.101066 0.008739 0.000289 0.284108 0.071203 1.001 2 length{all}[20] 0.100356 0.010394 0.000164 0.287460 0.068203 0.998 2 length{all}[21] 0.100768 0.008981 0.000036 0.308134 0.070106 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008197 Maximum standard deviation of split frequencies = 0.017430 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.005 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |-------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \-------------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1575 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 61 patterns at 525 / 525 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 61 patterns at 525 / 525 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 59536 bytes for conP 5368 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.087677 0.060620 0.053364 0.087863 0.052108 0.072635 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -2261.686808 Iterating by ming2 Initial: fx= 2261.686808 x= 0.08768 0.06062 0.05336 0.08786 0.05211 0.07264 0.30000 1.30000 1 h-m-p 0.0000 0.0001 1257.7543 ++ 2100.863495 m 0.0001 13 | 1/8 2 h-m-p 0.0016 0.0080 39.2183 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 1159.7060 ++ 2097.585111 m 0.0000 44 | 2/8 4 h-m-p 0.0029 1.4592 10.4847 ------------.. | 2/8 5 h-m-p 0.0000 0.0000 1036.5209 ++ 2082.417284 m 0.0000 76 | 3/8 6 h-m-p 0.0040 1.9803 8.7107 ------------.. | 3/8 7 h-m-p 0.0000 0.0000 897.9683 ++ 2063.510057 m 0.0000 108 | 4/8 8 h-m-p 0.0030 1.4751 8.0728 ------------.. | 4/8 9 h-m-p 0.0000 0.0000 734.2373 ++ 2047.630577 m 0.0000 140 | 5/8 10 h-m-p 0.0023 1.1493 9.1852 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 520.7827 ++ 2047.531592 m 0.0000 172 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 Y 2047.531592 0 0.0040 183 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 ----C 2047.531592 0 0.0014 200 Out.. lnL = -2047.531592 201 lfun, 201 eigenQcodon, 1206 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.048833 0.097906 0.014311 0.075503 0.033808 0.083332 0.299965 0.736520 0.341052 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 11.164609 np = 9 lnL0 = -2225.490788 Iterating by ming2 Initial: fx= 2225.490788 x= 0.04883 0.09791 0.01431 0.07550 0.03381 0.08333 0.29997 0.73652 0.34105 1 h-m-p 0.0000 0.0000 1197.5478 ++ 2183.684471 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 800.9040 ++ 2134.166591 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 1799.2401 ++ 2106.339025 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 945.5575 ++ 2063.313846 m 0.0001 50 | 4/9 5 h-m-p 0.0000 0.0000 8796.0757 ++ 2054.915561 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 5333.4344 ++ 2051.674812 m 0.0000 74 | 6/9 7 h-m-p 0.0011 0.0537 6.5416 -----------.. | 6/9 8 h-m-p 0.0000 0.0000 515.5228 ++ 2047.531580 m 0.0000 107 | 7/9 9 h-m-p 0.0272 8.0000 0.0000 +++++ 2047.531580 m 8.0000 122 | 7/9 10 h-m-p 0.0542 8.0000 0.0037 -----C 2047.531580 0 0.0000 141 | 7/9 11 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531580 m 8.0000 158 | 7/9 12 h-m-p 0.0042 1.7502 0.1891 ++++Y 2047.531577 0 1.3151 176 | 7/9 13 h-m-p 1.6000 8.0000 0.0016 Y 2047.531577 0 1.2012 190 | 7/9 14 h-m-p 1.6000 8.0000 0.0000 Y 2047.531577 0 1.6000 204 | 7/9 15 h-m-p 1.4836 8.0000 0.0000 Y 2047.531577 0 0.3709 218 | 7/9 16 h-m-p 0.1664 