--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:43:37 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1351/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -869.31 -872.50
2 -869.34 -872.48
--------------------------------------
TOTAL -869.32 -872.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893844 0.087664 0.359805 1.449046 0.863673 1443.45 1472.23 1.000
r(A<->C){all} 0.166218 0.018921 0.000159 0.441359 0.131300 316.40 397.03 1.006
r(A<->G){all} 0.163909 0.019267 0.000037 0.438457 0.129028 197.63 283.06 1.000
r(A<->T){all} 0.175413 0.020889 0.000014 0.460077 0.137527 225.03 234.81 1.000
r(C<->G){all} 0.162349 0.019607 0.000020 0.452484 0.124952 315.00 326.82 1.002
r(C<->T){all} 0.158556 0.019721 0.000029 0.454070 0.121822 210.97 250.07 1.000
r(G<->T){all} 0.173555 0.021011 0.000025 0.462860 0.133901 160.01 190.77 1.011
pi(A){all} 0.161243 0.000208 0.134535 0.191519 0.160696 1261.10 1298.87 1.000
pi(C){all} 0.304911 0.000327 0.269199 0.339418 0.304584 932.48 1124.40 1.000
pi(G){all} 0.317185 0.000330 0.281544 0.350790 0.317053 1165.53 1261.50 1.000
pi(T){all} 0.216662 0.000266 0.185275 0.249153 0.216425 1049.46 1170.99 1.000
alpha{1,2} 0.427965 0.233591 0.000192 1.402163 0.260075 1185.77 1242.29 1.000
alpha{3} 0.475847 0.258918 0.000172 1.550464 0.304447 1308.79 1314.05 1.000
pinvar{all} 0.997654 0.000008 0.992495 0.999997 0.998514 1246.82 1267.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -848.032626
Model 2: PositiveSelection -848.032624
Model 0: one-ratio -848.032629
Model 7: beta -848.032649
Model 8: beta&w>1 -848.03262
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 5.800000008093775E-5
>C1
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C2
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C3
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C4
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C5
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C6
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214
C1 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C2 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C3 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C4 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C5 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C6 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
**************************************************
C1 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C2 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C3 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C4 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C5 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C6 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
**************************************************
C1 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C2 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C3 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C4 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C5 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C6 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
**************************************************
C1 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C2 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C3 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C4 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C5 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C6 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
**************************************************
C1 YRRSPRAPAPGASD
C2 YRRSPRAPAPGASD
C3 YRRSPRAPAPGASD
C4 YRRSPRAPAPGASD
C5 YRRSPRAPAPGASD
C6 YRRSPRAPAPGASD
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 214 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 214 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6420]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6420]--->[6420]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.760 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C2 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C3 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C4 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C5 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C6 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
**************************************************
C1 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C2 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C3 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C4 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C5 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C6 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
**************************************************
C1 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C2 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C3 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C4 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C5 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C6 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
**************************************************
C1 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C2 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C3 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C4 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C5 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C6 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
**************************************************
C1 YRRSPRAPAPGASD
C2 YRRSPRAPAPGASD
C3 YRRSPRAPAPGASD
C4 YRRSPRAPAPGASD
C5 YRRSPRAPAPGASD
C6 YRRSPRAPAPGASD
**************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C2 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C3 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C4 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C5 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C6 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
**************************************************
C1 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C2 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C3 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C4 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C5 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C6 GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
**************************************************
C1 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C2 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C3 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C4 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C5 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C6 CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
**************************************************
C1 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C2 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C3 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C4 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C5 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C6 GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
**************************************************
C1 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C2 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C3 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C4 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C5 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C6 GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
**************************************************
C1 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C2 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C3 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C4 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C5 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C6 ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
**************************************************
C1 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C2 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C3 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C4 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C5 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C6 GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
**************************************************
C1 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C2 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C3 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C4 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C5 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C6 CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
**************************************************
C1 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C2 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C3 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C4 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C5 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C6 CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
**************************************************
C1 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C2 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C3 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C4 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C5 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C6 AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
**************************************************
C1 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C2 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C3 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C4 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C5 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C6 TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
**************************************************
C1 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C2 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C3 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C4 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C5 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C6 CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
**************************************************
C1 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C2 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C3 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C4 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C5 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C6 TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
******************************************
>C1
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C2
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C3
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C4
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C5
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C6
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C1
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C2
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C3
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C4
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C5
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C6
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 642 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858933
Setting output file names to "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1685683152
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5600241292
Seed = 1918191050
Swapseed = 1579858933
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1436.826776 -- -24.965149
Chain 2 -- -1436.826693 -- -24.965149
Chain 3 -- -1436.826693 -- -24.965149
Chain 4 -- -1436.826693 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1436.826776 -- -24.965149
Chain 2 -- -1436.826693 -- -24.965149
Chain 3 -- -1436.826776 -- -24.965149
Chain 4 -- -1436.826776 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1436.827] (-1436.827) (-1436.827) (-1436.827) * [-1436.827] (-1436.827) (-1436.827) (-1436.827)
500 -- (-887.122) (-893.473) (-901.313) [-881.502] * [-880.379] (-879.794) (-901.591) (-882.889) -- 0:00:00
1000 -- (-887.614) (-883.486) (-877.502) [-877.143] * (-884.972) (-883.709) (-881.327) [-883.471] -- 0:00:00
1500 -- (-879.263) (-882.951) (-884.531) [-879.213] * (-880.479) (-879.642) [-879.992] (-880.203) -- 0:00:00
2000 -- (-893.325) (-882.685) [-881.015] (-881.071) * [-876.120] (-886.287) (-877.575) (-883.627) -- 0:00:00
2500 -- (-875.968) (-879.918) [-874.606] (-879.742) * (-880.210) (-877.047) [-879.443] (-896.760) -- 0:00:00
3000 -- [-878.641] (-884.266) (-873.907) (-879.545) * (-873.543) (-871.408) [-876.113] (-877.959) -- 0:00:00
3500 -- (-879.375) [-878.571] (-879.752) (-881.032) * (-887.211) (-883.616) (-882.597) [-876.135] -- 0:00:00
4000 -- (-887.368) [-882.348] (-879.912) (-881.322) * [-878.547] (-877.266) (-878.711) (-872.158) -- 0:00:00
4500 -- [-873.515] (-877.584) (-881.451) (-877.561) * [-875.664] (-874.519) (-878.248) (-886.538) -- 0:00:00
5000 -- [-879.944] (-875.951) (-881.359) (-879.864) * (-878.043) (-876.639) (-880.955) [-879.352] -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-882.053) [-882.078] (-876.976) (-872.785) * (-876.905) (-879.619) (-878.733) [-883.422] -- 0:00:00
6000 -- (-880.727) (-891.317) (-881.209) [-878.561] * (-879.597) [-880.308] (-887.903) (-881.510) -- 0:00:00
6500 -- (-874.679) [-886.450] (-879.344) (-876.424) * [-879.494] (-887.571) (-881.688) (-881.059) -- 0:00:00
7000 -- (-877.319) (-877.260) [-878.376] (-879.386) * (-882.236) (-884.548) (-872.509) [-877.959] -- 0:00:00
7500 -- (-877.483) (-876.814) (-876.414) [-875.040] * (-875.254) [-877.485] (-881.789) (-887.128) -- 0:00:00
8000 -- [-881.404] (-884.217) (-877.726) (-888.456) * [-873.135] (-873.960) (-877.817) (-874.867) -- 0:00:00
8500 -- [-881.247] (-872.835) (-875.307) (-878.968) * (-880.520) (-892.235) (-887.602) [-878.511] -- 0:00:00
9000 -- [-880.250] (-876.692) (-880.563) (-876.119) * (-888.995) [-882.290] (-874.806) (-881.440) -- 0:00:00
9500 -- [-879.074] (-884.922) (-888.169) (-881.259) * (-879.936) (-879.560) (-881.364) [-876.606] -- 0:00:00
10000 -- [-873.711] (-877.447) (-881.012) (-877.995) * (-883.275) (-879.220) (-882.211) [-877.202] -- 0:00:00
Average standard deviation of split frequencies: 0.095754
10500 -- (-878.284) (-877.879) [-882.518] (-883.713) * (-869.134) (-882.874) (-881.853) [-875.609] -- 0:00:00
11000 -- (-882.578) (-887.302) [-879.555] (-880.935) * (-870.098) (-875.658) (-885.181) [-875.297] -- 0:00:00
11500 -- (-877.818) (-882.096) (-884.408) [-879.154] * (-868.169) (-884.403) (-880.390) [-880.192] -- 0:00:00
12000 -- (-876.632) (-884.817) (-881.874) [-875.011] * (-869.961) (-877.848) (-879.590) [-877.326] -- 0:00:00
12500 -- (-877.075) (-875.589) (-891.934) [-879.768] * (-868.971) (-880.943) (-879.164) [-884.104] -- 0:00:00
13000 -- [-875.039] (-878.621) (-880.561) (-877.255) * (-868.066) (-879.430) [-887.193] (-878.434) -- 0:00:00
13500 -- (-881.739) (-878.787) [-871.965] (-881.236) * (-869.289) (-876.905) (-875.718) [-879.719] -- 0:00:00
14000 -- [-877.131] (-879.543) (-872.215) (-875.224) * [-871.933] (-881.046) (-876.627) (-879.642) -- 0:01:10
14500 -- (-880.574) (-884.731) (-870.729) [-877.234] * [-873.926] (-880.205) (-882.151) (-876.158) -- 0:01:07
15000 -- (-877.991) (-879.710) [-868.423] (-876.989) * (-867.944) (-873.494) (-879.462) [-876.240] -- 0:01:05
Average standard deviation of split frequencies: 0.065473
15500 -- [-876.181] (-895.038) (-868.866) (-878.525) * (-870.616) (-881.537) [-882.197] (-882.698) -- 0:01:03
16000 -- (-881.320) [-886.570] (-870.089) (-889.442) * (-871.259) (-885.372) (-877.697) [-875.595] -- 0:01:01
16500 -- [-877.129] (-887.330) (-869.596) (-880.344) * (-868.224) (-875.286) (-879.530) [-875.271] -- 0:00:59
17000 -- (-884.859) (-872.820) [-869.198] (-879.925) * (-870.068) (-878.227) (-884.151) [-878.437] -- 0:00:57
17500 -- (-887.641) (-870.267) (-868.505) [-876.440] * (-870.709) (-880.371) (-884.302) [-875.466] -- 0:00:56
18000 -- [-874.614] (-871.062) (-868.835) (-887.562) * (-870.572) (-881.612) [-875.786] (-878.061) -- 0:00:54
18500 -- [-877.200] (-874.507) (-870.562) (-885.690) * (-871.016) (-879.161) (-876.267) [-881.906] -- 0:00:53
19000 -- (-875.887) (-872.022) (-869.536) [-873.837] * [-870.699] (-893.418) (-879.295) (-881.702) -- 0:00:51
19500 -- (-880.342) (-870.562) (-868.214) [-876.895] * (-872.152) (-876.371) [-872.285] (-885.495) -- 0:00:50
20000 -- (-891.519) (-877.378) [-867.926] (-887.410) * (-871.170) (-879.323) (-871.991) [-878.928] -- 0:00:49
Average standard deviation of split frequencies: 0.049897
20500 -- (-879.747) (-873.255) (-869.828) [-871.001] * (-874.155) (-882.171) (-870.286) [-873.953] -- 0:00:47
21000 -- (-884.174) [-868.148] (-870.003) (-871.630) * (-870.936) (-878.396) [-869.732] (-876.079) -- 0:00:46
21500 -- (-879.147) (-869.727) (-869.061) [-868.608] * (-874.500) (-877.535) (-873.288) [-874.621] -- 0:00:45
22000 -- (-885.386) (-869.804) (-868.345) [-868.416] * (-873.398) [-879.999] (-872.929) (-877.183) -- 0:00:44
22500 -- [-876.092] (-869.725) (-869.845) (-869.190) * (-871.357) (-880.594) (-869.929) [-876.891] -- 0:00:43
23000 -- (-883.626) [-869.955] (-877.141) (-870.205) * (-871.802) (-879.881) [-868.722] (-878.716) -- 0:00:42
23500 -- (-884.527) [-867.919] (-880.008) (-871.042) * (-872.263) [-874.635] (-868.886) (-877.792) -- 0:00:41
24000 -- [-879.946] (-868.447) (-874.402) (-870.256) * (-874.766) [-875.161] (-870.990) (-881.510) -- 0:00:40