8.0000 0.0000 ---------------.. | 7/9 17 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531577 m 8.0000 262 | 7/9 18 h-m-p 0.0059 2.9668 0.2340 ------------.. | 7/9 19 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531577 m 8.0000 303 | 7/9 20 h-m-p 0.0062 3.1067 0.2237 --------N 2047.531577 0 0.0000 325 | 7/9 21 h-m-p 0.0160 8.0000 0.0002 +++++ 2047.531577 m 8.0000 342 | 7/9 22 h-m-p 0.0040 1.5088 0.3982 --------C 2047.531577 0 0.0000 364 | 7/9 23 h-m-p 0.0160 8.0000 0.0029 -------C 2047.531577 0 0.0000 385 | 7/9 24 h-m-p 0.0160 8.0000 0.0004 -------------.. | 7/9 25 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531577 m 8.0000 427 | 7/9 26 h-m-p 0.0058 2.9002 0.2408 --------Y 2047.531577 0 0.0000 449 | 7/9 27 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531577 m 8.0000 466 | 7/9 28 h-m-p 0.0041 2.0512 0.2704 +++Y 2047.531575 0 0.6563 483 | 7/9 29 h-m-p 1.6000 8.0000 0.0065 Y 2047.531575 0 0.6550 497 | 7/9 30 h-m-p 1.6000 8.0000 0.0001 -----C 2047.531575 0 0.0004 516 | 7/9 31 h-m-p 0.0160 8.0000 0.0043 +++++ 2047.531573 m 8.0000 533 | 7/9 32 h-m-p 0.1489 3.4480 0.2334 ----------Y 2047.531573 0 0.0000 557 | 7/9 33 h-m-p 0.0160 8.0000 0.0015 +++++ 2047.531572 m 8.0000 574 | 7/9 34 h-m-p 0.0469 2.9479 0.2637 ---------C 2047.531572 0 0.0000 597 | 7/9 35 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531572 m 8.0000 614 | 7/9 36 h-m-p 0.0041 2.0672 0.3848 --------Y 2047.531572 0 0.0000 636 | 7/9 37 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9 38 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531572 m 8.0000 678 | 7/9 39 h-m-p 0.0103 5.1673 0.2158 --------N 2047.531572 0 0.0000 700 | 7/9 40 h-m-p 0.0160 8.0000 0.0008 ------Y 2047.531572 0 0.0000 720 | 7/9 41 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531572 m 8.0000 737 | 7/9 42 h-m-p 0.0053 2.6297 0.2976 --------C 2047.531572 0 0.0000 759 | 7/9 43 h-m-p 0.0160 8.0000 0.0001 ----Y 2047.531572 0 0.0000 777 | 7/9 44 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531572 m 8.0000 794 | 7/9 45 h-m-p 0.0058 2.9178 0.2919 ---------Y 2047.531572 0 0.0000 817 | 7/9 46 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531572 m 8.0000 834 | 7/9 47 h-m-p 0.0080 3.9814 0.2076 -----------C 2047.531572 0 0.0000 859 | 7/9 48 h-m-p 0.0160 8.0000 0.0052 +++++ 2047.531568 m 8.0000 876 | 7/9 49 h-m-p 0.1846 3.8848 0.2256 -----------Y 2047.531568 0 0.0000 901 | 7/9 50 h-m-p 0.0160 8.0000 0.0001 +++++ 2047.531568 m 8.0000 918 | 7/9 51 h-m-p 0.0085 4.2587 0.2060 ----------C 2047.531568 0 0.0000 942 | 7/9 52 h-m-p 0.0160 8.0000 0.0000 ----Y 2047.531568 0 0.0000 960 | 7/9 53 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531568 m 8.0000 977 | 7/9 54 h-m-p 0.0160 8.0000 0.0570 -------C 2047.531568 0 0.0000 998 | 7/9 55 h-m-p 0.0160 8.0000 0.0002 -----------Y 2047.531568 0 0.0000 1023 | 7/9 56 h-m-p 0.0160 8.0000 0.0000 ---C 2047.531568 0 0.0001 1040 Out.. lnL = -2047.531568 1041 lfun, 3123 eigenQcodon, 12492 P(t) Time used: 0:04 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.060775 0.078513 0.056402 0.045755 0.081828 0.095225 0.171116 1.199407 0.433144 0.460395 1.378312 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.115025 np = 11 lnL0 = -2257.519419 Iterating by ming2 Initial: fx= 2257.519419 x= 0.06077 0.07851 0.05640 0.04576 0.08183 0.09523 0.17112 1.19941 0.43314 0.46039 1.37831 1 h-m-p 0.0000 0.0001 1187.1120 ++ 2122.232504 m 0.0001 16 | 1/11 2 h-m-p 0.0000 0.0001 506.4338 ++ 2094.333857 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0000 3754.9333 ++ 2084.331568 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0000 278490.1676 ++ 2056.609468 m 0.0000 58 | 4/11 5 h-m-p 0.0000 0.0000 5545.8434 ++ 2053.371199 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 11726.7016 ++ 2049.039745 m 0.0000 86 | 6/11 7 h-m-p 0.0053 0.0485 11.1244 ------------.. | 6/11 8 h-m-p 0.0000 0.0000 518.7862 ++ 2047.531584 m 0.0000 124 | 7/11 9 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531584 m 8.0000 141 | 7/11 10 h-m-p 0.2408 8.0000 0.0003 +++ 2047.531584 m 8.0000 160 | 7/11 11 h-m-p 0.0160 8.0000 1.2682 --------C 2047.531584 0 0.0000 186 | 7/11 12 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531584 m 8.0000 203 | 7/11 13 h-m-p 0.0160 8.0000 0.0314 +++++ 2047.531582 m 8.0000 224 | 7/11 14 h-m-p 0.1414 8.0000 1.7752 ----------C 2047.531582 0 0.0000 252 | 7/11 15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11 16 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531582 m 8.0000 298 | 7/11 17 h-m-p 0.0160 8.0000 0.3006 -----------Y 2047.531582 0 0.0000 327 | 7/11 18 h-m-p 0.0160 8.0000 0.0003 +++++ 2047.531582 m 8.0000 348 | 7/11 19 h-m-p 0.0160 8.0000 0.4347 ----------Y 2047.531582 0 0.0000 376 | 7/11 20 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531582 m 8.0000 397 | 7/11 21 h-m-p 0.0160 8.0000 0.5221 --------N 2047.531582 0 0.0000 423 | 7/11 22 h-m-p 0.0160 8.0000 0.0062 +++++ 2047.531581 m 8.0000 444 | 7/11 23 h-m-p 0.0839 8.0000 0.5898 ----------Y 2047.531581 0 0.0000 472 | 7/11 24 h-m-p 0.0160 8.0000 0.0000 +++++ 2047.531581 m 8.0000 493 | 7/11 25 h-m-p 0.0160 8.0000 0.5163 ---------Y 2047.531581 0 0.0000 520 | 7/11 26 h-m-p 0.0160 8.0000 0.0000 ---------Y 2047.531581 0 0.0000 547 | 7/11 27 h-m-p 0.0160 8.0000 0.0000 ---C 2047.531581 0 0.0001 568 Out.. lnL = -2047.531581 569 lfun, 2276 eigenQcodon, 10242 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -2047.564211 S = -2047.524819 -0.015178 Calculating f(w|X), posterior probabilities of site classes. did 10 / 61 patterns 0:07 did 20 / 61 patterns 0:07 did 30 / 61 patterns 0:07 did 40 / 61 patterns 0:07 did 50 / 61 patterns 0:07 did 60 / 61 patterns 0:07 did 61 / 61 patterns 0:07 Time used: 0:07 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.094469 0.084892 0.037110 0.070378 0.045186 0.097775 0.089394 0.682333 1.259991 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.379276 np = 9 lnL0 = -2258.382282 Iterating by ming2 Initial: fx= 2258.382282 x= 0.09447 0.08489 0.03711 0.07038 0.04519 0.09778 0.08939 0.68233 1.25999 1 h-m-p 0.0000 0.0001 1137.1723 ++ 2153.342348 m 0.0001 14 | 1/9 2 h-m-p 0.0003 0.0014 134.0642 ++ 2130.891227 m 0.0014 26 | 2/9 3 h-m-p 0.0000 0.0000 15814.5252 ++ 2122.791907 m 0.0000 38 | 3/9 4 h-m-p 0.0001 0.0003 411.0635 ++ 2098.941326 m 0.0003 50 | 4/9 5 h-m-p 0.0001 0.0003 417.3837 ++ 2058.989811 m 0.0003 62 | 5/9 6 h-m-p 0.0000 0.0001 135.4524 ++ 2058.010366 m 0.0001 74 | 6/9 7 h-m-p 0.0011 0.0759 7.1978 -----------.. | 6/9 8 h-m-p 0.0000 0.0000 512.2938 ++ 2047.531564 m 0.0000 107 | 7/9 9 h-m-p 0.4035 8.0000 0.0000 +++ 2047.531564 m 8.0000 120 | 7/9 10 h-m-p 0.1976 8.0000 0.0004 +++ 2047.531564 m 8.0000 135 | 7/9 11 