24500 -- [-881.885] (-868.621) (-869.979) (-869.306) * (-871.357) (-881.813) [-872.087] (-883.095) -- 0:00:39
25000 -- (-882.703) (-871.214) [-872.465] (-868.558) * [-870.402] (-883.729) (-868.512) (-884.712) -- 0:00:39
Average standard deviation of split frequencies: 0.038734
25500 -- [-889.884] (-875.534) (-871.045) (-868.926) * (-869.908) (-887.513) (-871.074) [-874.129] -- 0:00:38
26000 -- (-885.017) (-872.131) (-872.711) [-873.102] * [-869.325] (-882.558) (-868.267) (-881.980) -- 0:00:37
26500 -- (-879.915) [-868.851] (-869.120) (-868.977) * (-870.412) (-879.585) (-869.358) [-880.904] -- 0:00:36
27000 -- [-880.205] (-870.847) (-871.131) (-870.849) * [-869.714] (-881.962) (-868.171) (-880.068) -- 0:00:36
27500 -- (-885.891) [-871.943] (-870.534) (-868.533) * (-868.375) [-876.482] (-868.775) (-883.608) -- 0:00:35
28000 -- (-888.674) (-872.497) (-871.495) [-871.665] * (-868.971) (-882.014) [-868.895] (-881.519) -- 0:00:34
28500 -- [-882.470] (-870.819) (-871.179) (-869.423) * (-868.489) [-881.267] (-873.488) (-883.078) -- 0:00:34
29000 -- (-876.050) (-871.377) (-868.780) [-868.925] * (-868.300) (-884.246) [-869.559] (-879.240) -- 0:00:33
29500 -- (-880.396) [-868.672] (-872.392) (-870.348) * [-868.226] (-884.744) (-869.208) (-876.115) -- 0:00:32
30000 -- (-882.976) (-868.012) (-870.657) [-867.963] * (-870.373) [-880.929] (-868.772) (-880.083) -- 0:01:04
Average standard deviation of split frequencies: 0.029975
30500 -- [-876.207] (-868.309) (-871.698) (-868.001) * [-870.362] (-875.498) (-872.559) (-884.863) -- 0:01:03
31000 -- (-877.271) (-868.258) (-871.794) [-871.128] * (-871.649) [-878.231] (-868.651) (-880.472) -- 0:01:02
31500 -- (-880.199) (-868.350) (-873.157) [-870.943] * (-869.404) [-876.494] (-870.754) (-880.723) -- 0:01:01
32000 -- (-882.295) (-870.034) [-871.435] (-868.103) * (-869.404) (-884.113) (-870.679) [-875.655] -- 0:01:00
32500 -- (-878.710) [-868.825] (-868.382) (-870.360) * [-868.865] (-876.485) (-873.554) (-877.135) -- 0:00:59
33000 -- (-879.133) (-868.718) (-868.240) [-868.773] * (-871.043) (-879.306) (-871.681) [-882.452] -- 0:00:58
33500 -- (-881.657) (-869.620) [-873.228] (-868.813) * (-872.034) [-877.810] (-869.153) (-883.946) -- 0:00:57
34000 -- [-878.928] (-869.636) (-869.607) (-869.355) * (-868.804) (-878.386) [-869.230] (-876.601) -- 0:00:56
34500 -- (-875.790) (-872.335) (-868.771) [-869.011] * [-869.388] (-874.916) (-875.341) (-879.389) -- 0:00:55
35000 -- [-882.352] (-870.739) (-870.490) (-868.905) * (-872.379) [-873.368] (-868.207) (-887.088) -- 0:00:55
Average standard deviation of split frequencies: 0.034046
35500 -- [-879.782] (-868.852) (-868.651) (-872.420) * (-869.826) (-878.570) (-868.201) [-873.899] -- 0:00:54
36000 -- (-881.251) [-869.779] (-868.517) (-874.594) * (-868.769) (-883.462) (-870.627) [-879.455] -- 0:00:53
36500 -- (-877.231) (-870.904) [-868.897] (-868.482) * (-871.339) (-884.425) (-868.817) [-878.773] -- 0:00:52
37000 -- (-880.151) (-870.843) (-869.700) [-872.050] * (-868.452) (-878.194) [-868.975] (-883.239) -- 0:00:52
37500 -- (-875.627) (-870.859) (-869.374) [-870.924] * [-869.570] (-880.894) (-871.360) (-878.444) -- 0:00:51
38000 -- (-877.523) (-868.064) [-870.103] (-873.676) * (-870.721) (-891.660) (-873.345) [-876.743] -- 0:00:50
38500 -- (-873.092) (-868.206) [-873.100] (-872.793) * (-869.736) [-877.710] (-870.755) (-871.754) -- 0:00:49
39000 -- [-878.708] (-871.204) (-870.424) (-870.357) * [-870.720] (-882.920) (-868.917) (-883.095) -- 0:00:49
39500 -- (-880.117) (-870.806) (-868.772) [-871.787] * (-871.402) (-880.975) [-868.467] (-880.804) -- 0:00:48
40000 -- (-878.269) (-870.308) [-868.976] (-871.113) * (-868.171) (-883.912) [-869.279] (-875.271) -- 0:00:48
Average standard deviation of split frequencies: 0.028152
40500 -- (-875.555) [-871.277] (-868.194) (-870.053) * (-870.737) (-876.261) [-869.917] (-874.437) -- 0:00:47
41000 -- (-885.735) (-870.345) (-867.883) [-870.119] * (-874.145) (-877.900) [-870.573] (-880.921) -- 0:00:46
41500 -- (-880.366) (-875.612) [-871.603] (-871.679) * (-872.305) (-878.869) [-869.496] (-876.587) -- 0:00:46
42000 -- (-874.880) [-870.243] (-869.517) (-870.859) * (-870.101) [-874.737] (-868.668) (-879.792) -- 0:00:45
42500 -- (-876.686) [-870.683] (-873.497) (-869.963) * (-868.503) (-881.305) [-868.308] (-878.875) -- 0:00:45
43000 -- [-883.140] (-869.997) (-871.618) (-868.064) * (-870.149) (-889.313) [-870.787] (-873.387) -- 0:00:44
43500 -- (-891.200) (-868.786) (-871.898) [-868.377] * (-870.198) (-885.965) (-874.126) [-880.698] -- 0:00:43
44000 -- (-883.868) (-870.536) (-872.902) [-868.944] * (-870.915) (-868.796) [-870.041] (-880.442) -- 0:00:43
44500 -- (-869.834) (-869.723) [-871.944] (-869.888) * (-872.109) (-870.174) [-869.624] (-874.416) -- 0:00:42
45000 -- (-871.039) (-869.724) (-870.658) [-868.981] * (-872.314) (-869.732) [-869.604] (-877.355) -- 0:00:42
Average standard deviation of split frequencies: 0.034160
45500 -- (-869.650) [-872.780] (-869.082) (-871.577) * (-876.696) [-869.692] (-868.708) (-887.801) -- 0:00:41
46000 -- (-870.429) [-868.263] (-869.081) (-869.447) * (-870.307) (-868.474) (-870.917) [-880.772] -- 0:00:41
46500 -- (-868.931) [-871.027] (-874.302) (-869.225) * (-871.427) (-869.376) (-869.625) [-882.061] -- 0:01:01
47000 -- (-870.380) (-870.373) (-875.963) [-871.425] * (-868.714) (-870.999) (-869.595) [-876.284] -- 0:01:00
47500 -- (-871.810) [-871.498] (-869.943) (-871.869) * (-869.194) (-869.158) [-869.990] (-879.850) -- 0:01:00
48000 -- (-869.578) (-873.751) (-870.815) [-869.678] * (-869.551) (-869.091) (-869.409) [-875.669] -- 0:00:59
48500 -- [-869.544] (-869.210) (-869.314) (-868.685) * (-870.248) (-869.505) [-870.168] (-882.268) -- 0:00:58
49000 -- (-871.263) [-869.545] (-871.665) (-872.053) * [-868.861] (-870.005) (-870.351) (-885.173) -- 0:00:58
49500 -- [-869.365] (-870.184) (-869.253) (-872.067) * (-870.495) [-869.183] (-870.715) (-879.842) -- 0:00:57
50000 -- [-870.656] (-869.214) (-869.400) (-868.698) * (-879.008) (-871.799) [-869.731] (-876.050) -- 0:00:57
Average standard deviation of split frequencies: 0.030127
50500 -- (-867.736) (-868.890) [-867.981] (-868.605) * (-879.580) (-870.991) (-870.474) [-875.402] -- 0:00:56
51000 -- [-868.107] (-870.118) (-874.362) (-868.112) * (-869.720) (-871.475) (-869.926) [-881.702] -- 0:00:55
51500 -- (-868.125) [-871.003] (-869.677) (-868.974) * (-874.238) (-870.263) [-872.355] (-873.744) -- 0:00:55
52000 -- (-869.858) (-869.908) (-872.537) [-868.664] * (-874.042) [-871.187] (-868.560) (-877.810) -- 0:00:54
52500 -- (-867.688) (-871.213) (-872.440) [-870.191] * (-870.304) (-869.966) [-870.018] (-896.419) -- 0:00:54
53000 -- (-868.095) (-870.057) (-870.718) [-868.966] * (-872.736) (-872.325) [-870.570] (-882.858) -- 0:00:53
53500 -- (-869.251) (-871.479) (-871.376) [-868.863] * (-871.225) (-870.796) [-869.134] (-882.309) -- 0:00:53
54000 -- [-870.460] (-871.698) (-869.149) (-867.970) * (-870.568) [-869.024] (-870.604) (-883.415) -- 0:00:52
54500 -- (-869.516) (-870.735) [-871.049] (-868.031) * (-870.559) (-870.753) (-869.773) [-874.692] -- 0:00:52
55000 -- [-868.897] (-872.143) (-873.043) (-869.126) * (-868.585) (-868.166) [-868.133] (-878.121) -- 0:00:51
Average standard deviation of split frequencies: 0.023570
55500 -- [-869.039] (-872.247) (-876.507) (-867.856) * (-869.437) (-869.547) [-870.092] (-881.362) -- 0:00:51
56000 -- (-869.088) (-869.736) (-868.150) [-870.163] * (-870.471) (-869.050) [-872.177] (-881.670) -- 0:00:50
56500 -- (-868.514) [-868.336] (-868.150) (-868.451) * (-869.945) (-868.073) [-871.082] (-878.054) -- 0:00:50
57000 -- [-869.123] (-868.955) (-868.150) (-871.860) * (-868.248) (-869.122) [-870.597] (-885.582) -- 0:00:49
57500 -- [-868.841] (-873.973) (-873.132) (-870.271) * (-871.335) (-868.125) (-869.830) [-880.736] -- 0:00:49
58000 -- (-869.020) (-869.303) (-871.260) [-870.563] * (-869.225) (-875.514) (-868.762) [-886.219] -- 0:00:48
58500 -- (-869.738) (-868.326) (-872.808) [-872.226] * (-871.677) [-874.883] (-872.119) (-876.446) -- 0:00:48
59000 -- (-873.572) (-869.616) [-869.401] (-872.323) * (-869.369) [-875.053] (-869.196) (-876.811) -- 0:00:47
59500 -- (-873.837) (-869.910) (-869.178) [-869.698] * [-868.276] (-868.811) (-869.364) (-878.931) -- 0:00:47
60000 -- (-869.793) (-876.798) [-868.545] (-871.557) * [-869.417] (-869.174) (-870.079) (-880.721) -- 0:00:47
Average standard deviation of split frequencies: 0.023700
60500 -- (-869.812) (-873.518) [-868.555] (-869.104) * (-871.311) (-869.323) (-871.504) [-873.133] -- 0:00:46
61000 -- (-870.005) (-871.906) (-868.069) [-868.328] * (-869.724) (-870.110) [-869.963] (-883.813) -- 0:00:46
61500 -- (-870.180) (-871.399) [-870.830] (-869.530) * (-875.649) (-871.021) [-868.816] (-881.711) -- 0:00:45
62000 -- (-870.742) (-870.802) [-868.350] (-870.365) * (-869.460) (-869.890) (-873.201) [-877.093] -- 0:00:45
62500 -- [-870.525] (-870.392) (-868.749) (-871.939) * (-873.132) [-868.653] (-873.740) (-880.914) -- 0:01:00
63000 -- [-868.570] (-869.298) (-868.842) (-876.143) * (-868.223) [-868.251] (-873.560) (-878.723) -- 0:00:59
63500 -- [-874.971] (-870.034) (-868.570) (-875.041) * [-870.014] (-869.549) (-870.885) (-886.965) -- 0:00:58
64000 -- (-868.986) (-870.354) [-869.680] (-876.176) * (-869.272) (-869.323) (-877.900) [-888.317] -- 0:00:58
64500 -- (-869.061) (-870.004) (-869.332) [-870.592] * (-868.119) [-869.335] (-871.881) (-881.397) -- 0:00:58
65000 -- (-869.557) (-868.207) (-868.886) [-870.095] * (-868.554) [-870.554] (-870.238) (-883.228) -- 0:00:57
Average standard deviation of split frequencies: 0.017686
65500 -- (-872.883) (-868.787) [-869.618] (-868.599) * [-869.431] (-871.198) (-869.435) (-881.435) -- 0:00:57
66000 -- (-874.721) (-871.074) [-869.075] (-871.777) * (-871.277) (-872.026) (-869.365) [-877.421] -- 0:00:56
66500 -- [-870.452] (-868.524) (-870.890) (-878.322) * (-868.016) (-870.904) [-868.767] (-883.562) -- 0:00:56
67000 -- (-869.350) (-868.800) [-868.133] (-873.321) * (-868.313) [-868.900] (-868.620) (-881.514) -- 0:00:55
67500 -- [-869.923] (-870.290) (-870.631) (-874.269) * (-869.466) (-870.226) [-869.964] (-874.079) -- 0:00:55
68000 -- (-871.968) [-871.968] (-869.729) (-868.482) * (-873.578) [-869.430] (-870.639) (-881.119) -- 0:00:54
68500 -- (-870.145) (-868.426) [-872.095] (-868.245) * (-875.834) [-870.371] (-871.573) (-878.815) -- 0:00:54
69000 -- (-870.939) [-869.663] (-871.925) (-868.473) * (-878.307) (-871.143) [-867.809] (-875.239) -- 0:00:53
69500 -- (-872.707) (-870.188) [-872.363] (-869.033) * (-876.515) (-873.159) (-868.332) [-881.292] -- 0:00:53
70000 -- (-869.415) [-870.133] (-877.198) (-872.339) * (-868.933) (-870.489) (-868.477) [-882.652] -- 0:00:53
Average standard deviation of split frequencies: 0.022014
70500 -- [-870.071] (-868.876) (-873.184) (-869.036) * [-869.925] (-872.305) (-870.347) (-884.166) -- 0:00:52
71000 -- [-869.531] (-870.375) (-869.581) (-871.439) * (-870.331) (-872.380) [-869.428] (-901.180) -- 0:00:52
71500 -- (-868.342) (-869.341) (-869.324) [-868.870] * (-870.166) (-875.108) [-869.103] (-879.063) -- 0:00:51
72000 -- (-868.950) (-869.435) (-873.467) [-868.055] * (-873.119) (-872.649) [-869.567] (-870.984) -- 0:00:51
72500 -- [-869.683] (-869.902) (-874.442) (-870.313) * [-875.215] (-873.941) (-869.864) (-872.912) -- 0:00:51
73000 -- (-873.365) (-870.374) (-870.256) [-869.046] * (-873.949) (-873.428) (-869.480) [-869.834] -- 0:00:50
73500 -- (-869.182) (-870.972) (-868.320) [-870.005] * (-872.614) [-873.866] (-868.787) (-870.424) -- 0:00:50
74000 -- [-870.995] (-869.749) (-867.985) (-868.498) * (-872.986) (-874.833) [-870.946] (-869.419) -- 0:00:50
74500 -- (-870.136) (-868.707) (-869.567) [-870.886] * [-871.295] (-876.880) (-871.147) (-869.661) -- 0:00:49
75000 -- (-869.456) (-871.273) [-871.631] (-869.117) * (-870.167) [-873.629] (-873.030) (-873.632) -- 0:00:49
Average standard deviation of split frequencies: 0.020893
75500 -- (-869.537) [-875.820] (-872.281) (-869.820) * (-871.081) (-870.731) (-869.332) [-869.672] -- 0:00:48
76000 -- (-870.135) (-875.726) [-870.322] (-869.474) * [-871.141] (-869.121) (-869.831) (-869.684) -- 0:00:48
76500 -- [-870.278] (-869.307) (-869.517) (-876.659) * [-869.663] (-868.858) (-870.115) (-871.116) -- 0:00:48
77000 -- (-868.350) [-868.459] (-869.354) (-870.653) * [-868.937] (-870.047) (-872.118) (-871.434) -- 0:00:47
77500 -- [-871.172] (-868.249) (-872.379) (-868.938) * (-868.634) (-874.110) [-870.108] (-869.999) -- 0:00:47
78000 -- (-868.250) (-868.041) (-868.153) [-868.454] * [-870.260] (-870.732) (-869.470) (-870.967) -- 0:00:47
78500 -- (-871.558) [-868.614] (-869.119) (-869.584) * (-870.745) (-871.125) [-870.028] (-872.535) -- 0:00:46
79000 -- [-869.337] (-868.067) (-868.333) (-869.667) * [-870.049] (-876.713) (-869.101) (-869.755) -- 0:00:58
79500 -- (-869.686) (-868.096) [-868.194] (-873.200) * (-869.859) [-869.896] (-868.265) (-872.649) -- 0:00:57
80000 -- (-871.158) (-868.521) [-868.128] (-869.187) * (-869.399) [-870.834] (-869.013) (-873.999) -- 0:00:57
Average standard deviation of split frequencies: 0.017856
80500 -- (-871.582) (-870.054) (-868.888) [-872.839] * [-869.162] (-872.004) (-869.781) (-870.024) -- 0:00:57
81000 -- [-869.217] (-869.003) (-868.842) (-868.936) * [-869.368] (-871.519) (-869.333) (-870.191) -- 0:00:56
81500 -- (-868.338) (-870.925) (-868.282) [-868.357] * (-870.576) (-868.585) [-870.456] (-873.092) -- 0:00:56
82000 -- (-870.893) (-873.888) [-868.871] (-869.048) * [-870.628] (-868.309) (-870.067) (-873.222) -- 0:00:55
82500 -- (-869.090) (-869.406) [-869.409] (-873.724) * [-870.081] (-867.980) (-870.023) (-871.678) -- 0:00:55
83000 -- (-871.984) (-870.900) (-869.747) [-870.332] * [-868.881] (-869.495) (-868.591) (-870.025) -- 0:00:55
83500 -- (-870.736) (-872.589) [-868.948] (-869.246) * (-873.459) (-867.931) [-870.262] (-870.407) -- 0:00:54
84000 -- (-869.673) (-869.809) (-868.936) [-868.738] * (-874.952) (-870.757) (-869.818) [-871.673] -- 0:00:54
84500 -- (-871.248) (-871.388) [-869.578] (-871.709) * [-876.537] (-869.016) (-869.035) (-869.315) -- 0:00:54
85000 -- (-869.033) [-870.286] (-870.664) (-868.915) * (-877.949) (-869.538) [-867.956] (-869.544) -- 0:00:53
Average standard deviation of split frequencies: 0.015896
85500 -- (-870.147) [-870.661] (-870.705) (-872.936) * (-871.860) [-868.734] (-871.116) (-868.271) -- 0:00:53
86000 -- (-870.930) (-869.191) (-870.938) [-868.551] * (-870.618) [-870.652] (-870.159) (-868.290) -- 0:00:53
86500 -- (-871.060) [-869.775] (-868.000) (-874.045) * (-871.902) (-873.886) [-873.794] (-872.506) -- 0:00:52
87000 -- [-869.809] (-869.264) (-867.951) (-873.764) * (-871.401) (-868.884) [-868.557] (-871.486) -- 0:00:52
87500 -- (-869.225) (-870.653) (-873.528) [-869.729] * (-871.511) (-868.820) [-870.235] (-871.123) -- 0:00:52
88000 -- [-868.867] (-869.499) (-869.490) (-869.246) * (-871.737) [-870.384] (-871.311) (-870.153) -- 0:00:51
88500 -- (-870.907) (-870.804) [-868.116] (-869.452) * [-868.756] (-871.099) (-871.670) (-868.795) -- 0:00:51
89000 -- (-868.654) (-869.621) [-869.533] (-868.189) * (-875.434) [-869.352] (-868.721) (-870.125) -- 0:00:51
89500 -- (-869.311) (-870.127) [-871.589] (-868.521) * (-869.039) [-871.493] (-867.931) (-868.474) -- 0:00:50
90000 -- (-872.351) (-870.139) (-868.402) [-868.280] * [-869.519] (-869.709) (-869.825) (-869.890) -- 0:00:50
Average standard deviation of split frequencies: 0.015051
90500 -- (-873.715) (-871.229) (-869.488) [-869.532] * (-868.105) (-869.841) [-868.133] (-870.777) -- 0:00:50
91000 -- (-874.566) (-872.257) [-870.053] (-869.206) * (-868.850) (-869.496) [-868.235] (-870.162) -- 0:00:49
91500 -- (-870.435) (-870.662) [-868.187] (-868.210) * (-871.133) (-872.558) [-868.342] (-874.949) -- 0:00:49
92000 -- (-868.201) (-869.828) (-870.641) [-871.155] * (-871.045) (-870.327) [-868.280] (-869.810) -- 0:00:49
92500 -- (-871.221) (-872.834) [-870.024] (-870.014) * (-870.686) (-868.655) [-868.498] (-874.445) -- 0:00:49
93000 -- (-869.258) [-869.600] (-869.678) (-869.269) * (-869.871) (-869.563) [-871.936] (-871.754) -- 0:00:48
93500 -- (-868.695) (-871.725) (-868.148) [-869.359] * (-871.835) (-876.159) (-869.485) [-872.518] -- 0:00:48
94000 -- [-867.868] (-869.073) (-869.346) (-868.725) * (-870.427) [-870.575] (-869.141) (-870.892) -- 0:00:48
94500 -- (-867.797) (-869.766) [-868.351] (-869.920) * (-869.872) [-869.742] (-870.716) (-871.656) -- 0:00:47
95000 -- [-868.446] (-873.327) (-868.133) (-874.266) * (-870.018) (-872.727) (-870.432) [-872.198] -- 0:00:47
Average standard deviation of split frequencies: 0.015959
95500 -- [-868.449] (-873.367) (-869.044) (-873.544) * (-870.116) [-872.624] (-869.676) (-872.724) -- 0:00:47
96000 -- (-869.007) (-871.817) (-868.740) [-867.933] * (-870.338) [-869.782] (-868.877) (-871.291) -- 0:00:56
96500 -- (-869.235) (-868.704) [-868.408] (-869.577) * [-868.608] (-870.132) (-868.602) (-870.361) -- 0:00:56
97000 -- (-871.170) [-868.631] (-872.249) (-875.766) * (-869.040) (-868.969) [-867.871] (-871.614) -- 0:00:55
97500 -- (-869.350) (-868.724) (-871.242) [-873.085] * (-869.732) [-869.331] (-868.727) (-870.469) -- 0:00:55
98000 -- [-872.372] (-868.529) (-873.410) (-875.667) * (-871.881) [-868.453] (-871.173) (-869.668) -- 0:00:55
98500 -- (-870.387) (-869.316) [-871.846] (-876.010) * (-869.199) (-870.311) (-871.656) [-873.477] -- 0:00:54
99000 -- (-868.942) [-869.229] (-870.689) (-877.431) * (-869.273) [-870.018] (-869.234) (-868.808) -- 0:00:54
99500 -- [-871.570] (-870.681) (-870.123) (-875.119) * (-870.102) (-872.739) [-868.646] (-869.804) -- 0:00:54
100000 -- [-872.794] (-868.911) (-870.064) (-875.143) * (-869.978) (-869.995) [-867.917] (-870.328) -- 0:00:54
Average standard deviation of split frequencies: 0.016910
100500 -- (-871.265) (-870.290) (-869.220) [-872.268] * (-871.760) (-871.363) (-869.013) [-868.970] -- 0:00:53
101000 -- (-876.486) [-869.390] (-870.586) (-870.680) * (-869.420) [-870.425] (-869.829) (-869.313) -- 0:00:53
101500 -- (-873.882) [-869.235] (-870.009) (-874.914) * (-867.782) (-870.419) [-868.512] (-871.251) -- 0:00:53
102000 -- (-876.512) [-873.116] (-872.115) (-869.508) * [-868.149] (-868.946) (-868.672) (-875.081) -- 0:00:52
102500 -- (-876.030) [-870.453] (-868.144) (-871.659) * (-870.584) (-870.811) (-870.394) [-870.999] -- 0:00:52
103000 -- (-877.517) [-868.766] (-871.546) (-869.640) * (-877.483) (-871.610) [-868.608] (-868.145) -- 0:00:52
103500 -- (-875.029) (-870.364) [-871.194] (-870.790) * (-873.074) (-871.963) [-868.767] (-870.723) -- 0:00:51
104000 -- (-873.475) [-868.411] (-870.290) (-869.407) * (-872.168) (-871.926) [-870.067] (-871.774) -- 0:00:51
104500 -- (-868.986) [-870.100] (-874.328) (-870.636) * (-869.445) [-868.698] (-871.777) (-870.895) -- 0:00:51
105000 -- (-871.307) [-870.877] (-869.340) (-869.191) * [-871.416] (-868.681) (-869.022) (-868.224) -- 0:00:51
Average standard deviation of split frequencies: 0.016059
105500 -- (-870.034) (-871.479) (-869.090) [-871.387] * (-870.546) (-871.676) [-869.023] (-868.966) -- 0:00:50
106000 -- (-869.870) (-872.469) (-869.529) [-870.031] * (-868.694) (-872.631) (-873.123) [-869.111] -- 0:00:50
106500 -- (-868.479) (-876.434) (-869.440) [-871.501] * (-869.793) (-871.693) (-869.549) [-868.523] -- 0:00:50
107000 -- (-869.579) [-870.701] (-871.027) (-869.181) * (-869.420) (-874.716) [-868.834] (-869.657) -- 0:00:50
107500 -- [-869.601] (-872.913) (-867.943) (-871.414) * (-868.749) (-874.254) (-869.837) [-869.328] -- 0:00:49
108000 -- (-871.886) (-870.610) [-867.984] (-871.436) * (-869.408) [-871.352] (-868.779) (-868.038) -- 0:00:49
108500 -- [-871.594] (-868.036) (-870.301) (-873.145) * (-868.959) (-874.492) [-868.757] (-870.694) -- 0:00:49
109000 -- (-869.212) [-869.535] (-869.689) (-871.514) * [-868.802] (-872.390) (-868.781) (-873.452) -- 0:00:49
109500 -- (-869.571) (-868.511) (-870.007) [-870.049] * (-870.623) [-869.394] (-869.652) (-871.945) -- 0:00:48
110000 -- (-872.591) (-869.433) (-871.601) [-871.195] * [-871.647] (-869.538) (-869.917) (-869.107) -- 0:00:48
Average standard deviation of split frequencies: 0.019642
110500 -- (-871.400) [-869.582] (-874.197) (-868.943) * (-868.879) (-871.224) (-874.909) [-869.600] -- 0:00:48
111000 -- (-870.163) (-875.683) [-870.664] (-869.380) * (-868.389) [-871.493] (-870.175) (-869.816) -- 0:00:48
111500 -- (-869.114) (-868.093) [-870.901] (-870.415) * (-869.518) (-871.659) [-870.565] (-869.824) -- 0:00:47
112000 -- [-868.700] (-867.918) (-868.913) (-870.239) * [-870.335] (-868.572) (-871.542) (-869.133) -- 0:00:55
112500 -- (-871.306) [-868.681] (-869.959) (-869.741) * (-870.113) (-868.803) (-871.245) [-869.541] -- 0:00:55
113000 -- [-869.803] (-868.712) (-868.347) (-868.125) * (-868.376) [-868.082] (-870.605) (-873.565) -- 0:00:54
113500 -- (-870.180) [-868.447] (-869.237) (-867.998) * [-869.998] (-869.201) (-873.829) (-870.452) -- 0:00:54
114000 -- (-870.865) (-870.024) (-869.929) [-868.735] * [-873.893] (-870.052) (-872.551) (-869.988) -- 0:00:54
114500 -- (-871.745) [-871.324] (-869.933) (-868.243) * [-868.536] (-872.021) (-868.815) (-869.353) -- 0:00:54
115000 -- (-869.127) (-868.599) [-871.493] (-868.695) * (-869.213) [-869.506] (-872.130) (-869.225) -- 0:00:53
Average standard deviation of split frequencies: 0.016030
115500 -- (-874.096) (-868.224) [-869.495] (-869.655) * (-871.919) [-871.295] (-869.994) (-870.178) -- 0:00:53
116000 -- (-871.107) [-869.602] (-869.489) (-877.799) * (-874.665) (-871.110) (-868.799) [-868.850] -- 0:00:53
116500 -- (-867.800) [-869.737] (-868.927) (-872.238) * [-872.300] (-870.754) (-869.030) (-868.567) -- 0:00:53
117000 -- (-867.838) [-869.543] (-869.360) (-872.366) * [-871.511] (-869.611) (-871.057) (-868.588) -- 0:00:52
117500 -- (-868.290) (-868.280) [-870.154] (-869.551) * (-870.009) (-871.311) [-872.615] (-869.277) -- 0:00:52
118000 -- [-870.074] (-870.329) (-869.949) (-869.608) * (-874.450) [-870.812] (-873.609) (-869.360) -- 0:00:52
118500 -- [-869.351] (-871.889) (-871.018) (-870.223) * (-870.968) [-871.295] (-873.869) (-868.119) -- 0:00:52
119000 -- (-869.986) (-871.272) [-870.197] (-874.772) * (-872.679) (-869.006) (-871.456) [-869.407] -- 0:00:51
119500 -- (-869.561) (-873.438) (-872.192) [-871.599] * (-869.131) (-868.747) (-870.229) [-867.884] -- 0:00:51
120000 -- [-872.009] (-869.166) (-875.687) (-871.297) * (-869.214) [-868.777] (-868.730) (-870.802) -- 0:00:51
Average standard deviation of split frequencies: 0.017066
120500 -- [-869.285] (-869.304) (-870.560) (-870.812) * [-869.948] (-868.945) (-869.452) (-872.085) -- 0:00:51
121000 -- (-868.993) (-869.000) (-870.120) [-872.540] * [-869.164] (-871.015) (-869.756) (-869.401) -- 0:00:50
121500 -- (-868.459) (-868.690) (-872.525) [-870.657] * [-868.788] (-870.616) (-870.850) (-869.944) -- 0:00:50
122000 -- (-870.732) [-868.312] (-870.679) (-871.297) * [-870.461] (-872.154) (-871.703) (-871.671) -- 0:00:50
122500 -- [-871.051] (-868.893) (-873.519) (-869.273) * [-868.988] (-869.341) (-870.654) (-870.644) -- 0:00:50
123000 -- (-869.552) (-868.272) (-868.199) [-869.457] * (-869.219) (-869.144) (-872.818) [-870.800] -- 0:00:49
123500 -- (-868.534) [-868.549] (-868.788) (-869.971) * [-869.614] (-869.622) (-867.939) (-869.366) -- 0:00:49
124000 -- (-871.096) (-869.832) [-870.074] (-869.351) * [-870.874] (-868.343) (-870.141) (-869.352) -- 0:00:49
124500 -- (-874.118) (-870.491) (-870.697) [-869.351] * (-872.097) (-870.856) (-872.888) [-868.206] -- 0:00:49
125000 -- (-868.825) [-870.677] (-869.630) (-868.634) * (-870.009) (-869.751) [-872.629] (-868.186) -- 0:00:49
Average standard deviation of split frequencies: 0.014965
125500 -- (-870.348) [-869.897] (-869.958) (-871.694) * [-869.364] (-868.417) (-870.849) (-870.147) -- 0:00:48
126000 -- (-871.277) (-871.869) (-869.424) [-869.850] * (-870.733) (-868.417) [-869.956] (-870.919) -- 0:00:48
126500 -- (-873.855) (-874.425) (-870.522) [-868.857] * (-870.799) (-868.480) [-871.274] (-870.736) -- 0:00:48
127000 -- (-872.710) (-880.629) (-871.085) [-869.718] * (-870.054) (-868.898) (-870.502) [-869.475] -- 0:00:48
127500 -- [-870.081] (-879.033) (-870.943) (-869.621) * (-870.097) [-870.681] (-869.459) (-870.858) -- 0:00:47
128000 -- [-868.449] (-879.489) (-869.673) (-870.412) * (-870.761) (-870.527) [-868.952] (-870.436) -- 0:00:47
128500 -- [-868.762] (-872.161) (-872.104) (-871.489) * (-871.862) [-870.165] (-868.885) (-868.577) -- 0:00:47
129000 -- (-868.813) [-869.918] (-868.764) (-872.386) * (-870.943) [-869.111] (-869.618) (-870.693) -- 0:00:54
129500 -- (-869.702) [-872.067] (-869.082) (-870.982) * (-871.871) (-871.585) [-868.568] (-870.169) -- 0:00:53
130000 -- [-872.712] (-870.379) (-869.034) (-873.553) * (-871.824) (-869.113) (-868.568) [-869.341] -- 0:00:53
Average standard deviation of split frequencies: 0.011424
130500 -- (-869.571) (-871.364) [-869.750] (-870.836) * (-873.734) (-871.346) [-870.399] (-869.803) -- 0:00:53
131000 -- (-869.496) (-869.776) [-871.402] (-870.125) * (-868.933) [-873.540] (-868.359) (-872.733) -- 0:00:53
131500 -- [-869.260] (-871.108) (-869.664) (-869.466) * (-868.837) (-869.848) (-868.381) [-870.518] -- 0:00:52
132000 -- (-868.028) (-870.478) (-869.112) [-868.723] * (-872.857) [-869.698] (-869.724) (-869.772) -- 0:00:52
132500 -- [-872.405] (-872.109) (-869.397) (-869.326) * (-872.012) (-870.752) (-868.310) [-870.170] -- 0:00:52
133000 -- (-868.575) [-869.802] (-869.584) (-869.599) * (-870.673) (-870.969) [-869.401] (-871.230) -- 0:00:52
133500 -- [-869.416] (-869.502) (-868.416) (-871.235) * (-870.037) (-870.550) (-869.139) [-872.778] -- 0:00:51
134000 -- [-868.268] (-868.360) (-870.150) (-870.447) * (-868.316) (-869.669) [-868.446] (-869.825) -- 0:00:51
134500 -- [-870.941] (-868.316) (-871.020) (-869.267) * (-869.554) (-875.040) [-868.179] (-869.379) -- 0:00:51
135000 -- (-870.243) [-871.050] (-870.811) (-868.281) * (-868.449) [-868.500] (-870.146) (-868.876) -- 0:00:51
Average standard deviation of split frequencies: 0.011554
135500 -- [-871.293] (-870.603) (-872.750) (-867.898) * (-868.590) (-868.866) [-868.321] (-870.174) -- 0:00:51
136000 -- (-873.735) (-869.305) (-868.851) [-868.159] * (-868.977) (-876.397) [-870.022] (-872.802) -- 0:00:50
136500 -- (-871.834) [-868.285] (-868.167) (-868.644) * (-873.490) (-871.349) [-871.851] (-871.152) -- 0:00:50
137000 -- [-869.900] (-868.648) (-868.221) (-869.179) * (-871.048) [-869.497] (-878.785) (-868.503) -- 0:00:50
137500 -- (-870.210) (-870.099) [-870.106] (-869.582) * (-875.655) (-868.736) (-869.613) [-869.232] -- 0:00:50
138000 -- (-871.962) (-869.260) (-869.672) [-872.150] * [-870.488] (-868.401) (-873.692) (-868.210) -- 0:00:49
138500 -- (-870.509) (-869.168) (-871.695) [-875.492] * (-870.004) (-870.536) [-873.619] (-877.366) -- 0:00:49
139000 -- (-870.890) (-871.814) (-868.366) [-871.472] * (-870.105) (-869.154) [-871.431] (-876.861) -- 0:00:49
139500 -- (-871.178) [-869.683] (-871.502) (-871.599) * (-869.742) (-869.186) (-871.023) [-871.172] -- 0:00:49
140000 -- (-869.692) [-871.609] (-870.862) (-874.292) * (-870.503) (-870.844) [-868.335] (-871.108) -- 0:00:49
Average standard deviation of split frequencies: 0.009172
140500 -- (-871.400) (-869.380) (-871.233) [-869.238] * (-869.093) (-869.197) [-868.664] (-870.016) -- 0:00:48
141000 -- (-872.594) (-868.774) (-868.659) [-868.977] * [-870.299] (-876.836) (-869.787) (-869.428) -- 0:00:48
141500 -- [-870.005] (-869.009) (-869.259) (-872.098) * (-870.604) [-868.832] (-869.110) (-868.599) -- 0:00:48
142000 -- (-868.379) (-871.319) (-881.346) [-870.979] * (-870.704) (-868.505) [-869.617] (-871.099) -- 0:00:48
142500 -- [-868.393] (-870.457) (-873.999) (-869.694) * [-870.103] (-872.722) (-868.305) (-870.818) -- 0:00:48
143000 -- [-868.072] (-871.790) (-873.587) (-869.753) * (-871.155) [-873.112] (-869.109) (-869.387) -- 0:00:47
143500 -- (-868.697) (-872.314) (-870.765) [-869.465] * (-870.349) (-869.248) [-869.481] (-868.483) -- 0:00:47
144000 -- [-868.068] (-871.894) (-870.208) (-868.994) * [-869.493] (-874.056) (-869.190) (-869.874) -- 0:00:47
144500 -- (-868.056) (-870.437) (-870.682) [-872.716] * (-870.495) (-872.071) (-870.050) [-871.046] -- 0:00:47
145000 -- (-869.486) (-869.224) [-868.813] (-875.080) * (-872.627) (-870.681) (-868.751) [-870.578] -- 0:00:47
Average standard deviation of split frequencies: 0.008497
145500 -- (-869.460) [-868.153] (-868.982) (-870.845) * (-873.217) (-868.991) (-869.731) [-869.053] -- 0:00:52
146000 -- (-869.428) (-868.455) (-869.933) [-869.592] * (-873.884) (-868.379) (-876.468) [-869.116] -- 0:00:52
146500 -- (-870.916) [-869.529] (-870.289) (-868.615) * (-873.741) [-869.168] (-874.497) (-872.877) -- 0:00:52
147000 -- (-868.534) [-868.449] (-870.781) (-868.522) * (-869.290) (-868.984) [-874.684] (-869.257) -- 0:00:52
147500 -- (-870.523) (-868.965) (-870.511) [-871.338] * [-871.248] (-868.166) (-873.309) (-874.167) -- 0:00:52
148000 -- (-874.387) (-870.291) [-869.881] (-868.753) * (-870.641) [-868.735] (-869.991) (-874.691) -- 0:00:51
148500 -- (-870.547) (-870.161) [-868.249] (-868.872) * [-867.932] (-869.033) (-868.295) (-868.396) -- 0:00:51
149000 -- (-869.748) [-868.826] (-870.922) (-873.419) * (-868.363) (-869.543) (-868.310) [-870.074] -- 0:00:51
149500 -- (-872.221) [-870.054] (-874.437) (-868.971) * (-868.866) [-870.167] (-867.881) (-870.074) -- 0:00:51
150000 -- [-869.241] (-869.513) (-872.805) (-871.154) * (-871.426) (-870.559) (-874.545) [-868.034] -- 0:00:51
Average standard deviation of split frequencies: 0.010539
150500 -- [-871.113] (-870.539) (-873.214) (-873.601) * (-878.756) (-871.350) (-872.340) [-870.206] -- 0:00:50
151000 -- (-868.722) [-870.559] (-870.377) (-871.055) * (-869.171) (-870.281) (-872.759) [-870.153] -- 0:00:50
151500 -- [-872.761] (-871.576) (-871.214) (-869.714) * (-869.095) (-868.334) (-870.853) [-870.047] -- 0:00:50
152000 -- (-872.175) (-872.621) [-869.631] (-867.988) * (-870.480) (-868.387) (-870.719) [-873.295] -- 0:00:50
152500 -- (-869.886) (-870.257) (-871.262) [-867.967] * (-868.952) [-870.135] (-869.688) (-870.633) -- 0:00:50
153000 -- (-869.987) [-869.290] (-869.025) (-869.070) * [-870.445] (-869.206) (-869.519) (-869.969) -- 0:00:49
153500 -- (-870.118) [-869.372] (-872.710) (-869.628) * (-868.377) (-869.507) (-867.959) [-870.045] -- 0:00:49
154000 -- (-869.785) (-874.580) (-875.703) [-867.901] * (-868.372) (-869.378) (-869.507) [-869.436] -- 0:00:49
154500 -- (-871.869) (-869.949) (-870.506) [-868.594] * (-870.418) (-871.505) [-871.764] (-871.613) -- 0:00:49
155000 -- (-871.014) (-870.947) [-868.901] (-869.743) * (-868.759) (-868.838) (-869.611) [-872.093] -- 0:00:49
Average standard deviation of split frequencies: 0.012423
155500 -- [-870.884] (-868.397) (-870.110) (-874.887) * (-874.192) [-869.210] (-869.039) (-873.144) -- 0:00:48
156000 -- [-868.747] (-870.741) (-869.180) (-874.862) * (-873.180) [-869.655] (-871.191) (-870.741) -- 0:00:48
156500 -- [-872.280] (-871.230) (-869.851) (-872.994) * (-872.746) (-869.154) (-869.599) [-872.642] -- 0:00:48
157000 -- (-870.562) [-869.618] (-868.307) (-869.282) * (-874.326) [-871.479] (-871.559) (-868.106) -- 0:00:48
157500 -- (-870.585) (-868.216) [-868.666] (-871.132) * (-871.060) (-868.544) (-871.761) [-871.116] -- 0:00:48
158000 -- (-872.128) (-872.362) (-868.095) [-870.415] * [-872.236] (-869.498) (-871.944) (-872.019) -- 0:00:47
158500 -- (-870.330) [-870.264] (-868.005) (-870.132) * (-869.431) [-874.001] (-871.617) (-871.236) -- 0:00:47
159000 -- [-869.977] (-869.872) (-868.579) (-869.239) * (-870.966) (-869.933) (-869.521) [-869.965] -- 0:00:47
159500 -- (-872.546) [-868.811] (-869.320) (-869.362) * (-869.771) [-868.226] (-870.791) (-873.535) -- 0:00:47
160000 -- (-868.808) (-868.766) (-869.159) [-870.922] * (-870.780) [-871.194] (-872.532) (-870.018) -- 0:00:47
Average standard deviation of split frequencies: 0.013203
160500 -- [-870.444] (-872.096) (-869.887) (-869.392) * (-871.308) [-871.008] (-871.958) (-869.443) -- 0:00:47
161000 -- (-869.429) [-868.677] (-868.634) (-868.812) * (-869.909) (-874.113) (-868.546) [-871.791] -- 0:00:46
161500 -- [-873.157] (-868.278) (-869.266) (-869.258) * [-869.770] (-870.616) (-869.820) (-868.853) -- 0:00:46
162000 -- (-871.252) (-870.511) [-869.837] (-868.093) * (-869.236) [-869.026] (-870.420) (-870.050) -- 0:00:46
162500 -- (-869.555) [-868.624] (-869.102) (-868.279) * (-868.931) [-870.169] (-871.736) (-869.534) -- 0:00:51
163000 -- (-868.271) [-868.444] (-871.808) (-868.646) * (-870.984) [-871.186] (-873.083) (-868.964) -- 0:00:51
163500 -- [-875.745] (-868.803) (-873.718) (-870.420) * (-870.088) (-869.046) (-872.680) [-873.715] -- 0:00:51
164000 -- [-872.840] (-870.457) (-872.395) (-871.146) * (-869.302) (-871.703) [-869.431] (-871.255) -- 0:00:50
164500 -- [-871.203] (-869.070) (-869.783) (-868.911) * (-868.508) [-872.243] (-870.372) (-870.784) -- 0:00:50
165000 -- (-869.427) (-875.739) [-869.884] (-870.156) * (-870.824) (-869.257) (-868.786) [-871.850] -- 0:00:50
Average standard deviation of split frequencies: 0.013063
165500 -- [-872.275] (-870.810) (-868.900) (-870.688) * (-869.641) [-871.037] (-869.663) (-871.884) -- 0:00:50
166000 -- (-870.888) (-871.872) (-869.992) [-870.577] * (-869.813) (-871.779) [-869.067] (-871.285) -- 0:00:50
166500 -- (-870.074) (-870.669) [-868.957] (-868.745) * [-875.385] (-872.991) (-868.885) (-872.297) -- 0:00:50
167000 -- (-872.025) (-869.767) [-873.077] (-869.906) * (-872.400) [-871.646] (-870.895) (-871.836) -- 0:00:49
167500 -- (-874.657) [-870.133] (-869.877) (-871.617) * (-872.638) (-869.536) [-873.961] (-871.319) -- 0:00:49
168000 -- (-873.718) (-869.098) (-868.657) [-869.525] * (-878.027) [-873.325] (-869.791) (-871.151) -- 0:00:49
168500 -- (-871.519) (-870.248) [-869.023] (-870.487) * [-873.285] (-872.056) (-869.117) (-868.668) -- 0:00:49
169000 -- (-872.490) (-872.453) (-871.238) [-868.561] * (-871.490) [-872.596] (-871.153) (-868.147) -- 0:00:49
169500 -- (-870.240) (-870.801) [-870.547] (-868.492) * (-871.260) (-872.268) [-871.351] (-869.725) -- 0:00:48
170000 -- [-869.463] (-872.920) (-870.444) (-868.394) * (-873.086) [-869.219] (-871.640) (-869.119) -- 0:00:48
Average standard deviation of split frequencies: 0.013396
170500 -- [-871.465] (-868.950) (-871.668) (-870.740) * (-867.878) [-870.395] (-871.500) (-868.356) -- 0:00:48
171000 -- (-872.158) (-870.362) (-871.392) [-874.308] * (-870.357) (-871.542) (-871.638) [-868.091] -- 0:00:48
171500 -- [-873.667] (-872.436) (-870.933) (-870.095) * [-869.199] (-869.033) (-871.356) (-868.657) -- 0:00:48
172000 -- (-869.329) (-868.883) (-868.653) [-869.105] * (-872.658) [-869.338] (-872.072) (-868.839) -- 0:00:48
172500 -- (-869.641) [-868.449] (-872.296) (-870.034) * (-870.139) (-871.241) [-870.533] (-870.342) -- 0:00:47
173000 -- (-870.956) (-868.284) [-870.784] (-871.173) * (-869.136) (-869.560) [-870.612] (-868.787) -- 0:00:47
173500 -- (-871.021) [-872.290] (-870.442) (-868.949) * (-870.177) (-870.193) (-869.061) [-869.622] -- 0:00:47
174000 -- (-870.584) (-869.053) [-868.774] (-868.861) * (-868.598) [-869.387] (-870.485) (-868.436) -- 0:00:47
174500 -- (-871.578) (-873.300) (-871.369) [-869.676] * [-868.526] (-870.745) (-870.139) (-868.704) -- 0:00:47
175000 -- [-868.718] (-870.266) (-870.322) (-872.511) * (-870.743) (-869.198) [-870.014] (-869.384) -- 0:00:47
Average standard deviation of split frequencies: 0.014583
175500 -- (-869.828) [-870.156] (-871.546) (-868.795) * (-870.343) [-871.522] (-874.108) (-870.053) -- 0:00:46