h-m-p 0.0160 8.0000 1.0767 +++++ 2047.531552 m 8.0000 152 | 7/9 12 h-m-p 1.6000 8.0000 0.0886 ++ 2047.531552 m 8.0000 164 | 7/9 13 h-m-p 0.5774 8.0000 1.2278 --------Y 2047.531552 0 0.0000 186 | 7/9 14 h-m-p 1.6000 8.0000 0.0000 C 2047.531552 0 1.6000 198 | 7/9 15 h-m-p 1.1765 8.0000 0.0000 N 2047.531552 0 1.1765 212 | 7/9 16 h-m-p 0.0248 8.0000 0.0000 C 2047.531552 0 0.0062 226 Out.. lnL = -2047.531552 227 lfun, 2497 eigenQcodon, 13620 P(t) Time used: 0:10 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.039665 0.034744 0.073440 0.032130 0.106752 0.068970 0.000100 0.900000 1.155313 1.499020 1.300003 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 12.741420 np = 11 lnL0 = -2223.594534 Iterating by ming2 Initial: fx= 2223.594534 x= 0.03966 0.03474 0.07344 0.03213 0.10675 0.06897 0.00011 0.90000 1.15531 1.49902 1.30000 1 h-m-p 0.0000 0.0000 1159.4543 ++ 2221.143673 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0008 370.9723 ++++ 2125.479148 m 0.0008 32 | 2/11 3 h-m-p 0.0000 0.0000 8450.9391 ++ 2118.993841 m 0.0000 46 | 3/11 4 h-m-p 0.0001 0.0005 130.4747 ++ 2114.736312 m 0.0005 60 | 4/11 5 h-m-p 0.0000 0.0002 630.7935 ++ 2081.891524 m 0.0002 74 | 5/11 6 h-m-p 0.0000 0.0001 653.8661 ++ 2078.600959 m 0.0001 88 | 6/11 7 h-m-p 0.0000 0.0002 754.1063 ++ 2047.531591 m 0.0002 102 | 7/11 8 h-m-p 1.6000 8.0000 0.0003 ++ 2047.531591 m 8.0000 116 | 7/11 9 h-m-p 0.0077 2.0359 0.2982 +++++ 2047.531579 m 2.0359 137 | 8/11 10 h-m-p 1.3794 6.8970 0.3359 ++ 2047.531509 m 6.8970 155 | 9/11 11 h-m-p 1.6000 8.0000 0.0034 ++ 2047.531509 m 8.0000 172 | 9/11 12 h-m-p 1.4708 8.0000 0.0183 ++ 2047.531509 m 8.0000 188 | 9/11 13 h-m-p 0.6863 8.0000 0.2133 ++ 2047.531509 m 8.0000 204 | 9/11 14 h-m-p 0.7105 8.0000 2.4017 -------C 2047.531509 0 0.0000 227 | 9/11 15 h-m-p 1.0699 8.0000 0.0000 N 2047.531509 0 1.0699 241 | 9/11 16 h-m-p 1.6000 8.0000 0.0000 N 2047.531509 0 0.4000 257 | 9/11 17 h-m-p 1.0041 8.0000 0.0000 C 2047.531509 0 1.0041 273 | 9/11 18 h-m-p 0.4246 8.0000 0.0000 +Y 2047.531509 0 1.6985 290 | 9/11 19 h-m-p 1.4701 8.0000 0.0000 -------N 2047.531509 0 0.0000 313 Out.. lnL = -2047.531509 314 lfun, 3768 eigenQcodon, 20724 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -2047.661355 S = -2047.533574 -0.057813 Calculating f(w|X), posterior probabilities of site classes. did 10 / 61 patterns 0:16 did 20 / 61 patterns 0:16 did 30 / 61 patterns 0:16 did 40 / 61 patterns 0:16 did 50 / 61 patterns 0:17 did 60 / 61 patterns 0:17 did 61 / 61 patterns 0:17 Time used: 0:17 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=525 NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA NC_002677_1_NP_301960_1_832_ML1339 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL NC_002677_1_NP_301960_1_832_ML1339 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS NC_002677_1_NP_301960_1_832_ML1339 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN NC_002677_1_NP_301960_1_832_ML1339 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NC_002677_1_NP_301960_1_832_ML1339 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF NC_002677_1_NP_301960_1_832_ML1339 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF NC_002677_1_NP_301960_1_832_ML1339 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD NC_002677_1_NP_301960_1_832_ML1339 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL NC_002677_1_NP_301960_1_832_ML1339 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS NC_002677_1_NP_301960_1_832_ML1339 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ************************************************** NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 ACAVPPIIGYLTSGKLPATDTYCPA NC_002677_1_NP_301960_1_832_ML1339 ACAVPPIIGYLTSGKLPATDTYCPA NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 ACAVPPIIGYLTSGKLPATDTYCPA NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 ACAVPPIIGYLTSGKLPATDTYCPA NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 ACAVPPIIGYLTSGKLPATDTYCPA NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 ACAVPPIIGYLTSGKLPATDTYCPA *************************
>NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >NC_002677_1_NP_301960_1_832_ML1339 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC >NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 ATGGCTACTGTGGTCGGCATGCGTTGGCACACCAGATCCGCCACGATTTT GGTTGCTGTTACCGCATTGCTGGTAGGTTGTGTCCCGGGCCTAGCCGCGA ACCCGCGGTTCGCCACCAACTCCGGTGCTCGACCGCAAGGCGCGGCCGCC ACCACTACACCGGCCGCCGGGCCGCTGCTGATCGCTGCACCCAAAAAGGA CTTGTCGTGGCACGACTGCACGTCACGGCTATTCAGGGATGCCGGGGTCG CAGCGGCACCCGGCATACAGTTGGAGTGTGCGGACTACGACTCCGACCTC GACCCAGTCAACGGTGGATCTGGGACCGTGACCATTGGAGCGGTCCGCGC CCGCTCCAGTCAAACGCCACGCGACGCAGGCCCCCTGGTTTTCACCACCG GATCCGACCTGCCGTCGTCGGCACAGCTACCGGTCTGGCTGTCACGCTCG GGCGCCGATGTGGTCCGCACTCACCCCATCGTCGCAGTCGACCGACGCGG CATAGGCATGTCGAACCCGATCGACTGCCGCGACCACTACGATCGCCAAA AGATGCGCGACCAGGCGCAGTTCGAGTCCGGCGACGATCCCGTGGCTAAC CTTTCCGACATTTCAAACACCGCCACCACCAACTGCACCGACGCCATCAC ACCAGGAACTTCCGCCTACGACAACTCACACGCCGCCTCTGATATCGAGC GACTGCGCAACCTCTGGGACGTACCCGCACTCGCGCTGATCGGGATCGGC AACGGGGCCGAGGTAGCATTAGCCTACGCTGCGTCGCGTCCCGACCGGGT CGCGAGGTTGATCCTCGACTCCCCGATTGCATTGGGGATCAAGACCGAAG CTGCCGCCGAGCAACAAGTCAGGGGCCAGCAGGCCGCGCTCGATACGTTC GCTGCGCAATGCGTTGCGCTGAAATGTGCGCTAGGACCCGATCCGAAGAG CGCCGTCACTGCGCTGCTGGCTGCCGCCCACGCCGGTAAAGGGCCCGGCG GTGCATCGGTGGCCGCAGTAACCAACGCCATCACTGTCTCTTTGGGTTTC CCTTCAGGTGACCGGGTCGGCACGACCATGAGCCTGGCCAACGCGCTCGC GGCCGCCCGCAGCGGCGACGCCAATCCGTTGACCAACTTGATCCACCGCT CCGACGCCACACAGGATTCAGACGGCCAGTTTGTCAACGATTGCAGCGAC GCACTCAACCGCCCGACCCCCGACCGCGTTCGCGAACTGGTCGTTGCATG GGGGAAATTGTATCCCGAGTTCGGCACGGTCGGCGCACTCAACTTGGTAA AATGTGTGCACTGGCCCACAGGCACAACGCCGCAACCGCCAAAGAACCTC AAGATCGACGTCATGGTACTGGATGTACAAAACGACCCGATTGTGGGCTT TGAAGGGGTCGCCGCGACAACGGCCGCCATTATCAACGCCAACGCCGCCA GCAAACGGGTGATGTGGCAGGGCATCGGCCATGGTGCAAGCATCTATTCG GCCTGTGCGGTCCCGCCCATCATCGGCTATCTAACTAGCGGCAAGCTACC CGCAACTGACACCTACTGTCCCGCC
>NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >NC_002677_1_NP_301960_1_832_ML1339 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA >NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 MATVVGMRWHTRSATILVAVTALLVGCVPGLAANPRFATNSGARPQGAAA TTTPAAGPLLIAAPKKDLSWHDCTSRLFRDAGVAAAPGIQLECADYDSDL DPVNGGSGTVTIGAVRARSSQTPRDAGPLVFTTGSDLPSSAQLPVWLSRS GADVVRTHPIVAVDRRGIGMSNPIDCRDHYDRQKMRDQAQFESGDDPVAN LSDISNTATTNCTDAITPGTSAYDNSHAASDIERLRNLWDVPALALIGIG NGAEVALAYAASRPDRVARLILDSPIALGIKTEAAAEQQVRGQQAALDTF AAQCVALKCALGPDPKSAVTALLAAAHAGKGPGGASVAAVTNAITVSLGF PSGDRVGTTMSLANALAAARSGDANPLTNLIHRSDATQDSDGQFVNDCSD ALNRPTPDRVRELVVAWGKLYPEFGTVGALNLVKCVHWPTGTTPQPPKNL KIDVMVLDVQNDPIVGFEGVAATTAAIINANAASKRVMWQGIGHGASIYS ACAVPPIIGYLTSGKLPATDTYCPA