176000 -- (-870.119) [-871.430] (-873.576) (-869.757) * [-869.200] (-872.158) (-871.103) (-871.382) -- 0:00:46
176500 -- (-871.614) (-870.423) [-869.591] (-869.281) * (-873.069) (-870.602) (-870.514) [-869.070] -- 0:00:46
177000 -- (-871.081) [-873.745] (-870.024) (-871.319) * (-872.490) (-868.849) (-871.486) [-868.849] -- 0:00:46
177500 -- (-871.392) (-874.039) (-871.005) [-868.419] * [-873.325] (-869.576) (-872.886) (-869.583) -- 0:00:46
178000 -- (-870.627) [-869.897] (-869.087) (-871.545) * [-868.884] (-869.836) (-873.203) (-870.017) -- 0:00:46
178500 -- [-871.860] (-868.504) (-872.205) (-874.580) * (-869.300) (-870.934) [-872.550] (-870.056) -- 0:00:46
179000 -- (-871.564) (-868.250) [-869.570] (-871.143) * (-873.852) (-868.769) [-869.526] (-869.777) -- 0:00:50
179500 -- [-871.693] (-868.888) (-868.531) (-871.605) * (-871.118) (-877.226) [-871.749] (-870.421) -- 0:00:50
180000 -- (-871.507) (-869.004) [-868.573] (-868.446) * (-870.239) [-871.393] (-869.144) (-870.441) -- 0:00:50
Average standard deviation of split frequencies: 0.013191
180500 -- (-870.126) [-874.918] (-870.223) (-867.916) * (-870.438) (-869.856) [-869.144] (-873.952) -- 0:00:49
181000 -- (-868.500) (-871.176) [-868.565] (-868.511) * [-870.480] (-873.286) (-868.457) (-869.840) -- 0:00:49
181500 -- (-870.694) [-870.900] (-868.386) (-875.457) * (-873.890) (-870.347) [-868.252] (-868.469) -- 0:00:49
182000 -- (-872.910) (-873.385) [-870.490] (-870.292) * (-872.279) (-871.803) [-870.072] (-872.718) -- 0:00:49
182500 -- (-871.720) [-869.333] (-870.533) (-868.437) * (-871.343) (-870.684) (-871.480) [-868.814] -- 0:00:49
183000 -- (-871.653) (-871.339) (-873.491) [-868.624] * [-874.105] (-869.786) (-869.659) (-868.650) -- 0:00:49
183500 -- (-872.175) [-870.219] (-868.653) (-870.042) * (-872.936) (-868.252) (-868.150) [-868.545] -- 0:00:48
184000 -- (-869.997) (-869.432) (-870.511) [-868.861] * [-870.963] (-870.485) (-872.178) (-868.010) -- 0:00:48
184500 -- (-868.623) [-868.711] (-882.026) (-869.307) * (-870.892) [-869.901] (-869.362) (-870.085) -- 0:00:48
185000 -- (-872.660) [-868.903] (-868.710) (-869.200) * (-871.857) (-869.104) (-868.547) [-868.513] -- 0:00:48
Average standard deviation of split frequencies: 0.013072
185500 -- (-875.749) [-868.938] (-870.052) (-871.103) * (-869.022) (-871.247) (-870.831) [-868.187] -- 0:00:48
186000 -- (-869.664) [-868.941] (-870.090) (-869.041) * (-873.954) (-870.676) [-868.619] (-868.265) -- 0:00:48
186500 -- [-870.276] (-868.793) (-869.318) (-874.311) * (-874.071) (-870.217) [-870.682] (-873.897) -- 0:00:47
187000 -- (-869.001) [-869.184] (-876.711) (-868.280) * (-874.161) [-868.950] (-871.532) (-871.745) -- 0:00:47
187500 -- (-868.645) (-873.188) [-868.476] (-868.635) * (-873.448) [-867.941] (-875.409) (-873.367) -- 0:00:47
188000 -- (-872.536) (-875.658) [-871.016] (-869.151) * [-868.398] (-867.870) (-869.279) (-871.693) -- 0:00:47
188500 -- (-870.354) [-870.308] (-868.433) (-870.729) * (-869.336) [-869.742] (-871.133) (-869.939) -- 0:00:47
189000 -- [-867.974] (-870.542) (-873.665) (-872.747) * (-868.417) [-871.611] (-868.376) (-868.900) -- 0:00:47
189500 -- (-869.138) (-870.808) (-870.596) [-871.433] * (-872.327) (-873.833) (-869.880) [-870.994] -- 0:00:47
190000 -- [-872.885] (-869.651) (-869.516) (-869.418) * [-873.283] (-871.699) (-868.846) (-868.291) -- 0:00:46
Average standard deviation of split frequencies: 0.014054
190500 -- (-869.438) (-868.045) (-871.464) [-868.565] * (-873.997) [-868.800] (-867.898) (-871.200) -- 0:00:46
191000 -- [-870.348] (-868.324) (-869.654) (-869.420) * (-871.585) (-870.029) (-874.934) [-870.219] -- 0:00:46
191500 -- [-868.402] (-870.699) (-869.429) (-868.092) * (-871.400) (-868.701) (-870.755) [-870.669] -- 0:00:46
192000 -- (-870.233) [-868.950] (-869.043) (-869.654) * (-869.519) (-873.708) (-873.116) [-870.933] -- 0:00:46
192500 -- (-873.439) [-869.615] (-870.498) (-868.334) * [-869.024] (-872.583) (-869.814) (-869.546) -- 0:00:46
193000 -- (-869.139) [-868.602] (-870.063) (-871.270) * [-869.684] (-870.868) (-868.647) (-870.245) -- 0:00:45
193500 -- (-868.155) [-869.148] (-870.535) (-870.298) * (-868.748) (-870.205) (-868.369) [-870.208] -- 0:00:45
194000 -- (-868.847) (-868.309) (-871.661) [-871.743] * (-869.252) [-868.722] (-871.215) (-869.445) -- 0:00:45
194500 -- (-870.730) (-871.999) (-871.281) [-869.872] * (-870.102) (-869.177) [-868.181] (-869.917) -- 0:00:45
195000 -- [-868.221] (-871.813) (-869.843) (-870.012) * (-871.468) [-869.394] (-874.273) (-869.721) -- 0:00:45
Average standard deviation of split frequencies: 0.013418
195500 -- (-868.729) (-871.881) (-869.064) [-868.747] * [-869.035] (-868.553) (-875.249) (-870.104) -- 0:00:49
196000 -- (-869.177) (-869.061) (-870.187) [-870.316] * [-870.097] (-869.684) (-867.944) (-869.245) -- 0:00:49
196500 -- [-867.850] (-871.651) (-871.954) (-869.478) * (-869.340) (-871.127) (-868.411) [-870.009] -- 0:00:49
197000 -- [-870.432] (-874.229) (-868.831) (-869.725) * (-868.651) (-870.289) (-868.494) [-869.620] -- 0:00:48
197500 -- [-868.717] (-873.352) (-868.664) (-872.274) * [-870.063] (-871.500) (-870.304) (-870.307) -- 0:00:48
198000 -- (-869.114) (-870.708) (-868.662) [-869.344] * (-869.878) (-869.218) [-870.752] (-870.773) -- 0:00:48
198500 -- (-869.050) (-869.851) [-870.921] (-869.152) * (-870.246) (-871.212) (-868.776) [-870.608] -- 0:00:48
199000 -- [-869.011] (-868.731) (-871.109) (-869.399) * (-869.446) [-871.737] (-869.592) (-873.437) -- 0:00:48
199500 -- (-869.156) (-868.914) [-868.749] (-872.402) * (-871.979) [-870.725] (-875.003) (-872.309) -- 0:00:48
200000 -- (-868.617) [-869.134] (-868.534) (-870.665) * (-868.107) [-868.620] (-869.648) (-873.316) -- 0:00:48
Average standard deviation of split frequencies: 0.013601
200500 -- (-868.834) (-868.744) [-872.034] (-872.603) * (-868.274) (-869.124) (-869.757) [-870.545] -- 0:00:47
201000 -- (-870.286) (-868.717) [-871.838] (-869.192) * (-871.855) [-869.916] (-868.974) (-868.830) -- 0:00:47
201500 -- (-869.411) (-868.297) (-868.825) [-871.230] * (-874.490) (-871.057) [-868.160] (-869.945) -- 0:00:47
202000 -- [-868.559] (-868.752) (-870.130) (-872.715) * [-868.932] (-869.165) (-868.310) (-870.235) -- 0:00:47
202500 -- (-871.433) (-868.871) (-868.690) [-868.847] * [-868.403] (-874.268) (-870.398) (-873.064) -- 0:00:47
203000 -- (-869.009) (-870.035) (-869.021) [-871.129] * (-869.270) (-872.521) [-870.480] (-871.791) -- 0:00:47
203500 -- (-869.805) [-868.825] (-868.479) (-872.472) * [-869.944] (-873.568) (-873.725) (-869.130) -- 0:00:46
204000 -- [-870.405] (-869.660) (-872.188) (-869.004) * (-871.051) (-873.028) [-870.924] (-869.521) -- 0:00:46
204500 -- (-871.258) (-869.002) (-869.354) [-869.561] * (-869.649) (-869.531) (-870.635) [-868.164] -- 0:00:46
205000 -- (-870.401) (-871.991) (-868.567) [-869.344] * (-868.703) (-868.776) [-869.724] (-869.355) -- 0:00:46
Average standard deviation of split frequencies: 0.014646
205500 -- (-871.343) (-870.660) [-868.284] (-873.570) * (-871.746) (-869.514) [-869.986] (-869.347) -- 0:00:46
206000 -- (-869.750) (-874.255) [-869.631] (-874.397) * (-873.320) (-869.208) (-869.391) [-868.860] -- 0:00:46
206500 -- (-868.783) (-870.232) (-872.444) [-872.314] * (-869.827) [-868.145] (-872.477) (-869.051) -- 0:00:46
207000 -- (-870.718) [-869.164] (-876.295) (-870.280) * (-869.050) (-868.417) [-869.140] (-869.203) -- 0:00:45
207500 -- (-870.986) (-869.179) (-870.197) [-870.044] * (-868.068) [-870.280] (-869.398) (-868.984) -- 0:00:45
208000 -- [-869.442] (-869.649) (-868.764) (-872.734) * (-876.332) (-870.909) [-869.139] (-870.686) -- 0:00:45
208500 -- (-869.080) (-871.783) [-868.745] (-869.279) * (-872.799) (-867.916) (-869.515) [-869.572] -- 0:00:45
209000 -- (-870.993) [-873.681] (-871.421) (-868.264) * (-868.729) (-868.706) [-868.533] (-868.701) -- 0:00:45
209500 -- (-868.731) (-870.129) [-870.259] (-871.854) * (-870.272) (-876.271) (-869.414) [-870.388] -- 0:00:45
210000 -- (-869.165) (-872.769) (-868.138) [-870.018] * (-869.573) (-876.805) [-871.087] (-868.017) -- 0:00:45
Average standard deviation of split frequencies: 0.013302
210500 -- [-869.323] (-870.219) (-868.449) (-868.551) * (-870.874) (-869.745) (-870.203) [-871.026] -- 0:00:45
211000 -- (-869.089) (-870.444) (-868.988) [-868.746] * (-873.767) [-870.652] (-872.202) (-870.496) -- 0:00:44
211500 -- (-869.889) [-868.173] (-869.939) (-870.744) * (-868.902) [-873.262] (-868.749) (-870.905) -- 0:00:44
212000 -- (-870.657) [-869.437] (-873.930) (-869.594) * (-868.398) (-872.195) (-868.888) [-872.873] -- 0:00:44
212500 -- [-873.735] (-869.403) (-869.135) (-868.567) * [-869.215] (-870.820) (-868.508) (-870.496) -- 0:00:48
213000 -- (-871.331) (-869.877) [-868.566] (-869.458) * [-872.677] (-869.751) (-870.682) (-869.449) -- 0:00:48
213500 -- (-870.618) [-869.928] (-870.115) (-868.707) * (-869.571) (-870.967) (-870.496) [-869.579] -- 0:00:47
214000 -- (-873.039) (-869.088) (-868.389) [-868.554] * (-869.675) (-873.465) [-872.801] (-869.246) -- 0:00:47
214500 -- [-869.929] (-874.387) (-870.438) (-868.415) * (-868.846) (-874.645) [-871.439] (-871.070) -- 0:00:47
215000 -- (-870.225) [-870.376] (-869.036) (-868.885) * (-868.575) [-872.756] (-877.556) (-875.288) -- 0:00:47
Average standard deviation of split frequencies: 0.013458
215500 -- (-869.885) (-873.986) (-869.036) [-869.106] * (-868.723) (-870.891) (-870.134) [-874.657] -- 0:00:47
216000 -- (-868.931) [-871.028] (-869.217) (-868.947) * (-869.716) [-870.882] (-869.973) (-870.812) -- 0:00:47
216500 -- [-869.041] (-869.892) (-868.792) (-871.194) * (-871.921) (-872.329) (-869.092) [-870.087] -- 0:00:47
217000 -- (-868.792) (-871.395) [-868.418] (-868.621) * (-872.099) (-870.517) (-868.909) [-869.550] -- 0:00:46
217500 -- (-869.559) (-870.055) [-870.354] (-870.590) * (-873.964) (-870.069) [-869.836] (-872.115) -- 0:00:46
218000 -- [-868.758] (-869.412) (-872.885) (-868.153) * [-869.865] (-868.923) (-871.234) (-871.249) -- 0:00:46
218500 -- (-870.225) [-869.319] (-871.312) (-870.710) * [-867.869] (-872.992) (-868.423) (-871.460) -- 0:00:46
219000 -- [-868.800] (-868.183) (-870.051) (-871.699) * (-869.765) (-871.446) [-869.024] (-874.915) -- 0:00:46
219500 -- (-868.711) [-867.951] (-873.526) (-868.947) * (-873.677) (-871.330) [-869.500] (-871.573) -- 0:00:46
220000 -- [-869.374] (-870.254) (-870.140) (-870.827) * (-876.127) [-871.674] (-868.664) (-870.701) -- 0:00:46
Average standard deviation of split frequencies: 0.015834
220500 -- (-871.707) [-869.765] (-868.842) (-873.323) * (-871.122) [-869.286] (-868.520) (-870.429) -- 0:00:45
221000 -- (-869.501) (-869.620) [-868.937] (-869.636) * (-870.673) (-870.380) [-868.350] (-871.006) -- 0:00:45
221500 -- [-868.256] (-868.568) (-870.533) (-872.621) * (-873.597) (-869.062) (-868.765) [-869.750] -- 0:00:45
222000 -- (-871.161) (-870.472) [-868.328] (-869.154) * (-870.158) (-868.986) (-869.364) [-872.343] -- 0:00:45
222500 -- (-873.060) (-872.025) (-869.071) [-868.548] * (-870.087) (-867.646) [-869.407] (-871.349) -- 0:00:45
223000 -- (-873.072) [-870.183] (-869.718) (-870.061) * [-872.415] (-870.171) (-872.613) (-871.218) -- 0:00:45
223500 -- (-869.212) (-868.334) [-868.144] (-868.931) * (-868.748) (-871.711) [-868.231] (-869.531) -- 0:00:45
224000 -- (-871.991) [-869.417] (-868.065) (-870.459) * (-870.839) (-869.726) [-870.215] (-872.428) -- 0:00:45
224500 -- (-870.931) (-870.075) (-871.920) [-870.044] * (-869.918) [-870.284] (-869.165) (-870.235) -- 0:00:44
225000 -- (-872.831) [-869.363] (-868.488) (-871.633) * [-869.772] (-869.268) (-868.640) (-869.514) -- 0:00:44
Average standard deviation of split frequencies: 0.014914
225500 -- [-871.820] (-870.569) (-869.549) (-869.913) * [-870.443] (-875.934) (-869.401) (-869.538) -- 0:00:44
226000 -- [-868.887] (-868.794) (-873.082) (-871.782) * (-869.116) [-869.918] (-870.647) (-869.701) -- 0:00:44
226500 -- (-868.220) (-869.991) (-873.446) [-871.373] * (-869.410) (-869.795) (-869.109) [-872.637] -- 0:00:44
227000 -- [-869.764] (-874.088) (-869.311) (-871.535) * (-869.296) [-869.709] (-868.977) (-869.815) -- 0:00:44
227500 -- [-868.458] (-868.107) (-874.484) (-872.624) * [-869.279] (-869.987) (-872.240) (-868.027) -- 0:00:44
228000 -- [-870.338] (-872.403) (-868.315) (-869.116) * (-868.302) (-875.926) [-870.427] (-869.467) -- 0:00:44
228500 -- (-870.048) (-877.732) [-868.988] (-868.780) * (-870.554) (-868.232) [-869.443] (-870.154) -- 0:00:43
229000 -- (-870.538) (-870.349) [-870.627] (-871.233) * (-870.680) [-868.232] (-869.904) (-870.023) -- 0:00:47
229500 -- (-873.158) (-869.555) (-869.974) [-871.675] * (-871.213) [-870.245] (-870.640) (-869.212) -- 0:00:47
230000 -- (-873.686) (-870.040) (-871.622) [-870.043] * (-872.086) [-871.511] (-872.171) (-869.712) -- 0:00:46
Average standard deviation of split frequencies: 0.015919
230500 -- (-870.500) (-870.302) [-873.597] (-871.322) * (-869.038) [-869.176] (-871.911) (-870.680) -- 0:00:46
231000 -- (-870.698) (-873.087) (-869.556) [-867.787] * (-868.427) (-869.759) (-869.915) [-872.683] -- 0:00:46
231500 -- (-869.267) (-869.410) (-870.187) [-867.758] * (-868.431) (-869.854) (-869.945) [-870.162] -- 0:00:46
232000 -- [-874.446] (-871.515) (-873.687) (-873.672) * [-868.433] (-870.592) (-870.140) (-870.791) -- 0:00:46
232500 -- (-872.139) (-873.493) [-869.714] (-871.141) * (-869.458) (-869.894) [-868.912] (-868.823) -- 0:00:46
233000 -- (-871.288) (-873.155) (-871.271) [-868.397] * (-868.758) (-868.630) (-869.107) [-868.144] -- 0:00:46
233500 -- (-872.716) (-872.034) (-870.788) [-868.279] * (-868.750) (-873.207) [-869.315] (-868.363) -- 0:00:45
234000 -- (-872.107) [-868.499] (-876.369) (-868.279) * (-870.327) (-878.894) [-870.294] (-868.303) -- 0:00:45
234500 -- [-868.990] (-868.370) (-873.629) (-869.991) * (-871.383) [-870.835] (-868.725) (-868.458) -- 0:00:45
235000 -- (-868.644) (-868.788) (-874.615) [-869.577] * [-870.219] (-872.909) (-870.570) (-869.622) -- 0:00:45
Average standard deviation of split frequencies: 0.016085
235500 -- (-873.131) [-868.576] (-870.526) (-871.575) * (-867.720) (-869.731) [-868.854] (-874.260) -- 0:00:45
236000 -- [-869.557] (-868.393) (-872.224) (-872.468) * (-867.948) (-869.938) (-869.458) [-869.960] -- 0:00:45
236500 -- [-868.379] (-868.767) (-870.246) (-869.032) * (-868.813) [-871.872] (-868.100) (-869.595) -- 0:00:45
237000 -- [-868.597] (-869.998) (-868.264) (-870.607) * [-870.719] (-870.704) (-868.564) (-869.495) -- 0:00:45
237500 -- (-868.382) (-869.277) [-869.284] (-869.060) * (-870.416) (-871.197) (-868.571) [-870.062] -- 0:00:44
238000 -- (-868.143) [-869.140] (-869.317) (-867.965) * (-870.814) (-869.717) [-870.798] (-870.202) -- 0:00:44
238500 -- [-868.420] (-870.026) (-870.951) (-868.106) * [-872.861] (-870.025) (-870.390) (-870.083) -- 0:00:44
239000 -- (-869.232) [-868.936] (-872.458) (-869.425) * (-868.959) (-870.256) [-870.465] (-869.216) -- 0:00:44
239500 -- (-868.445) (-869.677) (-871.889) [-870.480] * (-868.135) (-871.479) [-868.434] (-871.734) -- 0:00:44
240000 -- [-868.504] (-875.895) (-870.836) (-869.349) * (-870.115) (-873.279) (-871.956) [-871.083] -- 0:00:44
Average standard deviation of split frequencies: 0.016361
240500 -- [-869.936] (-871.319) (-871.877) (-870.113) * (-869.410) (-868.677) [-869.851] (-868.466) -- 0:00:44
241000 -- (-871.569) (-868.918) (-870.810) [-872.908] * (-868.486) [-868.600] (-869.528) (-870.602) -- 0:00:44
241500 -- (-877.754) (-868.845) (-868.499) [-871.048] * (-869.234) (-868.571) [-869.853] (-868.765) -- 0:00:43
242000 -- (-869.050) [-869.240] (-870.666) (-871.414) * (-869.271) [-871.395] (-871.369) (-870.119) -- 0:00:43
242500 -- (-870.404) (-871.713) (-874.382) [-870.875] * (-870.820) [-874.188] (-868.701) (-869.849) -- 0:00:43
243000 -- (-869.534) (-870.789) (-869.190) [-870.956] * [-871.438] (-870.517) (-868.931) (-869.521) -- 0:00:43
243500 -- (-871.338) (-871.585) [-867.783] (-868.384) * (-872.468) [-870.746] (-872.357) (-869.262) -- 0:00:43
244000 -- (-869.974) (-870.691) [-868.630] (-869.356) * (-869.401) [-870.668] (-870.430) (-869.437) -- 0:00:43
244500 -- (-870.040) (-870.396) (-867.633) [-870.696] * (-869.040) (-870.784) [-870.067] (-872.031) -- 0:00:43
245000 -- [-869.341] (-874.801) (-870.417) (-869.709) * (-871.755) (-871.167) (-869.845) [-868.769] -- 0:00:46
Average standard deviation of split frequencies: 0.015756
245500 -- (-870.174) [-874.094] (-868.406) (-872.618) * (-871.790) [-868.340] (-871.231) (-868.456) -- 0:00:46
246000 -- (-873.556) (-869.989) (-870.815) [-869.801] * (-871.309) [-869.319] (-875.537) (-868.198) -- 0:00:45
246500 -- (-871.646) [-870.467] (-869.742) (-871.042) * (-869.615) [-870.033] (-872.315) (-869.534) -- 0:00:45
247000 -- (-871.113) [-868.629] (-871.678) (-869.936) * [-869.393] (-870.641) (-870.893) (-873.077) -- 0:00:45
247500 -- (-870.212) [-868.132] (-876.264) (-870.776) * (-868.515) [-870.829] (-869.702) (-869.584) -- 0:00:45
248000 -- (-868.920) [-869.012] (-873.964) (-873.364) * (-870.217) [-869.628] (-868.716) (-869.228) -- 0:00:45
248500 -- (-872.004) (-869.128) (-872.033) [-871.674] * (-870.445) (-871.362) (-872.786) [-868.394] -- 0:00:45
249000 -- (-876.268) (-870.216) [-869.998] (-869.188) * (-872.266) (-869.032) (-871.914) [-867.765] -- 0:00:45
249500 -- [-868.731] (-872.241) (-871.890) (-869.042) * [-868.578] (-868.225) (-870.084) (-867.804) -- 0:00:45
250000 -- [-868.558] (-873.347) (-869.872) (-870.687) * (-871.864) [-869.799] (-871.200) (-869.978) -- 0:00:45
Average standard deviation of split frequencies: 0.016925
250500 -- [-870.684] (-870.085) (-872.114) (-870.677) * (-874.618) (-868.907) [-872.075] (-869.781) -- 0:00:44
251000 -- (-871.092) (-871.132) (-870.250) [-869.435] * (-871.807) [-869.770] (-872.866) (-870.769) -- 0:00:44