#NEXUS [ID: 5937814289] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 NC_002677_1_NP_301960_1_832_ML1339 NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 ; end; begin trees; translate 1 NC_011896_1_WP_010908281_1_1412_MLBR_RS06645, 2 NC_002677_1_NP_301960_1_832_ML1339, 3 NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525, 4 NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295, 5 NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285, 6 NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0671612,2:0.06896081,3:0.06963723,4:0.06833865,5:0.07206985,6:0.06827237); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0671612,2:0.06896081,3:0.06963723,4:0.06833865,5:0.07206985,6:0.06827237); end;
Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2120.34 -2123.28 2 -2120.36 -2125.44 -------------------------------------- TOTAL -2120.35 -2124.85 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1339/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899146 0.088910 0.378539 1.497152 0.862669 832.77 1140.49 1.001 r(A<->C){all} 0.157979 0.017199 0.000122 0.431004 0.123115 167.27 201.42 1.005 r(A<->G){all} 0.180790 0.021744 0.000161 0.482132 0.144867 152.98 223.34 1.007 r(A<->T){all} 0.166610 0.020798 0.000075 0.459213 0.126558 217.92 230.07 1.002 r(C<->G){all} 0.166227 0.019595 0.000144 0.452034 0.130329 102.13 138.86 1.010 r(C<->T){all} 0.159234 0.017823 0.000030 0.423067 0.126687 288.98 314.71 1.001 r(G<->T){all} 0.169161 0.021391 0.000060 0.473843 0.125348 129.16 144.76 1.001 pi(A){all} 0.195992 0.000100 0.176050 0.215564 0.195966 1119.70 1229.60 1.000 pi(C){all} 0.348534 0.000133 0.326733 0.371374 0.348518 1367.55 1383.97 1.002 pi(G){all} 0.286474 0.000125 0.265396 0.309250 0.286409 1341.25 1374.00 1.000 pi(T){all} 0.169000 0.000096 0.150566 0.188426 0.168907 1055.70 1116.64 1.000 alpha{1,2} 0.438335 0.254580 0.000109 1.417447 0.260389 1294.41 1337.33 1.000 alpha{3} 0.450780 0.240929 0.000217 1.442928 0.286566 645.12 967.68 1.000 pinvar{all} 0.999019 0.000001 0.996851 0.999998 0.999367 1018.68 1041.59 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1339/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 525 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 6 6 6 6 6 6 TTC 7 7 7 7 7 7 | TCC 10 10 10 10 10 10 | TAC 5 5 5 5 5 5 | TGC 5 5 5 5 5 5 Leu TTA 1 1 1 1 1 1 | TCA 6 6 6 6 6 6 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 11 11 11 11 11 11 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2 CTC 9 9 9 9 9 9 | CCC 15 15 15 15 15 15 | CAC 8 8 8 8 8 8 | CGC 15 15 15 15 15 15 CTA 6 6 6 6 6 6 | CCA 4 4 4 4 4 4 | Gln CAA 8 8 8 8 8 8 | CGA 3 3 3 3 3 3 CTG 14 14 14 14 14 14 | CCG 16 16 16 16 16 16 | CAG 9 9 9 9 9 9 | CGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 6 6 6 6 6 6 | Thr ACT 8 8 8 8 8 8 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1 ATC 17 17 17 17 17 17 | ACC 18 18 18 18 18 18 | AAC 20 20 20 20 20 20 | AGC 7 7 7 7 7 7 ATA 2 2 2 2 2 2 | ACA 6 6 6 6 6 6 | Lys AAA 6 6 6 6 6 6 | Arg AGA 1 1 1 1 1 1 Met ATG 7 7 7 7 7 7 | ACG 8 8 8 8 8 8 | AAG 7 7 7 7 7 7 | AGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 9 9 9 9 9 9 | Asp GAT 10 10 10 10 10 10 | Gly GGT 8 8 8 8 8 8 GTC 20 20 20 20 20 20 | GCC 39 39 39 39 39 39 | GAC 28 28 28 28 28 28 | GGC 23 23 23 23 23 23 GTA 7 7 7 7 7 7 | GCA 17 17 17 17 17 17 | Glu GAA 3 3 3 3 3 3 | GGA 5 5 5 5 5 5 GTG 8 8 8 8 8 8 | GCG 18 18 