251500 -- (-868.826) (-870.452) [-868.278] (-870.624) * (-875.037) (-869.475) [-867.804] (-872.801) -- 0:00:44
252000 -- (-868.817) [-871.200] (-868.019) (-870.434) * (-873.620) (-871.280) (-873.508) [-869.737] -- 0:00:44
252500 -- (-869.189) (-874.947) [-868.935] (-869.202) * (-872.678) (-868.934) (-868.787) [-868.569] -- 0:00:44
253000 -- (-870.439) (-871.071) (-869.642) [-871.312] * (-872.187) [-876.408] (-868.617) (-870.330) -- 0:00:44
253500 -- (-872.099) (-871.803) (-870.124) [-871.472] * (-869.506) (-870.222) [-868.544] (-869.670) -- 0:00:44
254000 -- (-871.081) (-872.247) [-870.058] (-875.126) * [-868.058] (-868.336) (-868.075) (-869.918) -- 0:00:44
254500 -- [-870.833] (-873.724) (-868.215) (-871.839) * [-867.827] (-870.155) (-871.075) (-872.861) -- 0:00:43
255000 -- (-870.194) [-869.548] (-869.434) (-870.048) * (-871.582) (-870.350) [-871.467] (-868.503) -- 0:00:43
Average standard deviation of split frequencies: 0.016789
255500 -- (-868.776) (-872.357) [-871.453] (-871.375) * (-871.049) (-870.203) [-870.632] (-869.472) -- 0:00:43
256000 -- (-869.312) [-873.551] (-872.040) (-871.726) * (-871.008) (-870.511) [-869.756] (-869.626) -- 0:00:43
256500 -- (-870.089) (-873.599) (-872.450) [-869.743] * (-869.492) [-875.867] (-869.801) (-873.786) -- 0:00:43
257000 -- (-869.179) (-870.534) [-869.676] (-869.882) * (-872.318) [-870.441] (-870.280) (-871.143) -- 0:00:43
257500 -- (-869.696) (-870.326) [-868.238] (-868.988) * (-873.122) (-870.657) (-871.191) [-870.142] -- 0:00:43
258000 -- (-869.117) [-870.446] (-869.798) (-874.034) * (-870.251) (-869.888) (-871.454) [-869.379] -- 0:00:43
258500 -- (-870.173) [-876.512] (-869.558) (-877.085) * (-869.125) (-871.288) (-880.440) [-870.750] -- 0:00:43
259000 -- (-872.894) (-871.815) [-870.025] (-875.959) * [-869.330] (-868.968) (-870.586) (-869.753) -- 0:00:42
259500 -- (-870.571) (-869.384) [-869.065] (-872.222) * (-870.661) (-868.793) (-870.914) [-868.639] -- 0:00:42
260000 -- (-868.893) (-873.734) (-870.153) [-869.761] * (-873.488) (-868.201) (-871.834) [-870.033] -- 0:00:42
Average standard deviation of split frequencies: 0.015851
260500 -- (-874.843) [-873.380] (-869.437) (-875.469) * (-870.960) (-868.886) [-871.798] (-868.923) -- 0:00:45
261000 -- (-869.504) (-869.845) [-872.561] (-869.304) * [-870.027] (-870.135) (-870.769) (-869.527) -- 0:00:45
261500 -- (-869.169) [-869.653] (-872.600) (-871.798) * (-870.334) [-869.759] (-869.328) (-871.104) -- 0:00:45
262000 -- (-869.086) [-869.530] (-868.146) (-868.897) * (-872.868) (-870.453) [-869.777] (-870.365) -- 0:00:45
262500 -- (-869.109) (-868.521) [-872.765] (-870.097) * (-874.305) (-869.318) (-869.713) [-869.333] -- 0:00:44
263000 -- (-870.177) [-868.148] (-869.199) (-872.899) * (-872.226) (-872.097) (-868.454) [-868.559] -- 0:00:44
263500 -- (-871.105) (-870.167) [-868.586] (-869.004) * (-868.809) (-869.561) [-867.962] (-874.383) -- 0:00:44
264000 -- (-869.746) [-873.822] (-871.801) (-869.360) * (-868.332) (-871.037) [-869.009] (-870.795) -- 0:00:44
264500 -- (-871.204) (-871.128) (-869.946) [-870.862] * (-870.235) (-871.307) (-869.754) [-871.595] -- 0:00:44
265000 -- (-871.435) [-871.756] (-869.011) (-871.737) * (-869.384) (-871.985) (-871.451) [-871.248] -- 0:00:44
Average standard deviation of split frequencies: 0.016789
265500 -- [-870.348] (-874.240) (-870.379) (-874.172) * (-869.063) (-873.160) (-869.634) [-868.060] -- 0:00:44
266000 -- (-871.769) (-875.184) (-869.387) [-870.793] * (-872.854) [-874.929] (-869.120) (-869.820) -- 0:00:44
266500 -- (-873.172) (-871.381) [-868.380] (-870.158) * (-869.918) [-870.489] (-868.690) (-868.564) -- 0:00:44
267000 -- (-871.369) (-870.772) [-870.082] (-870.484) * [-868.522] (-869.769) (-870.772) (-870.089) -- 0:00:43
267500 -- (-870.481) [-868.448] (-871.688) (-869.404) * (-872.791) [-873.435] (-872.176) (-870.765) -- 0:00:43
268000 -- (-868.236) (-870.635) (-869.379) [-868.245] * (-868.343) (-870.036) [-870.890] (-870.459) -- 0:00:43
268500 -- (-868.476) [-869.624] (-874.502) (-870.089) * [-870.813] (-869.092) (-869.501) (-869.891) -- 0:00:43
269000 -- (-869.002) (-869.713) (-869.066) [-869.749] * (-869.332) [-868.182] (-869.931) (-874.441) -- 0:00:43
269500 -- (-874.100) (-869.731) [-868.800] (-869.161) * (-869.092) (-867.900) (-869.676) [-871.678] -- 0:00:43
270000 -- [-870.366] (-873.548) (-872.042) (-869.959) * (-870.717) (-868.748) [-868.363] (-869.703) -- 0:00:43
Average standard deviation of split frequencies: 0.017141
270500 -- (-869.688) (-870.900) [-868.907] (-869.317) * (-874.145) (-869.529) [-868.304] (-870.752) -- 0:00:43
271000 -- (-870.265) [-868.182] (-870.200) (-873.986) * (-868.685) (-870.659) (-868.478) [-870.110] -- 0:00:43
271500 -- [-872.173] (-870.898) (-870.845) (-872.074) * (-870.644) (-871.391) (-870.371) [-868.408] -- 0:00:42
272000 -- [-873.317] (-870.889) (-868.275) (-873.431) * (-868.157) (-873.348) (-869.883) [-870.852] -- 0:00:42
272500 -- [-869.247] (-868.928) (-869.239) (-869.381) * (-869.063) (-873.550) [-869.934] (-869.283) -- 0:00:42
273000 -- [-868.713] (-870.860) (-869.217) (-869.537) * (-869.088) (-870.308) [-868.733] (-870.957) -- 0:00:42
273500 -- (-868.198) [-870.581] (-874.024) (-870.316) * (-869.238) (-872.636) [-869.174] (-873.814) -- 0:00:42
274000 -- (-870.023) (-869.748) (-872.497) [-870.235] * [-870.552] (-876.114) (-869.187) (-871.504) -- 0:00:42
274500 -- (-871.554) (-868.709) (-869.720) [-870.801] * [-870.095] (-871.059) (-869.977) (-873.143) -- 0:00:42
275000 -- [-872.831] (-868.200) (-870.693) (-870.651) * [-869.602] (-871.064) (-868.439) (-872.500) -- 0:00:42
Average standard deviation of split frequencies: 0.016890
275500 -- [-868.669] (-867.719) (-872.762) (-869.059) * (-874.974) (-873.117) (-869.513) [-870.190] -- 0:00:42
276000 -- (-870.912) (-868.164) (-873.843) [-868.004] * (-876.006) (-870.774) (-869.688) [-869.371] -- 0:00:41
276500 -- (-870.390) [-868.188] (-869.407) (-868.029) * (-873.682) (-871.230) [-869.258] (-868.630) -- 0:00:41
277000 -- (-870.795) (-868.297) (-870.197) [-870.817] * (-872.203) [-871.712] (-869.541) (-868.443) -- 0:00:41
277500 -- (-867.933) [-868.135] (-872.996) (-871.666) * [-871.794] (-871.977) (-868.378) (-872.102) -- 0:00:44
278000 -- [-867.964] (-869.828) (-874.513) (-870.379) * (-871.704) [-871.534] (-868.877) (-873.047) -- 0:00:44
278500 -- [-867.941] (-870.225) (-868.632) (-873.337) * (-869.127) (-870.642) [-869.258] (-870.968) -- 0:00:44
279000 -- (-870.924) [-871.233] (-871.055) (-869.931) * [-870.282] (-869.421) (-869.799) (-869.390) -- 0:00:43
279500 -- (-869.899) (-869.056) [-869.909] (-868.758) * [-869.780] (-869.180) (-868.855) (-875.383) -- 0:00:43
280000 -- (-869.917) (-872.538) [-868.971] (-870.356) * (-869.529) (-870.987) (-868.419) [-870.752] -- 0:00:43
Average standard deviation of split frequencies: 0.017169
280500 -- (-868.736) (-871.702) (-869.507) [-872.197] * (-871.758) [-868.406] (-872.090) (-869.246) -- 0:00:43
281000 -- (-868.130) (-872.486) [-869.987] (-871.812) * [-870.022] (-872.698) (-868.368) (-871.800) -- 0:00:43
281500 -- (-870.525) [-868.628] (-872.613) (-869.796) * (-869.215) (-874.295) [-870.533] (-868.420) -- 0:00:43
282000 -- (-868.513) [-869.697] (-874.048) (-870.090) * (-872.025) (-870.896) (-869.962) [-869.878] -- 0:00:43
282500 -- (-868.566) [-868.836] (-873.602) (-870.752) * (-872.877) (-868.040) [-867.957] (-874.969) -- 0:00:43
283000 -- (-871.647) [-871.224] (-874.026) (-869.387) * (-870.032) (-870.757) (-870.728) [-871.646] -- 0:00:43
283500 -- (-869.530) (-873.038) [-872.460] (-870.222) * (-870.335) (-867.875) [-870.522] (-869.097) -- 0:00:42
284000 -- (-870.036) (-875.762) (-869.291) [-869.793] * (-868.235) (-867.968) [-870.308] (-869.120) -- 0:00:42
284500 -- [-870.146] (-873.228) (-871.727) (-874.134) * (-869.955) (-868.870) [-869.169] (-872.636) -- 0:00:42
285000 -- [-868.658] (-871.946) (-871.974) (-871.095) * [-868.496] (-871.449) (-873.226) (-869.938) -- 0:00:42
Average standard deviation of split frequencies: 0.015615
285500 -- (-870.108) (-874.883) [-870.887] (-870.170) * (-869.380) (-872.525) (-868.935) [-870.425] -- 0:00:42
286000 -- (-870.072) (-873.084) (-870.454) [-870.360] * [-872.893] (-871.051) (-870.693) (-868.943) -- 0:00:42
286500 -- (-873.629) (-867.910) (-868.622) [-868.885] * (-870.357) (-869.002) (-870.293) [-869.307] -- 0:00:42
287000 -- (-868.960) [-868.642] (-871.385) (-870.137) * (-870.011) (-868.987) [-868.733] (-872.117) -- 0:00:42
287500 -- (-868.732) (-869.165) (-868.303) [-874.160] * (-873.109) (-868.333) (-870.412) [-869.797] -- 0:00:42
288000 -- (-868.164) [-868.941] (-870.071) (-869.907) * (-870.878) [-868.952] (-870.062) (-870.738) -- 0:00:42
288500 -- [-872.186] (-869.325) (-870.335) (-869.740) * [-870.009] (-869.833) (-873.162) (-869.184) -- 0:00:41
289000 -- [-871.387] (-868.660) (-868.359) (-869.204) * [-870.378] (-869.075) (-869.724) (-869.267) -- 0:00:41
289500 -- (-874.860) (-869.048) [-870.835] (-870.557) * (-869.837) (-868.706) (-868.798) [-871.570] -- 0:00:41
290000 -- (-873.613) (-868.624) [-870.308] (-871.052) * (-870.553) (-871.385) [-869.655] (-871.319) -- 0:00:41
Average standard deviation of split frequencies: 0.015858
290500 -- (-873.564) [-868.882] (-872.361) (-868.992) * (-871.130) [-869.005] (-869.409) (-869.180) -- 0:00:41
291000 -- (-868.810) (-870.252) [-870.749] (-872.767) * [-873.312] (-870.527) (-868.432) (-870.047) -- 0:00:41
291500 -- [-870.249] (-874.207) (-868.583) (-871.078) * (-873.351) (-869.700) (-869.022) [-871.246] -- 0:00:41
292000 -- (-869.087) (-876.503) (-870.275) [-871.382] * (-870.534) [-873.216] (-868.641) (-869.562) -- 0:00:41
292500 -- (-871.099) (-868.820) (-870.420) [-871.429] * (-870.562) [-871.141] (-869.831) (-869.951) -- 0:00:41
293000 -- (-868.763) (-869.612) (-870.215) [-869.055] * [-869.780] (-872.028) (-868.266) (-874.920) -- 0:00:41
293500 -- (-869.403) (-875.033) [-874.878] (-869.264) * (-870.055) [-870.109] (-868.545) (-870.594) -- 0:00:40
294000 -- (-870.511) (-872.208) [-874.951] (-874.682) * (-871.340) [-869.828] (-873.348) (-870.057) -- 0:00:43
294500 -- [-869.035] (-878.406) (-870.548) (-871.477) * (-869.794) (-872.098) (-871.577) [-871.792] -- 0:00:43
295000 -- [-870.673] (-873.668) (-872.231) (-871.117) * (-870.667) (-869.806) [-873.948] (-870.929) -- 0:00:43
Average standard deviation of split frequencies: 0.016113
295500 -- (-869.958) (-872.112) [-873.443] (-873.581) * [-869.444] (-870.842) (-868.867) (-871.782) -- 0:00:42
296000 -- (-873.613) (-869.203) [-869.052] (-869.240) * (-869.411) (-869.903) (-868.874) [-868.711] -- 0:00:42
296500 -- (-871.227) [-868.921] (-871.317) (-868.620) * (-869.975) (-869.323) (-869.751) [-869.250] -- 0:00:42
297000 -- (-869.245) (-870.382) (-870.294) [-868.823] * [-869.101] (-872.463) (-868.985) (-869.210) -- 0:00:42
297500 -- (-869.552) (-868.933) [-870.077] (-870.305) * (-868.832) (-869.091) (-868.821) [-874.218] -- 0:00:42
298000 -- [-868.346] (-868.770) (-870.821) (-872.013) * (-870.060) [-870.522] (-869.202) (-869.129) -- 0:00:42
298500 -- (-868.015) [-868.112] (-869.962) (-870.963) * [-868.930] (-869.273) (-869.179) (-871.155) -- 0:00:42
299000 -- (-868.415) (-868.883) [-869.812] (-869.663) * [-868.496] (-868.318) (-871.063) (-872.219) -- 0:00:42
299500 -- (-867.838) [-872.170] (-868.688) (-868.524) * (-870.976) (-872.102) [-869.660] (-873.167) -- 0:00:42
300000 -- (-869.965) (-873.998) [-869.212] (-870.055) * [-867.986] (-868.940) (-868.173) (-871.707) -- 0:00:42
Average standard deviation of split frequencies: 0.015863
300500 -- (-870.366) (-872.256) (-870.056) [-869.175] * (-870.291) [-870.487] (-870.946) (-872.341) -- 0:00:41
301000 -- (-868.480) (-870.334) (-873.797) [-867.858] * (-874.623) (-872.336) [-868.118] (-868.962) -- 0:00:41
301500 -- (-870.064) (-871.646) [-874.795] (-868.760) * (-875.688) [-872.450] (-871.106) (-868.694) -- 0:00:41
302000 -- (-872.187) (-870.948) (-869.039) [-868.265] * [-870.785] (-871.156) (-869.531) (-869.359) -- 0:00:41
302500 -- (-871.748) (-870.081) [-870.740] (-870.824) * (-870.371) (-870.607) [-870.660] (-869.044) -- 0:00:41
303000 -- (-868.262) (-868.677) (-870.644) [-869.823] * [-869.279] (-870.637) (-870.808) (-869.350) -- 0:00:41
303500 -- (-870.847) (-868.691) (-871.197) [-869.723] * [-869.386] (-869.526) (-871.642) (-869.732) -- 0:00:41
304000 -- [-868.584] (-872.796) (-868.990) (-870.208) * (-869.912) [-869.382] (-869.639) (-873.150) -- 0:00:41
304500 -- (-869.393) (-873.135) (-869.827) [-869.443] * (-870.100) (-872.100) [-868.715] (-868.684) -- 0:00:41
305000 -- (-871.420) (-869.382) (-870.728) [-871.214] * (-869.595) (-871.338) (-869.237) [-869.283] -- 0:00:41
Average standard deviation of split frequencies: 0.015649
305500 -- (-872.443) [-868.402] (-869.046) (-869.824) * (-870.473) (-873.138) (-872.191) [-869.315] -- 0:00:40
306000 -- (-868.808) [-867.929] (-870.261) (-876.956) * (-871.278) [-872.943] (-871.360) (-868.540) -- 0:00:40
306500 -- [-870.920] (-869.209) (-869.358) (-875.264) * [-871.555] (-871.474) (-871.546) (-875.762) -- 0:00:40
307000 -- (-869.248) (-870.190) (-869.162) [-870.687] * (-868.801) [-871.656] (-868.538) (-879.330) -- 0:00:40
307500 -- [-870.089] (-874.522) (-870.525) (-870.202) * [-868.370] (-870.879) (-868.350) (-870.895) -- 0:00:40
308000 -- [-870.727] (-872.415) (-869.803) (-868.927) * (-869.567) (-870.078) [-868.436] (-870.921) -- 0:00:40
308500 -- (-867.980) [-872.126] (-868.119) (-869.947) * (-869.567) (-870.116) [-868.214] (-869.643) -- 0:00:40
309000 -- [-868.007] (-874.648) (-868.163) (-875.416) * (-869.667) [-871.086] (-871.504) (-871.643) -- 0:00:40
309500 -- (-868.938) (-872.871) [-868.339] (-872.970) * [-868.446] (-873.526) (-870.332) (-868.946) -- 0:00:40
310000 -- (-867.902) (-870.681) [-871.413] (-872.411) * (-869.614) (-874.585) (-870.656) [-868.651] -- 0:00:40
Average standard deviation of split frequencies: 0.015493
310500 -- (-867.806) (-872.152) [-871.340] (-871.965) * (-869.878) [-873.602] (-871.272) (-870.443) -- 0:00:42
311000 -- (-868.235) (-869.969) (-869.537) [-870.142] * (-868.537) [-869.415] (-873.703) (-870.001) -- 0:00:42
311500 -- [-868.428] (-871.312) (-869.350) (-868.873) * [-870.301] (-868.579) (-871.667) (-870.189) -- 0:00:41
312000 -- [-869.310] (-868.325) (-869.422) (-869.578) * (-869.370) [-869.761] (-873.644) (-870.031) -- 0:00:41
312500 -- (-874.078) [-870.578] (-868.883) (-871.290) * (-873.634) [-872.525] (-868.920) (-868.313) -- 0:00:41
313000 -- (-871.666) (-871.983) [-868.921] (-868.633) * (-869.892) (-871.968) [-870.851] (-868.363) -- 0:00:41
313500 -- [-871.444] (-871.228) (-868.586) (-869.664) * (-871.334) (-868.648) (-870.459) [-867.753] -- 0:00:41
314000 -- (-869.713) (-868.856) [-868.191] (-869.456) * (-868.450) (-870.079) (-870.171) [-869.366] -- 0:00:41
314500 -- (-872.990) [-869.399] (-869.196) (-870.937) * (-869.041) [-869.125] (-868.970) (-869.779) -- 0:00:41
315000 -- (-869.943) [-869.569] (-872.081) (-870.065) * (-868.368) (-872.543) [-871.359] (-868.867) -- 0:00:41
Average standard deviation of split frequencies: 0.015249
315500 -- (-871.055) (-871.689) [-869.658] (-870.938) * [-868.115] (-868.333) (-869.136) (-871.763) -- 0:00:41
316000 -- (-871.403) [-869.355] (-870.980) (-870.708) * (-869.299) (-870.937) (-873.609) [-870.160] -- 0:00:41
316500 -- (-869.952) (-869.905) [-869.495] (-870.927) * [-870.677] (-873.170) (-871.408) (-869.241) -- 0:00:41
317000 -- (-869.021) [-870.629] (-869.909) (-868.143) * (-870.477) (-870.691) (-874.460) [-868.481] -- 0:00:40
317500 -- (-871.962) (-869.311) (-869.852) [-870.388] * (-869.308) [-871.378] (-872.665) (-868.009) -- 0:00:40
318000 -- (-869.172) (-869.164) [-867.987] (-869.818) * [-871.084] (-869.569) (-872.281) (-869.735) -- 0:00:40
318500 -- (-869.288) [-870.618] (-868.653) (-871.654) * [-867.809] (-868.440) (-872.248) (-869.301) -- 0:00:40
319000 -- [-868.328] (-868.305) (-869.985) (-869.375) * (-870.822) (-868.443) [-870.367] (-869.354) -- 0:00:40
319500 -- (-868.273) (-869.550) (-871.057) [-870.359] * (-872.216) (-871.756) [-868.753] (-870.172) -- 0:00:40
320000 -- (-869.353) [-870.490] (-869.321) (-869.804) * (-871.070) (-874.137) [-868.629] (-868.621) -- 0:00:40
Average standard deviation of split frequencies: 0.016007
320500 -- [-868.980] (-870.282) (-869.421) (-869.502) * (-869.542) (-869.337) (-868.176) [-868.727] -- 0:00:40
321000 -- (-872.276) (-870.599) (-870.498) [-869.054] * (-868.932) (-869.698) (-870.507) [-868.591] -- 0:00:40
321500 -- (-872.735) (-875.885) [-870.848] (-870.686) * (-870.952) (-869.735) (-871.278) [-869.773] -- 0:00:40
322000 -- (-871.793) (-872.243) (-875.606) [-868.468] * (-871.435) (-867.862) (-873.154) [-871.845] -- 0:00:40
322500 -- [-872.042] (-871.619) (-872.115) (-870.345) * (-869.778) (-867.862) (-869.834) [-871.852] -- 0:00:39
323000 -- (-870.779) [-868.627] (-870.937) (-868.745) * (-869.201) [-868.350] (-873.136) (-872.212) -- 0:00:39
323500 -- (-868.977) (-870.983) (-868.989) [-870.386] * (-869.128) [-870.693] (-869.717) (-867.657) -- 0:00:39
324000 -- (-869.892) (-870.331) (-868.428) [-871.410] * (-871.906) (-870.219) (-869.411) [-869.366] -- 0:00:39
324500 -- [-871.203] (-868.203) (-871.634) (-868.854) * [-869.696] (-869.982) (-871.589) (-871.010) -- 0:00:39
325000 -- (-871.255) (-868.939) [-869.128] (-874.405) * (-874.453) (-869.251) (-875.128) [-869.837] -- 0:00:39
Average standard deviation of split frequencies: 0.016287
325500 -- (-870.855) [-868.939] (-869.511) (-871.602) * [-869.051] (-869.312) (-869.769) (-873.123) -- 0:00:39
326000 -- (-874.183) (-871.283) [-868.491] (-872.604) * (-871.508) (-872.164) (-868.167) [-868.157] -- 0:00:39
326500 -- (-872.138) [-873.286] (-869.214) (-868.693) * [-869.297] (-871.824) (-870.876) (-869.146) -- 0:00:39
327000 -- [-869.690] (-875.551) (-868.928) (-869.975) * (-869.255) (-869.417) (-868.205) [-868.389] -- 0:00:39
327500 -- [-868.614] (-872.519) (-870.071) (-869.739) * (-873.043) [-872.404] (-868.243) (-871.440) -- 0:00:41
328000 -- (-871.059) (-871.976) [-870.510] (-871.365) * (-871.502) (-868.916) [-868.330] (-873.961) -- 0:00:40
328500 -- (-868.441) [-869.665] (-873.420) (-870.135) * (-869.334) (-869.343) (-870.630) [-873.610] -- 0:00:40
329000 -- (-868.073) (-873.325) [-868.457] (-869.657) * (-874.139) [-868.515] (-869.466) (-872.914) -- 0:00:40
329500 -- [-868.048] (-872.846) (-868.372) (-870.761) * [-869.221] (-868.347) (-870.505) (-868.487) -- 0:00:40
330000 -- (-871.665) (-868.926) (-870.358) [-874.862] * [-871.942] (-870.198) (-873.213) (-869.845) -- 0:00:40
Average standard deviation of split frequencies: 0.015757
330500 -- (-870.170) (-869.606) (-871.519) [-868.987] * (-872.302) (-869.409) (-874.335) [-868.785] -- 0:00:40
331000 -- (-870.360) (-871.540) [-870.283] (-868.717) * (-869.531) (-868.431) (-872.547) [-869.714] -- 0:00:40
331500 -- (-868.695) [-873.103] (-870.716) (-869.322) * (-868.061) [-868.642] (-869.929) (-870.812) -- 0:00:40
332000 -- (-868.638) (-869.056) (-870.352) [-870.184] * (-868.073) [-868.763] (-870.338) (-874.035) -- 0:00:40
332500 -- (-873.408) (-871.287) (-870.012) [-870.920] * (-868.690) [-869.339] (-871.531) (-870.302) -- 0:00:40
333000 -- (-870.318) [-869.437] (-870.007) (-868.644) * [-869.689] (-872.905) (-869.852) (-869.324) -- 0:00:40
333500 -- (-869.716) (-868.790) (-870.719) [-868.703] * [-869.231] (-870.508) (-873.204) (-870.783) -- 0:00:39
334000 -- [-872.958] (-868.522) (-873.534) (-870.446) * (-872.133) (-871.692) [-875.427] (-871.089) -- 0:00:39
334500 -- (-878.400) [-869.234] (-869.912) (-868.162) * [-869.693] (-870.312) (-872.396) (-873.601) -- 0:00:39
335000 -- [-869.207] (-868.907) (-870.064) (-872.853) * (-868.345) [-870.851] (-870.089) (-871.473) -- 0:00:39
Average standard deviation of split frequencies: 0.015268
335500 -- (-871.827) (-871.749) [-867.691] (-875.088) * [-870.090] (-871.244) (-870.629) (-870.133) -- 0:00:39
336000 -- (-872.034) (-871.490) (-871.154) [-870.550] * (-868.795) [-874.637] (-869.724) (-869.003) -- 0:00:39
336500 -- [-869.366] (-869.760) (-869.447) (-869.364) * [-871.921] (-870.345) (-869.471) (-869.210) -- 0:00:39
337000 -- [-869.630] (-871.022) (-874.866) (-872.808) * (-868.113) (-868.236) (-869.046) [-868.668] -- 0:00:39
337500 -- (-868.171) [-872.575] (-871.604) (-870.154) * [-868.846] (-870.825) (-868.190) (-871.485) -- 0:00:39
338000 -- (-868.222) (-872.230) (-872.756) [-869.272] * (-869.003) (-872.806) [-868.543] (-870.868) -- 0:00:39
338500 -- [-872.987] (-868.300) (-871.851) (-869.258) * (-868.303) (-871.517) [-871.588] (-868.655) -- 0:00:39
339000 -- (-871.144) (-868.307) [-869.514] (-869.506) * (-867.829) (-868.704) [-869.914] (-870.646) -- 0:00:38
339500 -- (-870.352) (-869.889) (-868.863) [-870.120] * [-869.629] (-871.702) (-872.942) (-868.663) -- 0:00:38
340000 -- (-871.478) (-870.306) [-868.491] (-868.425) * (-869.803) [-876.537] (-871.509) (-868.019) -- 0:00:38
Average standard deviation of split frequencies: 0.015827
340500 -- (-869.036) [-868.768] (-869.331) (-868.577) * (-868.482) (-872.172) [-874.729] (-868.700) -- 0:00:38
341000 -- (-872.299) (-868.710) (-870.990) [-868.665] * [-868.681] (-870.834) (-873.378) (-871.076) -- 0:00:38
341500 -- (-869.384) (-871.037) [-869.387] (-868.240) * (-869.217) (-869.838) [-872.809] (-871.984) -- 0:00:38
342000 -- [-870.833] (-870.460) (-868.036) (-868.883) * (-872.231) (-869.018) (-871.497) [-870.147] -- 0:00:38
342500 -- (-869.311) (-871.599) (-868.370) [-869.402] * (-870.806) (-872.332) (-872.356) [-869.101] -- 0:00:38
343000 -- (-874.610) (-874.243) (-869.338) [-872.063] * (-874.446) (-875.608) [-869.218] (-871.745) -- 0:00:38
343500 -- [-870.691] (-871.267) (-869.960) (-871.100) * (-871.832) [-873.656] (-870.126) (-871.159) -- 0:00:38
344000 -- [-868.755] (-873.452) (-873.837) (-868.504) * (-868.478) [-870.355] (-869.496) (-869.121) -- 0:00:40
344500 -- (-870.261) [-870.074] (-870.458) (-870.259) * (-868.480) [-871.239] (-870.098) (-869.238) -- 0:00:39
345000 -- (-870.604) (-869.381) (-872.281) [-870.726] * (-871.287) [-869.134] (-868.853) (-869.198) -- 0:00:39
Average standard deviation of split frequencies: 0.014346
345500 -- (-872.203) (-870.048) [-875.253] (-868.825) * [-868.995] (-871.072) (-869.821) (-869.997) -- 0:00:39
346000 -- (-870.735) (-869.539) [-868.191] (-873.432) * (-870.484) (-867.858) [-869.381] (-870.003) -- 0:00:39
346500 -- (-869.981) [-868.476] (-868.560) (-873.562) * (-870.124) (-868.239) (-868.383) [-868.022] -- 0:00:39
347000 -- (-870.496) [-868.218] (-870.473) (-871.570) * (-869.601) (-870.967) (-869.318) [-869.901] -- 0:00:39
347500 -- (-870.158) [-868.232] (-868.666) (-870.132) * [-871.007] (-873.590) (-869.801) (-868.787) -- 0:00:39
348000 -- (-869.211) (-871.547) [-869.278] (-870.838) * (-869.819) (-869.941) [-869.925] (-872.546) -- 0:00:39
348500 -- (-870.985) (-868.857) [-869.953] (-870.032) * (-869.634) (-870.561) (-869.571) [-869.736] -- 0:00:39
349000 -- [-871.559] (-874.243) (-870.930) (-869.513) * (-873.045) (-872.890) [-873.674] (-870.087) -- 0:00:39
349500 -- (-873.337) [-870.143] (-870.455) (-871.581) * (-868.446) [-870.334] (-869.321) (-871.065) -- 0:00:39
350000 -- (-871.863) [-868.686] (-868.193) (-868.966) * (-871.745) (-873.839) (-868.577) [-872.478] -- 0:00:39
Average standard deviation of split frequencies: 0.012731
350500 -- (-870.434) [-868.375] (-870.404) (-869.191) * (-872.247) (-873.443) [-869.023] (-871.937) -- 0:00:38
351000 -- (-869.351) (-869.124) (-871.484) [-868.252] * (-869.821) (-877.156) [-870.194] (-871.139) -- 0:00:38
351500 -- (-872.438) (-870.506) (-871.899) [-872.116] * [-869.972] (-872.066) (-870.819) (-874.396) -- 0:00:38
352000 -- (-869.417) (-871.533) [-870.658] (-873.166) * (-870.532) (-869.616) [-870.318] (-870.736) -- 0:00:38
352500 -- [-869.488] (-870.552) (-871.012) (-870.868) * [-875.533] (-869.683) (-872.758) (-873.482) -- 0:00:38
353000 -- [-869.859] (-870.570) (-869.428) (-873.751) * (-873.078) (-869.096) [-869.520] (-872.165) -- 0:00:38
353500 -- [-869.745] (-868.320) (-869.236) (-871.256) * (-870.122) (-868.650) [-870.838] (-869.254) -- 0:00:38
354000 -- (-871.609) (-868.665) [-872.063] (-871.015) * (-869.143) (-868.561) (-870.078) [-871.736] -- 0:00:38
354500 -- [-869.273] (-870.586) (-869.073) (-870.340) * [-869.067] (-868.483) (-869.424) (-872.827) -- 0:00:38
355000 -- (-870.070) (-869.040) [-872.474] (-869.451) * (-869.164) (-869.940) [-871.469] (-870.266) -- 0:00:38
Average standard deviation of split frequencies: 0.012385
355500 -- (-870.071) (-870.144) (-867.888) [-870.436] * [-868.999] (-868.299) (-873.836) (-868.101) -- 0:00:38
356000 -- (-871.438) (-870.817) (-870.069) [-868.444] * [-871.398] (-869.934) (-870.324) (-870.150) -- 0:00:37
356500 -- (-870.130) (-868.752) [-869.386] (-871.608) * (-874.295) (-869.053) (-870.551) [-870.730] -- 0:00:37
357000 -- [-869.370] (-869.085) (-869.067) (-873.852) * (-870.979) (-868.496) (-869.526) [-870.217] -- 0:00:37
357500 -- (-872.666) [-871.972] (-870.415) (-871.483) * [-870.898] (-869.495) (-871.281) (-871.424) -- 0:00:37
358000 -- (-873.050) (-868.121) (-870.899) [-872.214] * [-870.489] (-870.315) (-868.078) (-871.186) -- 0:00:37
358500 -- (-874.096) [-869.774] (-869.024) (-871.609) * (-870.124) (-869.070) (-869.587) [-869.679] -- 0:00:37
359000 -- (-868.823) [-870.838] (-869.283) (-868.322) * (-868.960) (-870.086) (-872.230) [-869.515] -- 0:00:37
359500 -- (-868.811) (-868.495) [-873.185] (-871.966) * (-869.222) (-870.553) [-872.433] (-874.333) -- 0:00:37
360000 -- [-868.672] (-868.091) (-874.193) (-872.263) * [-869.588] (-870.736) (-872.707) (-875.556) -- 0:00:37
Average standard deviation of split frequencies: 0.010865
360500 -- (-869.682) (-870.705) [-869.774] (-871.173) * (-870.394) (-869.618) [-870.454] (-869.601) -- 0:00:37
361000 -- (-868.150) (-870.022) [-871.692] (-868.103) * (-869.566) [-871.842] (-871.003) (-868.935) -- 0:00:38
361500 -- (-870.418) (-873.640) [-870.046] (-869.464) * (-869.999) (-869.533) [-868.656] (-868.603) -- 0:00:38
362000 -- (-870.098) (-874.517) (-869.556) [-869.598] * [-870.450] (-868.157) (-868.325) (-869.317) -- 0:00:38
362500 -- (-869.748) (-872.156) [-871.210] (-869.384) * (-871.322) (-869.321) (-870.268) [-871.321] -- 0:00:38
363000 -- [-869.352] (-868.640) (-870.590) (-871.892) * (-870.282) (-880.126) (-870.499) [-868.486] -- 0:00:38
363500 -- (-871.389) [-870.693] (-870.020) (-869.745) * (-870.364) (-868.891) (-870.768) [-868.494] -- 0:00:38
364000 -- (-879.133) (-869.770) [-869.247] (-869.220) * [-869.302] (-868.069) (-868.285) (-870.051) -- 0:00:38
364500 -- (-874.154) (-870.367) [-868.457] (-869.413) * [-873.731] (-873.568) (-870.291) (-872.443) -- 0:00:38
365000 -- [-874.627] (-872.380) (-868.414) (-869.021) * (-873.718) (-868.452) [-868.437] (-870.404) -- 0:00:38
Average standard deviation of split frequencies: 0.011062
365500 -- (-869.612) (-872.723) [-868.325] (-870.414) * (-874.302) [-870.501] (-868.857) (-872.703) -- 0:00:38
366000 -- (-872.945) [-872.120] (-868.876) (-870.907) * (-871.457) (-872.562) [-868.529] (-871.154) -- 0:00:38
366500 -- (-872.964) [-869.324] (-868.575) (-870.968) * (-869.171) (-870.511) (-869.827) [-868.591] -- 0:00:38
367000 -- [-872.825] (-870.316) (-870.087) (-870.757) * (-869.284) (-869.186) [-870.137] (-868.490) -- 0:00:37
367500 -- [-876.905] (-873.081) (-871.776) (-869.513) * (-871.600) (-874.039) (-868.842) [-868.691] -- 0:00:37
368000 -- (-868.830) (-869.026) [-872.506] (-873.348) * [-870.406] (-871.983) (-868.698) (-869.488) -- 0:00:37
368500 -- (-870.777) [-869.607] (-870.719) (-871.520) * (-873.797) (-868.646) (-876.166) [-869.762] -- 0:00:37
369000 -- (-868.912) (-869.278) (-871.215) [-871.737] * (-875.783) [-869.145] (-879.916) (-870.466) -- 0:00:37
369500 -- (-868.714) (-870.435) (-868.789) [-868.588] * (-869.522) (-868.958) (-873.645) [-870.579] -- 0:00:37
370000 -- (-869.914) (-870.284) [-868.015] (-871.455) * (-869.873) (-868.839) (-868.176) [-869.555] -- 0:00:37
Average standard deviation of split frequencies: 0.009950
370500 -- (-872.927) (-875.535) (-867.862) [-868.325] * [-869.192] (-870.711) (-870.281) (-868.764) -- 0:00:37
371000 -- (-871.470) (-869.718) [-869.332] (-869.297) * (-871.125) [-868.401] (-869.534) (-869.724) -- 0:00:37
371500 -- (-869.100) (-868.585) (-869.324) [-869.450] * (-869.968) (-868.733) (-869.916) [-869.550] -- 0:00:37
372000 -- [-871.177] (-868.277) (-873.646) (-871.814) * (-872.293) [-869.017] (-873.154) (-870.491) -- 0:00:37
372500 -- [-873.219] (-868.431) (-872.343) (-870.843) * (-872.083) [-869.365] (-869.240) (-870.048) -- 0:00:37
373000 -- [-871.917] (-868.901) (-869.320) (-870.446) * (-870.280) [-870.808] (-871.740) (-871.667) -- 0:00:36
373500 -- (-871.764) [-870.487] (-872.589) (-871.519) * (-871.448) [-868.789] (-869.826) (-868.455) -- 0:00:36
374000 -- (-875.109) [-869.828] (-868.054) (-869.119) * (-868.485) (-873.096) (-870.299) [-868.338] -- 0:00:36
374500 -- (-869.514) (-873.298) (-868.101) [-872.426] * (-870.136) (-874.586) [-871.259] (-870.296) -- 0:00:36
375000 -- (-868.725) [-869.514] (-867.972) (-869.804) * [-869.179] (-870.028) (-872.486) (-874.234) -- 0:00:36
Average standard deviation of split frequencies: 0.009809
375500 -- (-869.890) (-869.729) [-868.983] (-870.071) * (-870.916) (-870.989) (-869.605) [-871.691] -- 0:00:36
376000 -- [-869.993] (-869.521) (-870.590) (-873.869) * [-869.584] (-871.204) (-871.143) (-867.780) -- 0:00:36
376500 -- (-868.973) (-869.266) (-871.912) [-869.266] * [-868.572] (-870.434) (-870.453) (-869.797) -- 0:00:36
377000 -- [-870.064] (-873.102) (-870.884) (-870.622) * (-869.520) (-870.318) (-876.697) [-871.803] -- 0:00:36
377500 -- (-867.919) [-868.769] (-870.690) (-870.237) * (-869.523) [-869.362] (-876.973) (-871.162) -- 0:00:37
378000 -- (-869.434) (-870.035) (-873.355) [-871.534] * (-872.667) [-873.610] (-869.619) (-873.056) -- 0:00:37
378500 -- (-871.987) [-870.269] (-870.405) (-870.500) * [-868.634] (-876.488) (-870.088) (-871.200) -- 0:00:37
379000 -- (-870.368) (-869.227) (-869.473) [-871.756] * (-872.443) (-871.811) (-869.764) [-872.191] -- 0:00:37
379500 -- (-868.492) (-869.031) [-870.563] (-870.823) * (-871.814) [-870.574] (-869.883) (-872.059) -- 0:00:37
380000 -- (-870.240) (-868.675) [-868.609] (-874.490) * [-870.435] (-868.698) (-868.972) (-870.470) -- 0:00:37
Average standard deviation of split frequencies: 0.009688
380500 -- [-872.738] (-868.329) (-869.101) (-872.856) * (-877.735) [-869.663] (-868.990) (-872.630) -- 0:00:37
381000 -- (-873.603) (-870.015) (-872.353) [-868.021] * (-873.650) (-869.291) (-870.802) [-868.210] -- 0:00:37
381500 -- [-873.496] (-873.136) (-874.860) (-868.986) * [-869.710] (-871.162) (-869.725) (-870.647) -- 0:00:37
382000 -- (-870.253) (-870.963) [-870.924] (-868.628) * (-868.121) (-872.408) [-870.443] (-870.149) -- 0:00:37
382500 -- [-870.312] (-870.009) (-869.922) (-870.594) * [-870.154] (-870.963) (-868.533) (-871.152) -- 0:00:37
383000 -- (-870.383) (-869.645) [-869.669] (-869.172) * (-868.829) (-870.233) [-870.116] (-869.007) -- 0:00:37
383500 -- (-872.534) (-871.165) [-872.045] (-869.802) * (-870.484) (-868.527) [-868.799] (-872.601) -- 0:00:36
384000 -- (-870.942) (-873.217) [-869.227] (-868.058) * (-872.505) [-869.284] (-868.690) (-869.760) -- 0:00:36
384500 -- (-868.068) (-869.190) (-868.506) [-868.125] * (-869.385) (-869.261) (-869.689) [-869.632] -- 0:00:36
385000 -- (-867.792) [-870.777] (-872.508) (-871.671) * (-870.435) (-869.539) [-870.250] (-872.409) -- 0:00:36
Average standard deviation of split frequencies: 0.009052
385500 -- (-868.796) (-868.419) (-871.176) [-872.473] * (-868.738) (-870.320) [-870.524] (-876.063) -- 0:00:36
386000 -- (-870.635) [-868.370] (-871.543) (-872.308) * (-868.542) (-869.112) (-873.408) [-869.596] -- 0:00:36
386500 -- (-868.605) (-869.061) (-874.822) [-868.764] * (-869.991) (-871.966) [-868.041] (-871.138) -- 0:00:36
387000 -- (-869.171) (-871.085) [-872.625] (-868.954) * (-871.800) [-870.611] (-868.815) (-870.350) -- 0:00:36
387500 -- (-871.382) (-870.660) [-871.263] (-872.389) * [-868.583] (-869.609) (-869.935) (-868.242) -- 0:00:36
388000 -- (-874.799) (-870.034) [-871.000] (-870.911) * [-868.371] (-868.528) (-869.736) (-870.781) -- 0:00:36
388500 -- [-868.984] (-876.200) (-870.616) (-868.504) * (-868.552) (-874.783) (-869.917) [-868.867] -- 0:00:36
389000 -- (-871.589) [-871.760] (-870.673) (-869.438) * (-869.379) (-871.832) (-871.122) [-869.576] -- 0:00:36
389500 -- (-868.573) (-872.190) [-867.932] (-872.544) * (-870.554) [-872.263] (-875.872) (-872.462) -- 0:00:36
390000 -- (-867.998) (-874.908) [-870.480] (-868.424) * (-874.874) (-871.130) (-869.597) [-872.344] -- 0:00:35
Average standard deviation of split frequencies: 0.009298
390500 -- (-871.327) (-870.758) [-868.013] (-869.144) * (-869.150) (-871.052) [-870.639] (-869.029) -- 0:00:35
391000 -- [-871.338] (-871.135) (-869.742) (-870.211) * [-868.019] (-872.470) (-870.491) (-869.621) -- 0:00:35
391500 -- (-872.291) [-869.178] (-869.307) (-868.916) * [-868.897] (-871.008) (-873.555) (-869.215) -- 0:00:35
392000 -- [-869.405] (-870.001) (-875.435) (-869.038) * (-869.008) [-869.612] (-873.943) (-870.715) -- 0:00:35
392500 -- (-870.316) (-871.897) [-872.256] (-869.975) * (-869.034) (-867.960) [-870.347] (-871.883) -- 0:00:35
393000 -- (-871.183) (-872.939) (-871.287) [-870.292] * [-870.117] (-868.529) (-869.569) (-871.094) -- 0:00:35
393500 -- (-868.471) (-871.266) (-870.325) [-868.264] * [-871.336] (-871.053) (-872.119) (-868.889) -- 0:00:35
394000 -- [-868.471] (-869.214) (-877.130) (-868.626) * (-869.035) (-872.194) (-872.684) [-868.530] -- 0:00:36
394500 -- (-868.609) (-869.623) [-869.178] (-869.749) * [-869.424] (-869.352) (-871.387) (-872.188) -- 0:00:36
395000 -- (-868.168) (-873.255) (-870.827) [-870.226] * (-871.923) (-871.285) (-872.722) [-868.146] -- 0:00:36
Average standard deviation of split frequencies: 0.008482
395500 -- (-868.727) [-870.596] (-874.434) (-872.623) * (-870.332) (-873.773) (-871.762) [-868.604] -- 0:00:36
396000 -- (-870.128) (-871.795) [-869.022] (-870.693) * (-868.623) (-873.378) [-869.184] (-869.670) -- 0:00:36
396500 -- [-872.048] (-872.577) (-872.605) (-872.645) * (-873.887) (-874.811) (-872.139) [-868.242] -- 0:00:36
397000 -- (-873.351) [-870.537] (-869.805) (-872.733) * [-873.632] (-868.992) (-870.429) (-871.940) -- 0:00:36
397500 -- (-870.543) (-872.522) (-871.669) [-868.936] * (-867.951) (-870.082) [-870.298] (-871.160) -- 0:00:36
398000 -- (-868.944) (-872.331) (-870.549) [-870.983] * (-869.720) (-869.119) (-870.819) [-868.709] -- 0:00:36
398500 -- (-871.339) (-870.912) [-870.547] (-871.012) * (-869.628) [-869.391] (-875.349) (-873.696) -- 0:00:36
399000 -- (-873.701) [-871.138] (-868.469) (-870.559) * (-869.234) (-874.416) (-868.156) [-870.146] -- 0:00:36
399500 -- (-868.987) [-871.762] (-869.966) (-869.511) * [-869.380] (-872.237) (-868.997) (-869.828) -- 0:00:36
400000 -- (-869.945) [-868.311] (-868.140) (-872.616) * (-871.477) (-870.333) (-868.584) [-869.760] -- 0:00:36
Average standard deviation of split frequencies: 0.008604
400500 -- (-869.506) (-869.399) [-869.738] (-871.089) * (-871.036) (-871.979) (-870.230) [-869.889] -- 0:00:35
401000 -- (-870.151) (-869.418) [-868.982] (-869.704) * (-869.959) [-870.308] (-870.195) (-871.473) -- 0:00:35
401500 -- [-868.982] (-868.817) (-871.946) (-869.588) * (-872.115) (-870.324) [-870.745] (-874.977) -- 0:00:35
402000 -- (-869.693) (-869.310) (-871.864) [-869.622] * (-871.615) (-868.911) (-869.423) [-872.557] -- 0:00:35