18 18 18 18 | GAG 6 6 6 6 6 6 | GGG 9 9 9 9 9 9 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908281_1_1412_MLBR_RS06645 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 #2: NC_002677_1_NP_301960_1_832_ML1339 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 #3: NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 #4: NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 #5: NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 #6: NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450 position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 18 | Tyr Y TAT 18 | Cys C TGT 36 TTC 42 | TCC 60 | TAC 30 | TGC 30 Leu L TTA 6 | TCA 36 | *** * TAA 0 | *** * TGA 0 TTG 66 | TCG 48 | TAG 0 | Trp W TGG 42 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 12 CTC 54 | CCC 90 | CAC 48 | CGC 90 CTA 36 | CCA 24 | Gln Q CAA 48 | CGA 18 CTG 84 | CCG 96 | CAG 54 | CGG 30 ------------------------------------------------------------------------------ Ile I ATT 36 | Thr T ACT 48 | Asn N AAT 6 | Ser S AGT 6 ATC 102 | ACC 108 | AAC 120 | AGC 42 ATA 12 | ACA 36 | Lys K AAA 36 | Arg R AGA 6 Met M ATG 42 | ACG 48 | AAG 42 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 54 | Asp D GAT 60 | Gly G GGT 48 GTC 120 | GCC 234 | GAC 168 | GGC 138 GTA 42 | GCA 102 | Glu E GAA 18 | GGA 30 GTG 48 | GCG 108 | GAG 36 | GGG 54 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14095 C:0.22286 A:0.22476 G:0.41143 position 2: T:0.23619 C:0.35429 A:0.21905 G:0.19048 position 3: T:0.12952 C:0.46857 A:0.14286 G:0.25905 Average T:0.16889 C:0.34857 A:0.19556 G:0.28698 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -2047.531592 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299965 1.300003 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908281_1_1412_MLBR_RS06645: 0.000004, NC_002677_1_NP_301960_1_832_ML1339: 0.000004, NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525: 0.000004, NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295: 0.000004, NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285: 0.000004, NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29997 omega (dN/dS) = 1.30000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 1204.2 370.8 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -2047.531568 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.171116 0.820221 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908281_1_1412_MLBR_RS06645: 0.000004, NC_002677_1_NP_301960_1_832_ML1339: 0.000004, NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525: 0.000004, NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295: 0.000004, NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285: 0.000004, NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.17112 MLEs of dN/dS (w) for site classes (K=2) p: 0.82022 0.17978 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 7..2 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 7..3 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 7..4 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 7..5 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 7..6 0.000 1205.9 369.1 0.1798 0.0000 0.0000 0.0 0.0 Time used: 0:04 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -2047.531581 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.089394 0.577827 0.252751 0.000001 1.261776 