402500 -- [-868.861] (-868.980) (-870.717) (-868.904) * (-869.103) (-869.069) (-875.509) [-874.246] -- 0:00:35
403000 -- [-869.592] (-869.343) (-881.074) (-868.825) * (-873.079) (-873.526) (-871.770) [-871.230] -- 0:00:35
403500 -- (-869.133) [-871.766] (-869.484) (-868.363) * (-872.424) (-871.643) (-870.458) [-871.435] -- 0:00:35
404000 -- (-871.083) (-868.933) (-869.781) [-869.520] * [-870.476] (-870.387) (-868.645) (-875.677) -- 0:00:35
404500 -- (-874.751) (-869.964) [-869.272] (-870.061) * (-870.646) (-873.568) (-869.052) [-872.346] -- 0:00:35
405000 -- (-870.544) (-868.273) [-869.069] (-868.724) * (-870.090) (-868.451) (-870.119) [-869.235] -- 0:00:35
Average standard deviation of split frequencies: 0.007586
405500 -- (-872.151) (-869.448) [-869.392] (-870.623) * (-869.810) (-869.601) [-868.774] (-869.170) -- 0:00:35
406000 -- (-868.004) (-868.990) [-869.949] (-868.708) * (-868.817) (-870.643) [-868.632] (-873.093) -- 0:00:35
406500 -- (-868.986) (-867.998) [-869.359] (-869.103) * (-870.233) [-870.225] (-872.752) (-873.277) -- 0:00:35
407000 -- (-868.391) [-868.113] (-870.130) (-868.876) * (-869.939) (-869.616) [-873.467] (-870.268) -- 0:00:34
407500 -- [-869.520] (-869.235) (-870.404) (-869.150) * [-869.621] (-868.356) (-869.811) (-869.792) -- 0:00:34
408000 -- (-872.445) (-876.671) [-870.397] (-872.304) * (-869.603) (-868.594) [-870.061] (-870.013) -- 0:00:34
408500 -- (-869.625) (-869.830) [-868.712] (-870.092) * [-868.893] (-870.552) (-869.739) (-870.025) -- 0:00:34
409000 -- (-868.326) (-869.490) [-869.604] (-869.031) * (-870.898) (-870.497) [-870.513] (-872.027) -- 0:00:34
409500 -- (-869.781) (-872.685) [-869.980] (-868.592) * (-868.401) (-870.335) (-874.035) [-870.966] -- 0:00:34
410000 -- (-872.087) (-873.530) (-869.339) [-869.209] * [-868.508] (-870.887) (-873.793) (-870.257) -- 0:00:34
Average standard deviation of split frequencies: 0.007959
410500 -- (-868.494) (-869.772) (-868.522) [-869.379] * (-868.757) [-869.645] (-869.370) (-872.815) -- 0:00:35
411000 -- (-868.261) [-870.651] (-869.792) (-871.088) * (-874.976) (-870.568) (-874.077) [-870.051] -- 0:00:35
411500 -- [-868.244] (-871.239) (-869.316) (-868.406) * [-873.222] (-868.044) (-872.941) (-871.477) -- 0:00:35
412000 -- (-873.242) (-872.573) (-870.016) [-869.289] * (-875.157) (-869.910) [-871.947] (-870.624) -- 0:00:35
412500 -- (-868.777) (-869.858) (-872.349) [-869.359] * [-869.647] (-870.481) (-872.929) (-870.436) -- 0:00:35
413000 -- [-874.365] (-871.959) (-872.762) (-869.208) * [-870.291] (-868.442) (-871.668) (-869.003) -- 0:00:35
413500 -- (-869.553) [-870.834] (-872.071) (-868.650) * (-869.907) (-868.749) [-868.301] (-872.757) -- 0:00:35
414000 -- (-868.586) (-872.149) (-868.083) [-869.020] * (-868.588) [-869.863] (-872.082) (-869.876) -- 0:00:35
414500 -- (-870.652) (-872.762) [-870.476] (-869.942) * (-868.628) (-870.114) [-868.544] (-871.963) -- 0:00:35
415000 -- [-869.068] (-870.454) (-871.034) (-872.292) * (-869.348) (-869.145) (-869.077) [-870.057] -- 0:00:35
Average standard deviation of split frequencies: 0.008083
415500 -- (-868.809) (-870.042) (-873.303) [-871.614] * [-868.432] (-868.356) (-870.695) (-871.444) -- 0:00:35
416000 -- (-871.506) (-869.799) (-868.784) [-870.063] * (-867.993) (-869.086) (-869.300) [-870.414] -- 0:00:35
416500 -- (-873.334) (-870.505) [-872.796] (-871.012) * (-867.983) (-870.277) [-870.190] (-870.969) -- 0:00:35
417000 -- (-871.648) (-874.314) (-870.040) [-873.856] * (-867.958) (-873.287) (-869.032) [-869.485] -- 0:00:34
417500 -- (-870.274) [-873.235] (-870.257) (-875.089) * [-870.786] (-871.448) (-868.779) (-872.268) -- 0:00:34
418000 -- [-867.968] (-876.977) (-869.413) (-869.147) * (-868.249) (-870.802) (-868.697) [-869.901] -- 0:00:34
418500 -- [-869.232] (-874.028) (-870.000) (-869.157) * (-868.347) [-869.341] (-868.827) (-871.111) -- 0:00:34
419000 -- (-870.652) (-872.121) (-871.875) [-871.684] * (-869.301) (-870.420) (-869.240) [-871.061] -- 0:00:34
419500 -- (-874.902) (-870.258) (-871.984) [-871.314] * (-869.809) (-869.948) [-869.201] (-868.670) -- 0:00:34
420000 -- (-871.731) (-873.857) (-874.746) [-874.875] * [-874.355] (-867.975) (-869.090) (-871.925) -- 0:00:34
Average standard deviation of split frequencies: 0.008442
420500 -- (-868.629) [-878.398] (-870.170) (-870.038) * (-871.394) (-867.795) [-870.863] (-869.299) -- 0:00:34
421000 -- (-868.910) (-873.476) (-871.659) [-868.439] * [-869.069] (-869.482) (-868.775) (-869.776) -- 0:00:34
421500 -- [-869.506] (-871.196) (-870.044) (-868.757) * [-868.272] (-870.849) (-871.347) (-868.491) -- 0:00:34
422000 -- (-869.544) [-870.570] (-869.958) (-870.811) * (-869.321) [-871.181] (-870.722) (-869.671) -- 0:00:34
422500 -- [-874.665] (-872.532) (-869.518) (-871.979) * [-869.023] (-870.197) (-868.193) (-868.836) -- 0:00:34
423000 -- (-870.267) [-869.176] (-869.975) (-869.078) * (-870.386) (-869.821) (-873.171) [-869.302] -- 0:00:34
423500 -- [-869.245] (-873.335) (-873.511) (-871.394) * (-870.378) (-869.829) (-872.717) [-871.126] -- 0:00:34
424000 -- (-868.889) [-868.758] (-869.067) (-873.525) * (-870.303) (-871.978) (-869.897) [-870.681] -- 0:00:33
424500 -- [-868.752] (-871.326) (-868.886) (-872.138) * (-869.242) (-870.974) [-867.931] (-868.691) -- 0:00:33
425000 -- (-870.856) (-871.202) [-870.920] (-872.722) * (-872.882) (-871.909) [-867.931] (-868.962) -- 0:00:33
Average standard deviation of split frequencies: 0.009738
425500 -- (-871.546) [-869.792] (-869.754) (-871.880) * [-873.769] (-868.967) (-868.644) (-876.153) -- 0:00:33
426000 -- [-873.491] (-872.076) (-871.432) (-869.247) * (-869.860) [-869.909] (-868.481) (-872.816) -- 0:00:33
426500 -- (-870.962) [-869.935] (-868.209) (-868.964) * (-868.974) [-873.870] (-869.865) (-869.443) -- 0:00:33
427000 -- (-874.381) (-874.803) [-868.572] (-868.220) * [-869.152] (-870.606) (-869.066) (-870.272) -- 0:00:33
427500 -- (-870.356) (-869.165) (-873.047) [-869.408] * (-870.070) [-867.836] (-868.687) (-869.276) -- 0:00:34
428000 -- (-869.090) [-870.395] (-872.354) (-869.470) * (-868.996) (-869.489) (-868.783) [-868.016] -- 0:00:34
428500 -- [-870.700] (-871.446) (-873.776) (-870.599) * (-869.315) (-869.711) (-868.746) [-868.710] -- 0:00:34
429000 -- [-870.533] (-870.779) (-873.674) (-874.085) * (-868.568) (-870.210) [-869.479] (-875.060) -- 0:00:34
429500 -- (-869.519) (-874.449) (-871.544) [-868.538] * (-868.449) [-868.530] (-872.243) (-872.293) -- 0:00:34
430000 -- (-873.280) (-873.308) [-869.309] (-870.180) * (-869.271) [-868.547] (-875.736) (-873.281) -- 0:00:34
Average standard deviation of split frequencies: 0.008538
430500 -- (-869.208) (-869.051) [-869.305] (-869.321) * (-873.059) (-869.787) (-870.812) [-872.189] -- 0:00:34
431000 -- (-871.437) (-871.716) [-868.574] (-868.525) * (-871.980) (-869.452) (-868.774) [-873.281] -- 0:00:34
431500 -- (-869.724) (-869.821) (-868.400) [-869.706] * [-869.078] (-871.638) (-869.450) (-874.449) -- 0:00:34
432000 -- (-867.857) (-868.579) (-869.267) [-870.291] * (-872.357) (-871.989) (-871.316) [-868.925] -- 0:00:34
432500 -- (-871.253) (-869.561) (-869.822) [-872.679] * (-870.141) (-870.899) (-871.147) [-869.384] -- 0:00:34
433000 -- (-873.825) (-873.180) (-870.740) [-868.237] * (-870.992) (-872.432) (-869.753) [-871.726] -- 0:00:34
433500 -- (-872.060) [-874.351] (-870.660) (-870.990) * (-871.951) [-870.820] (-870.755) (-873.936) -- 0:00:33
434000 -- [-868.539] (-870.844) (-869.221) (-870.004) * (-868.763) (-869.810) (-871.640) [-869.346] -- 0:00:33
434500 -- (-868.667) (-875.804) (-869.901) [-873.232] * (-869.850) [-868.950] (-871.018) (-870.156) -- 0:00:33
435000 -- (-868.695) [-873.249] (-869.917) (-873.489) * (-869.227) [-870.861] (-872.119) (-868.444) -- 0:00:33
Average standard deviation of split frequencies: 0.008578
435500 -- [-870.658] (-870.293) (-870.606) (-872.484) * (-868.740) [-869.930] (-869.788) (-868.994) -- 0:00:33
436000 -- (-872.446) [-868.906] (-868.415) (-870.923) * [-869.075] (-872.034) (-869.821) (-870.532) -- 0:00:33
436500 -- (-869.331) [-876.160] (-868.828) (-873.986) * (-867.930) [-868.903] (-868.179) (-871.802) -- 0:00:33
437000 -- (-869.839) [-869.507] (-871.583) (-873.907) * [-868.324] (-870.278) (-871.093) (-868.372) -- 0:00:33
437500 -- (-871.909) (-874.176) [-873.018] (-869.912) * (-869.107) [-868.349] (-870.087) (-873.160) -- 0:00:33
438000 -- [-869.919] (-871.581) (-872.277) (-869.684) * [-869.307] (-871.771) (-869.354) (-870.712) -- 0:00:33
438500 -- [-868.814] (-868.438) (-872.229) (-869.510) * (-872.635) (-871.263) [-869.401] (-869.188) -- 0:00:33
439000 -- (-868.345) [-869.354] (-869.639) (-869.553) * (-869.721) [-868.951] (-869.939) (-869.467) -- 0:00:33
439500 -- [-870.813] (-869.231) (-868.265) (-870.041) * (-869.883) (-869.106) (-868.373) [-869.519] -- 0:00:33
440000 -- (-869.618) [-867.864] (-868.381) (-867.957) * [-868.087] (-871.516) (-872.034) (-871.726) -- 0:00:33
Average standard deviation of split frequencies: 0.008629
440500 -- (-874.740) (-868.680) [-869.454] (-871.858) * (-869.626) (-868.854) (-869.133) [-871.770] -- 0:00:33
441000 -- (-868.781) [-867.967] (-871.655) (-871.765) * [-869.283] (-869.143) (-869.615) (-869.468) -- 0:00:32
441500 -- [-868.655] (-868.097) (-869.484) (-869.653) * (-868.075) (-871.360) (-873.932) [-868.601] -- 0:00:32
442000 -- (-868.426) (-871.245) (-870.681) [-868.456] * (-870.366) (-870.615) [-871.723] (-871.201) -- 0:00:32
442500 -- (-869.978) (-871.041) [-870.519] (-868.733) * (-869.210) [-869.478] (-872.462) (-868.556) -- 0:00:32
443000 -- (-870.540) [-867.774] (-870.772) (-869.805) * (-869.342) (-869.745) (-871.651) [-871.617] -- 0:00:32
443500 -- (-872.012) [-869.031] (-868.925) (-870.158) * [-870.039] (-868.263) (-869.382) (-868.953) -- 0:00:32
444000 -- [-868.476] (-869.783) (-870.156) (-869.225) * (-868.981) (-872.202) [-870.455] (-870.547) -- 0:00:33
444500 -- (-872.039) (-872.057) (-870.977) [-868.786] * (-873.123) (-872.250) [-870.690] (-869.014) -- 0:00:33
445000 -- (-868.048) [-869.193] (-872.535) (-868.604) * [-869.095] (-871.233) (-873.714) (-870.682) -- 0:00:33
Average standard deviation of split frequencies: 0.009019
445500 -- [-869.019] (-871.894) (-872.183) (-868.797) * (-870.410) (-870.209) (-871.112) [-870.894] -- 0:00:33
446000 -- (-868.413) (-870.934) [-869.309] (-870.766) * (-872.587) (-869.132) (-870.024) [-869.686] -- 0:00:33
446500 -- (-869.177) (-870.026) (-869.912) [-873.428] * [-869.917] (-873.290) (-870.372) (-867.762) -- 0:00:33
447000 -- [-869.104] (-870.233) (-869.426) (-872.848) * (-870.263) (-872.985) (-872.956) [-868.674] -- 0:00:33
447500 -- (-871.453) (-874.874) [-869.046] (-869.229) * (-869.622) (-873.547) (-868.791) [-869.787] -- 0:00:33
448000 -- [-869.460] (-868.894) (-875.450) (-869.704) * [-868.162] (-871.866) (-869.495) (-870.352) -- 0:00:33
448500 -- (-873.167) (-870.905) [-871.157] (-869.860) * (-872.501) (-870.795) [-868.828] (-869.639) -- 0:00:33
449000 -- (-871.154) (-872.297) [-870.779] (-869.315) * (-870.220) [-872.593] (-868.692) (-870.089) -- 0:00:33
449500 -- (-872.171) (-868.941) [-868.726] (-868.224) * (-870.380) [-871.296] (-873.031) (-869.999) -- 0:00:33
450000 -- (-871.288) (-868.901) [-869.048] (-868.300) * (-869.957) (-872.800) (-870.916) [-871.353] -- 0:00:33
Average standard deviation of split frequencies: 0.009763
450500 -- (-869.035) (-869.243) (-869.205) [-870.361] * (-868.239) (-874.812) (-868.907) [-870.784] -- 0:00:32
451000 -- (-869.696) (-869.117) (-871.577) [-870.326] * (-868.426) [-870.721] (-870.856) (-870.787) -- 0:00:32
451500 -- (-869.552) (-871.987) (-869.662) [-871.555] * (-868.179) (-869.749) [-870.595] (-870.160) -- 0:00:32
452000 -- [-869.584] (-875.135) (-870.432) (-871.920) * [-867.870] (-869.313) (-868.032) (-871.658) -- 0:00:32
452500 -- (-868.299) (-870.957) (-871.607) [-869.934] * (-870.135) [-868.632] (-873.473) (-871.194) -- 0:00:32
453000 -- (-869.750) (-868.657) [-869.788] (-871.222) * (-871.822) (-868.014) (-869.469) [-869.181] -- 0:00:32
453500 -- (-870.075) (-868.982) (-872.597) [-867.815] * (-867.794) (-868.644) (-870.624) [-868.368] -- 0:00:32
454000 -- (-869.371) [-869.057] (-870.063) (-871.823) * (-872.629) [-868.643] (-872.927) (-868.432) -- 0:00:32
454500 -- (-873.148) [-867.896] (-869.131) (-877.406) * [-868.848] (-869.141) (-871.201) (-868.655) -- 0:00:32
455000 -- (-870.498) (-869.005) (-869.375) [-870.176] * (-870.250) [-869.405] (-869.115) (-873.349) -- 0:00:32
Average standard deviation of split frequencies: 0.009993
455500 -- [-870.918] (-868.170) (-868.962) (-868.086) * [-867.883] (-869.138) (-869.239) (-869.245) -- 0:00:32
456000 -- (-869.236) (-870.644) [-868.190] (-868.959) * (-872.408) (-872.289) [-868.492] (-868.334) -- 0:00:32
456500 -- [-869.996] (-872.179) (-871.256) (-872.764) * [-870.893] (-869.014) (-873.280) (-869.123) -- 0:00:32
457000 -- [-870.636] (-869.452) (-870.116) (-871.421) * (-874.685) (-869.633) [-877.371] (-868.276) -- 0:00:32
457500 -- (-871.492) (-870.428) [-870.164] (-868.417) * [-868.015] (-870.503) (-873.208) (-870.924) -- 0:00:32
458000 -- [-868.779] (-868.621) (-871.747) (-868.249) * [-869.749] (-869.802) (-871.087) (-874.270) -- 0:00:31
458500 -- [-869.814] (-868.164) (-870.049) (-869.962) * [-872.985] (-870.501) (-868.802) (-876.098) -- 0:00:31
459000 -- (-869.274) (-869.654) [-873.901] (-869.618) * [-873.011] (-874.064) (-869.674) (-873.439) -- 0:00:31
459500 -- [-870.335] (-872.519) (-875.119) (-872.767) * [-869.898] (-872.837) (-869.125) (-871.412) -- 0:00:31
460000 -- (-869.617) (-870.157) [-870.834] (-873.277) * (-871.774) (-870.707) [-868.142] (-871.381) -- 0:00:31
Average standard deviation of split frequencies: 0.010233
460500 -- (-873.262) [-868.961] (-869.855) (-869.739) * (-870.867) [-868.483] (-869.073) (-869.284) -- 0:00:31
461000 -- (-868.698) (-868.644) (-869.687) [-871.495] * (-868.915) (-871.256) (-870.771) [-869.019] -- 0:00:32
461500 -- (-872.852) (-868.658) [-868.415] (-873.680) * [-868.979] (-871.857) (-872.119) (-872.227) -- 0:00:32
462000 -- [-869.280] (-868.045) (-870.503) (-872.134) * (-869.356) [-874.024] (-875.246) (-870.539) -- 0:00:32
462500 -- (-869.626) (-868.796) (-872.266) [-869.755] * (-868.669) (-870.887) (-874.380) [-871.709] -- 0:00:32
463000 -- (-870.470) [-869.654] (-870.543) (-870.413) * (-869.047) (-871.519) (-868.321) [-869.487] -- 0:00:32
463500 -- (-870.228) (-871.670) (-872.589) [-869.857] * (-869.047) (-872.377) (-869.322) [-872.731] -- 0:00:32
464000 -- [-869.564] (-869.750) (-869.395) (-870.136) * (-873.567) (-870.820) [-867.985] (-871.925) -- 0:00:32
464500 -- (-870.504) (-872.376) (-872.782) [-868.559] * (-871.621) (-868.821) (-869.249) [-874.637] -- 0:00:32
465000 -- [-870.335] (-870.297) (-869.915) (-870.106) * [-869.449] (-868.963) (-871.268) (-874.557) -- 0:00:32
Average standard deviation of split frequencies: 0.010588
465500 -- (-869.173) (-873.118) (-869.926) [-868.890] * (-871.190) [-869.431] (-870.623) (-871.108) -- 0:00:32
466000 -- (-871.806) (-868.501) (-871.088) [-871.629] * (-871.496) (-873.163) (-870.921) [-869.755] -- 0:00:32
466500 -- [-870.095] (-868.458) (-871.077) (-872.648) * [-869.734] (-873.590) (-870.491) (-869.778) -- 0:00:32
467000 -- [-873.477] (-868.698) (-871.377) (-870.386) * (-869.142) [-871.604] (-871.053) (-873.817) -- 0:00:31
467500 -- (-871.327) [-870.769] (-871.023) (-868.347) * (-868.119) (-870.062) (-869.059) [-868.790] -- 0:00:31
468000 -- (-869.424) (-874.872) (-869.353) [-869.415] * [-868.809] (-869.716) (-868.597) (-868.931) -- 0:00:31
468500 -- (-869.224) [-868.440] (-869.353) (-870.762) * (-869.310) (-872.814) (-870.637) [-869.214] -- 0:00:31
469000 -- (-869.606) [-869.006] (-868.425) (-871.061) * (-869.171) (-872.804) (-869.913) [-870.977] -- 0:00:31
469500 -- [-872.000] (-870.876) (-868.710) (-868.328) * (-871.317) (-872.050) [-869.183] (-869.164) -- 0:00:31
470000 -- (-870.552) (-870.457) [-868.874] (-870.122) * (-869.704) [-870.764] (-869.344) (-869.475) -- 0:00:31
Average standard deviation of split frequencies: 0.010950
470500 -- [-869.450] (-869.807) (-876.384) (-871.931) * (-870.103) [-874.393] (-870.113) (-869.695) -- 0:00:31
471000 -- (-870.202) (-871.889) (-873.519) [-868.608] * (-870.135) (-868.953) (-872.898) [-868.609] -- 0:00:31
471500 -- (-875.418) (-872.343) [-870.211] (-869.957) * (-871.465) (-869.509) (-871.688) [-869.220] -- 0:00:31
472000 -- (-873.168) (-867.978) [-869.779] (-869.965) * (-871.475) (-870.378) (-871.039) [-870.354] -- 0:00:31
472500 -- (-875.174) (-870.485) (-871.971) [-868.355] * [-869.187] (-872.395) (-871.816) (-868.427) -- 0:00:31
473000 -- (-872.399) [-870.386] (-873.188) (-869.229) * (-869.900) (-869.381) (-867.774) [-869.095] -- 0:00:31
473500 -- (-877.583) [-871.145] (-869.246) (-868.047) * (-869.232) (-868.677) [-869.676] (-871.310) -- 0:00:31
474000 -- (-875.516) (-868.737) [-869.364] (-868.255) * (-869.090) (-870.798) (-870.994) [-870.206] -- 0:00:31
474500 -- (-873.317) (-871.470) [-871.185] (-871.082) * (-870.426) [-871.662] (-871.444) (-868.797) -- 0:00:31
475000 -- (-871.186) (-874.191) [-869.028] (-869.064) * (-869.724) (-868.540) (-870.182) [-870.090] -- 0:00:30
Average standard deviation of split frequencies: 0.011224
475500 -- (-870.394) (-870.304) (-868.702) [-868.442] * (-870.476) (-868.584) (-868.429) [-872.918] -- 0:00:30
476000 -- [-868.273] (-872.496) (-868.743) (-869.462) * (-868.033) [-870.824] (-869.369) (-873.058) -- 0:00:30
476500 -- (-869.023) [-869.798] (-868.587) (-871.662) * [-868.464] (-871.026) (-871.173) (-869.224) -- 0:00:30
477000 -- (-874.692) [-868.980] (-870.066) (-873.189) * (-868.001) [-872.217] (-868.599) (-868.916) -- 0:00:30
477500 -- (-868.996) (-871.554) [-869.490] (-873.694) * (-869.241) (-869.014) (-869.372) [-870.006] -- 0:00:30