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908281_1_1412_MLBR_RS06645: 0.000004, NC_002677_1_NP_301960_1_832_ML1339: 0.000004, NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525: 0.000004, NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295: 0.000004, NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285: 0.000004, NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.08939 MLEs of dN/dS (w) for site classes (K=3) p: 0.57783 0.25275 0.16942 w: 0.00000 1.00000 1.26178 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 7..2 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 7..3 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 7..4 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 7..5 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 7..6 0.000 1207.0 368.0 0.4665 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908281_1_1412_MLBR_RS06645) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908281_1_1412_MLBR_RS06645) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -2047.531552 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 2.284473 10.398286 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908281_1_1412_MLBR_RS06645: 0.000004, NC_002677_1_NP_301960_1_832_ML1339: 0.000004, NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525: 0.000004, NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295: 0.000004, NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285: 0.000004, NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 2.28447 q = 10.39829 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.04219 0.07497 0.10100 0.12546 0.15020 0.17657 0.20619 0.24178 0.28971 0.37663 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 7..2 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 7..3 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 7..4 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 7..5 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 7..6 0.000 1208.3 366.7 0.1785 0.0000 0.0000 0.0 0.0 Time used: 0:10 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -2047.531509 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.443531 1.115080 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908281_1_1412_MLBR_RS06645: 0.000004, NC_002677_1_NP_301960_1_832_ML1339: 0.000004, NZ_LVXE01000016_1_WP_010908281_1_604_A3216_RS06525: 0.000004, NZ_LYPH01000019_1_WP_010908281_1_700_A8144_RS03295: 0.000004, NZ_CP029543_1_WP_010908281_1_1434_DIJ64_RS07285: 0.000004, NZ_AP014567_1_WP_010908281_1_1467_JK2ML_RS07450: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.44353 (p1 = 0.00001) w = 1.11508 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.11508 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 1208.3 366.7 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908281_1_1412_MLBR_RS06645) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.090 0.092 0.094 0.097 0.099 0.101 0.103 0.105 0.108 0.110 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.109 0.107 0.105 0.103 0.101 0.099 0.097 0.095 0.093 0.091 Time used: 0:17
Model 1: NearlyNeutral -2047.531568 Model 2: PositiveSelection -2047.531581 Model 0: one-ratio -2047.531592 Model 7: beta -2047.531552 Model 8: beta&w>1 -2047.531509 Model 0 vs 1 4.799999987881165E-5 Model 2 vs 1 2.5999999706982635E-5 Model 8 vs 7 8.600000001024455E-5