478000 -- (-871.383) (-870.717) (-871.637) [-872.132] * (-871.840) [-869.794] (-868.603) (-868.485) -- 0:00:31
478500 -- (-871.195) (-869.484) (-869.954) [-869.483] * (-871.054) [-872.004] (-870.404) (-868.865) -- 0:00:31
479000 -- (-870.741) (-871.021) [-868.408] (-871.293) * (-874.524) (-868.548) [-870.427] (-869.011) -- 0:00:31
479500 -- [-872.850] (-874.842) (-868.586) (-869.928) * (-869.191) [-868.594] (-869.301) (-869.003) -- 0:00:31
480000 -- (-869.273) (-874.823) (-870.094) [-868.410] * [-868.617] (-868.281) (-870.461) (-872.389) -- 0:00:31
Average standard deviation of split frequencies: 0.010592
480500 -- (-869.772) [-868.431] (-873.033) (-870.786) * [-869.219] (-873.034) (-869.220) (-873.882) -- 0:00:31
481000 -- [-870.682] (-868.593) (-868.670) (-870.204) * (-869.488) (-870.214) (-868.925) [-873.441] -- 0:00:31
481500 -- (-872.352) (-878.006) [-868.437] (-874.014) * (-868.883) (-870.730) [-868.171] (-869.021) -- 0:00:31
482000 -- (-869.367) (-870.095) (-868.997) [-868.689] * (-870.772) (-870.620) (-868.466) [-868.215] -- 0:00:31
482500 -- (-872.516) [-870.182] (-870.003) (-868.652) * [-874.701] (-870.050) (-871.087) (-872.752) -- 0:00:31
483000 -- (-873.500) [-868.907] (-869.461) (-868.332) * [-869.800] (-873.388) (-871.484) (-874.077) -- 0:00:31
483500 -- [-872.853] (-868.959) (-870.808) (-870.980) * (-872.171) (-878.207) (-871.339) [-869.805] -- 0:00:30
484000 -- (-869.302) [-869.768] (-869.512) (-871.516) * (-871.158) [-873.008] (-870.812) (-868.129) -- 0:00:30
484500 -- (-868.166) (-870.662) (-871.124) [-869.503] * (-870.582) (-867.825) [-869.365] (-869.128) -- 0:00:30
485000 -- [-870.472] (-871.494) (-873.131) (-872.997) * [-868.812] (-869.304) (-868.182) (-872.590) -- 0:00:30
Average standard deviation of split frequencies: 0.010217
485500 -- (-871.504) [-871.184] (-870.856) (-871.200) * (-868.404) (-870.933) (-868.890) [-872.690] -- 0:00:30
486000 -- (-868.598) (-869.309) (-871.583) [-869.511] * [-868.459] (-870.589) (-868.415) (-870.321) -- 0:00:30
486500 -- (-868.260) [-869.375] (-873.449) (-872.786) * (-872.077) [-869.007] (-870.038) (-868.595) -- 0:00:30
487000 -- [-868.543] (-869.692) (-872.195) (-868.377) * (-870.732) [-869.237] (-870.324) (-870.281) -- 0:00:30
487500 -- (-869.072) (-868.819) (-876.534) [-871.796] * (-869.000) (-874.806) [-871.178] (-874.401) -- 0:00:30
488000 -- (-870.351) (-871.369) (-869.164) [-870.035] * (-869.541) (-868.655) [-868.646] (-872.976) -- 0:00:30
488500 -- (-871.045) (-869.322) [-868.913] (-870.952) * (-868.502) (-871.097) [-868.137] (-872.364) -- 0:00:30
489000 -- (-873.154) (-871.489) [-869.056] (-871.296) * [-869.861] (-868.214) (-869.168) (-868.657) -- 0:00:30
489500 -- (-873.632) (-872.236) [-870.143] (-872.594) * [-874.217] (-875.194) (-871.157) (-868.144) -- 0:00:30
490000 -- [-870.159] (-869.399) (-871.150) (-873.714) * (-869.038) (-872.013) [-870.159] (-868.070) -- 0:00:30
Average standard deviation of split frequencies: 0.010120
490500 -- [-869.011] (-869.383) (-871.115) (-868.310) * (-869.218) (-873.244) [-869.116] (-868.970) -- 0:00:30
491000 -- [-869.947] (-870.630) (-868.993) (-870.571) * (-869.994) [-870.341] (-870.355) (-869.519) -- 0:00:30
491500 -- (-869.750) [-870.426] (-869.551) (-871.569) * (-868.621) [-871.467] (-868.953) (-870.792) -- 0:00:30
492000 -- (-870.114) (-871.549) [-868.992] (-868.456) * (-871.317) (-868.589) [-871.359] (-871.234) -- 0:00:29
492500 -- (-867.906) (-872.456) (-868.334) [-868.413] * (-870.002) [-869.543] (-877.335) (-869.614) -- 0:00:29
493000 -- (-868.349) (-873.066) (-870.369) [-869.383] * [-871.859] (-871.074) (-872.481) (-869.480) -- 0:00:29
493500 -- (-869.008) (-870.492) [-871.432] (-871.707) * (-870.734) (-873.500) [-872.887] (-869.295) -- 0:00:29
494000 -- (-870.111) (-868.088) (-867.884) [-868.450] * (-870.303) (-871.714) (-876.731) [-869.369] -- 0:00:29
494500 -- (-869.081) (-867.939) (-868.002) [-868.439] * [-872.429] (-870.062) (-874.634) (-868.894) -- 0:00:30
495000 -- (-870.099) [-868.889] (-870.063) (-869.619) * (-872.163) (-871.066) [-869.588] (-873.355) -- 0:00:30
Average standard deviation of split frequencies: 0.010391
495500 -- [-868.640] (-872.580) (-869.580) (-869.878) * (-872.023) (-872.087) [-868.406] (-871.145) -- 0:00:30
496000 -- (-870.431) (-869.943) [-868.718] (-868.713) * (-871.216) (-869.548) [-871.115] (-868.528) -- 0:00:30
496500 -- (-869.610) (-868.015) (-870.763) [-868.336] * (-868.362) [-868.547] (-870.407) (-870.837) -- 0:00:30
497000 -- [-868.595] (-871.212) (-873.094) (-873.296) * (-868.969) (-869.059) [-872.334] (-870.908) -- 0:00:30
497500 -- (-870.435) (-867.941) (-870.774) [-868.313] * (-868.080) [-872.159] (-869.043) (-869.093) -- 0:00:30
498000 -- (-868.390) [-869.679] (-870.215) (-868.938) * (-873.549) (-868.050) (-868.585) [-870.561] -- 0:00:30
498500 -- (-868.781) (-873.634) [-869.736] (-871.014) * (-872.423) (-868.435) [-869.452] (-870.040) -- 0:00:30
499000 -- (-871.053) (-879.412) (-869.833) [-869.791] * (-876.086) (-869.176) [-868.561] (-869.187) -- 0:00:30
499500 -- (-871.634) (-870.826) (-870.231) [-869.221] * (-870.362) (-870.332) [-871.136] (-869.624) -- 0:00:30
500000 -- (-869.168) (-870.338) (-872.785) [-868.519] * (-869.022) (-871.145) [-874.010] (-869.540) -- 0:00:30
Average standard deviation of split frequencies: 0.010106
500500 -- [-870.388] (-870.272) (-871.210) (-870.868) * (-869.714) [-868.359] (-869.666) (-868.192) -- 0:00:29
501000 -- (-873.120) [-870.509] (-872.366) (-870.371) * (-871.000) (-870.899) [-869.542] (-868.679) -- 0:00:29
501500 -- (-869.145) [-869.831] (-871.625) (-872.226) * (-871.609) [-871.276] (-875.542) (-868.317) -- 0:00:29
502000 -- (-869.644) [-872.088] (-870.972) (-868.755) * [-868.261] (-870.700) (-872.506) (-869.511) -- 0:00:29
502500 -- (-870.705) (-870.717) (-871.048) [-869.375] * (-870.372) (-868.219) [-870.499] (-871.332) -- 0:00:29
503000 -- [-869.312] (-870.319) (-870.301) (-875.621) * (-870.921) [-869.688] (-868.563) (-869.215) -- 0:00:29
503500 -- (-870.823) (-870.752) (-875.917) [-868.789] * (-869.936) (-868.618) (-868.573) [-870.194] -- 0:00:29
504000 -- [-869.987] (-871.080) (-869.951) (-868.422) * (-867.931) (-872.002) [-869.653] (-871.239) -- 0:00:29
504500 -- (-869.987) [-872.458] (-869.460) (-868.447) * (-869.658) (-870.134) [-868.937] (-869.595) -- 0:00:29
505000 -- [-869.534] (-869.784) (-872.168) (-869.424) * [-869.252] (-871.096) (-871.670) (-870.242) -- 0:00:29
Average standard deviation of split frequencies: 0.010364
505500 -- (-870.366) [-867.667] (-871.568) (-869.404) * [-869.561] (-871.303) (-874.904) (-870.707) -- 0:00:29
506000 -- (-870.529) [-872.771] (-869.992) (-869.265) * (-870.033) (-869.301) (-869.439) [-868.405] -- 0:00:29
506500 -- [-873.021] (-871.753) (-869.883) (-872.481) * (-870.698) [-868.750] (-869.063) (-868.944) -- 0:00:29
507000 -- (-871.159) [-870.926] (-873.135) (-870.166) * (-871.234) [-869.559] (-870.329) (-869.928) -- 0:00:29
507500 -- (-876.684) (-870.203) (-870.525) [-872.713] * [-868.323] (-874.326) (-872.049) (-869.554) -- 0:00:29
508000 -- (-870.077) (-871.888) [-870.934] (-870.155) * [-868.334] (-871.565) (-868.097) (-870.482) -- 0:00:29
508500 -- (-871.331) (-872.842) (-869.701) [-871.501] * (-870.649) [-870.778] (-872.082) (-868.903) -- 0:00:28
509000 -- (-869.040) (-876.977) (-868.907) [-870.656] * (-872.801) [-872.462] (-869.057) (-874.636) -- 0:00:28
509500 -- (-871.156) (-869.040) (-871.025) [-868.882] * [-869.841] (-869.353) (-870.675) (-873.483) -- 0:00:28
510000 -- (-870.342) [-870.619] (-872.498) (-868.816) * (-868.367) (-873.847) [-873.226] (-869.555) -- 0:00:28
Average standard deviation of split frequencies: 0.010647
510500 -- (-869.919) (-875.279) (-875.255) [-870.270] * [-868.792] (-869.874) (-870.593) (-876.126) -- 0:00:28
511000 -- [-870.395] (-872.673) (-873.817) (-873.658) * [-870.922] (-869.964) (-873.677) (-869.254) -- 0:00:29
511500 -- [-869.521] (-871.029) (-870.975) (-869.430) * (-870.563) (-873.693) (-873.941) [-872.129] -- 0:00:29
512000 -- (-870.515) (-874.235) [-871.806] (-872.207) * [-871.707] (-874.549) (-869.533) (-869.514) -- 0:00:29
512500 -- [-870.528] (-872.562) (-870.370) (-871.755) * [-869.680] (-871.273) (-871.582) (-870.837) -- 0:00:29
513000 -- (-869.801) (-867.888) [-870.192] (-869.627) * (-867.933) (-868.188) (-871.727) [-869.828] -- 0:00:29
513500 -- (-870.112) (-869.961) (-869.301) [-869.713] * (-868.375) (-868.197) [-869.088] (-872.596) -- 0:00:29
514000 -- (-868.406) (-869.628) (-869.772) [-869.773] * [-868.886] (-869.409) (-871.151) (-874.752) -- 0:00:29
514500 -- (-869.554) [-869.762] (-869.843) (-870.272) * (-869.764) [-870.520] (-870.530) (-877.458) -- 0:00:29
515000 -- [-869.770] (-870.677) (-869.182) (-875.807) * (-871.825) [-872.435] (-869.712) (-872.774) -- 0:00:29
Average standard deviation of split frequencies: 0.009867
515500 -- [-868.597] (-869.115) (-870.242) (-870.081) * (-869.492) (-872.691) (-871.043) [-871.067] -- 0:00:29
516000 -- (-870.383) (-869.619) (-870.529) [-871.164] * (-868.829) (-878.397) (-872.266) [-871.580] -- 0:00:29
516500 -- [-870.288] (-870.035) (-868.647) (-870.831) * (-869.797) [-868.228] (-872.755) (-868.217) -- 0:00:29
517000 -- [-871.003] (-873.949) (-868.565) (-872.880) * (-870.288) (-869.153) [-869.858] (-868.072) -- 0:00:28
517500 -- (-872.088) (-871.453) [-869.125] (-870.350) * (-874.086) [-871.250] (-870.096) (-870.376) -- 0:00:28
518000 -- (-869.753) (-869.119) [-868.871] (-870.857) * [-868.456] (-868.390) (-869.646) (-868.374) -- 0:00:28
518500 -- (-868.384) (-870.018) (-870.248) [-868.988] * (-871.636) (-868.729) [-869.661] (-869.508) -- 0:00:28
519000 -- (-870.536) (-869.929) (-871.400) [-873.245] * (-872.599) [-869.203] (-870.729) (-872.618) -- 0:00:28
519500 -- (-869.211) [-869.633] (-868.384) (-870.633) * (-869.062) [-868.783] (-872.061) (-872.241) -- 0:00:28
520000 -- [-870.234] (-868.656) (-869.454) (-868.158) * (-868.678) (-869.516) [-872.049] (-871.873) -- 0:00:28
Average standard deviation of split frequencies: 0.010080
520500 -- [-868.511] (-868.720) (-868.545) (-870.300) * [-870.592] (-869.470) (-870.418) (-868.867) -- 0:00:28
521000 -- (-872.429) (-871.669) [-868.475] (-869.913) * (-872.123) [-869.383] (-870.381) (-871.430) -- 0:00:28
521500 -- (-871.616) (-868.593) (-872.510) [-870.010] * (-876.291) (-870.918) [-875.139] (-868.836) -- 0:00:28
522000 -- (-870.046) [-869.870] (-869.595) (-871.317) * (-870.496) [-868.808] (-872.328) (-872.499) -- 0:00:28
522500 -- (-870.320) (-869.878) (-870.199) [-868.874] * [-872.417] (-868.220) (-872.089) (-871.983) -- 0:00:28
523000 -- (-872.291) [-870.126] (-873.925) (-869.258) * (-867.806) (-870.734) (-868.488) [-869.125] -- 0:00:28
523500 -- (-868.038) [-869.264] (-871.740) (-867.877) * (-868.499) (-868.425) [-869.447] (-869.620) -- 0:00:28
524000 -- (-868.622) (-869.493) (-869.699) [-870.152] * [-869.589] (-868.262) (-869.436) (-870.610) -- 0:00:28
524500 -- (-871.048) (-870.718) (-871.147) [-868.248] * (-869.781) [-871.875] (-873.273) (-870.956) -- 0:00:28
525000 -- [-873.600] (-871.240) (-872.978) (-869.012) * (-869.129) (-873.142) [-871.744] (-870.621) -- 0:00:28
Average standard deviation of split frequencies: 0.009679
525500 -- [-873.400] (-868.600) (-876.082) (-869.713) * [-869.006] (-870.028) (-870.593) (-872.173) -- 0:00:27
526000 -- [-872.452] (-870.497) (-871.337) (-868.979) * (-869.604) (-874.313) (-870.515) [-870.505] -- 0:00:27
526500 -- (-872.174) (-868.336) [-872.327] (-871.444) * (-869.952) (-871.872) [-870.302] (-868.797) -- 0:00:27
527000 -- [-874.906] (-870.963) (-869.627) (-869.880) * (-870.357) [-872.292] (-872.858) (-874.063) -- 0:00:27
527500 -- [-868.554] (-871.391) (-869.408) (-868.332) * (-870.457) (-868.130) [-868.195] (-875.082) -- 0:00:27
528000 -- [-868.349] (-870.148) (-871.173) (-870.430) * (-872.865) [-871.746] (-868.432) (-871.837) -- 0:00:28
528500 -- (-871.240) (-868.873) (-873.154) [-868.290] * (-870.951) [-868.890] (-868.631) (-871.270) -- 0:00:28
529000 -- (-869.250) (-870.366) (-869.753) [-868.430] * (-868.034) [-870.425] (-874.331) (-871.201) -- 0:00:28
529500 -- [-871.348] (-870.090) (-868.237) (-869.088) * (-869.580) (-872.125) [-870.542] (-869.842) -- 0:00:28
530000 -- [-870.433] (-872.223) (-870.678) (-868.300) * (-869.957) (-868.647) [-870.123] (-870.492) -- 0:00:28
Average standard deviation of split frequencies: 0.009831
530500 -- (-869.943) [-870.672] (-871.262) (-868.709) * (-869.623) [-872.889] (-869.153) (-870.156) -- 0:00:28
531000 -- (-870.957) (-868.953) (-869.315) [-871.341] * (-872.516) [-868.874] (-871.511) (-869.817) -- 0:00:28
531500 -- (-870.596) [-869.651] (-868.577) (-868.140) * (-870.027) [-870.328] (-870.973) (-868.808) -- 0:00:28
532000 -- [-869.183] (-871.204) (-868.466) (-870.474) * [-868.698] (-869.964) (-869.350) (-870.179) -- 0:00:28
532500 -- (-872.157) (-873.903) (-871.208) [-868.893] * (-871.635) (-869.696) [-869.154] (-868.507) -- 0:00:28
533000 -- [-871.595] (-869.937) (-868.723) (-868.766) * (-874.733) (-868.338) (-869.032) [-870.145] -- 0:00:28
533500 -- [-871.030] (-872.031) (-868.106) (-868.473) * (-871.049) [-868.794] (-869.838) (-868.536) -- 0:00:27
534000 -- [-869.769] (-870.150) (-870.230) (-873.660) * (-869.857) (-869.019) [-871.753] (-870.406) -- 0:00:27
534500 -- (-868.940) (-869.348) [-868.876] (-869.625) * [-868.578] (-869.093) (-869.942) (-870.035) -- 0:00:27
535000 -- [-868.047] (-871.066) (-868.375) (-867.998) * (-868.490) (-870.192) (-869.281) [-869.502] -- 0:00:27
Average standard deviation of split frequencies: 0.009909
535500 -- [-870.632] (-870.926) (-869.349) (-871.102) * (-869.394) (-870.279) [-867.843] (-869.024) -- 0:00:27
536000 -- (-871.075) (-870.459) [-873.846] (-870.096) * (-869.807) (-870.732) [-868.865] (-867.920) -- 0:00:27
536500 -- (-871.810) (-869.579) (-873.054) [-868.284] * (-868.730) (-869.438) (-870.224) [-868.332] -- 0:00:27
537000 -- (-870.885) [-871.305] (-868.902) (-869.705) * (-868.810) (-871.812) (-868.236) [-871.508] -- 0:00:27
537500 -- (-869.602) (-869.516) [-870.247] (-869.800) * (-869.338) (-870.907) (-869.098) [-871.037] -- 0:00:27
538000 -- [-869.540] (-872.961) (-868.671) (-869.241) * [-869.528] (-873.510) (-869.749) (-870.514) -- 0:00:27
538500 -- (-872.412) [-871.129] (-869.473) (-869.882) * (-869.839) (-870.813) (-868.953) [-870.015] -- 0:00:27
539000 -- [-875.042] (-869.765) (-871.330) (-868.885) * (-869.303) (-874.290) [-871.284] (-871.698) -- 0:00:27
539500 -- (-870.738) (-873.574) [-870.717] (-870.696) * (-868.211) (-872.108) [-871.028] (-874.654) -- 0:00:27
540000 -- [-869.731] (-868.832) (-872.960) (-871.895) * [-868.193] (-869.295) (-869.867) (-874.672) -- 0:00:27
Average standard deviation of split frequencies: 0.009707
540500 -- (-869.486) (-870.177) [-870.805] (-870.427) * (-872.162) (-870.031) [-871.688] (-869.051) -- 0:00:27
541000 -- (-869.834) [-875.663] (-873.661) (-869.298) * (-871.509) [-869.238] (-868.075) (-870.006) -- 0:00:27
541500 -- (-869.875) (-875.641) (-869.903) [-870.284] * [-869.001] (-869.689) (-872.348) (-871.333) -- 0:00:27
542000 -- (-871.099) (-870.138) (-871.368) [-870.611] * (-872.667) [-870.694] (-876.422) (-872.895) -- 0:00:27
542500 -- (-870.065) [-872.066] (-868.748) (-868.253) * (-869.681) [-874.056] (-868.500) (-876.525) -- 0:00:26
543000 -- (-871.809) (-874.718) [-870.265] (-873.177) * [-869.048] (-868.988) (-869.903) (-879.358) -- 0:00:26
543500 -- (-871.982) (-872.002) [-870.069] (-869.988) * (-881.084) (-869.214) (-869.402) [-870.101] -- 0:00:26
544000 -- (-871.030) (-869.399) (-869.858) [-868.275] * (-872.687) [-870.547] (-870.186) (-871.291) -- 0:00:26
544500 -- (-870.629) (-869.008) (-869.889) [-869.204] * [-871.205] (-871.152) (-868.796) (-872.833) -- 0:00:27
545000 -- (-875.606) [-869.057] (-870.369) (-869.406) * (-872.736) (-871.633) (-871.651) [-870.153] -- 0:00:27
Average standard deviation of split frequencies: 0.009785
545500 -- (-872.347) (-868.301) (-869.972) [-869.298] * (-872.041) (-871.123) [-869.333] (-869.249) -- 0:00:27
546000 -- (-871.325) (-869.915) [-869.708] (-870.305) * (-874.649) (-872.963) (-869.449) [-869.452] -- 0:00:27
546500 -- [-868.552] (-870.974) (-870.345) (-871.195) * (-872.758) [-869.984] (-869.026) (-868.244) -- 0:00:27
547000 -- (-869.099) [-868.108] (-871.846) (-872.519) * [-869.816] (-870.116) (-869.826) (-870.042) -- 0:00:27
547500 -- [-871.561] (-870.421) (-870.001) (-871.198) * (-869.023) (-872.932) [-871.408] (-869.964) -- 0:00:27
548000 -- (-870.644) (-869.629) (-868.192) [-871.801] * (-868.630) (-870.472) (-868.951) [-869.360] -- 0:00:27
548500 -- (-868.922) [-868.555] (-869.713) (-869.541) * (-870.249) [-869.732] (-869.097) (-870.866) -- 0:00:27
549000 -- [-869.650] (-871.266) (-869.017) (-872.547) * (-870.952) (-871.916) (-868.960) [-868.837] -- 0:00:27
549500 -- (-869.561) (-870.026) [-868.650] (-869.404) * [-871.381] (-868.717) (-870.057) (-868.718) -- 0:00:27
550000 -- [-868.472] (-871.560) (-870.699) (-869.566) * (-870.907) (-868.831) (-873.373) [-869.260] -- 0:00:27
Average standard deviation of split frequencies: 0.009873
550500 -- (-868.110) (-871.119) [-868.770] (-871.882) * [-868.737] (-870.886) (-868.868) (-870.020) -- 0:00:26
551000 -- [-869.347] (-870.722) (-868.798) (-873.014) * [-868.723] (-869.110) (-871.781) (-869.036) -- 0:00:26
551500 -- (-873.930) (-869.870) [-870.402] (-869.612) * (-871.711) (-869.362) [-868.526] (-871.953) -- 0:00:26
552000 -- (-875.165) (-869.253) (-873.402) [-868.864] * [-873.667] (-876.088) (-869.436) (-870.588) -- 0:00:26
552500 -- (-872.881) [-868.167] (-870.527) (-869.728) * (-872.750) (-874.844) [-871.755] (-868.564) -- 0:00:26
553000 -- (-870.593) (-871.024) (-868.345) [-868.138] * (-871.318) [-869.747] (-869.708) (-869.171) -- 0:00:26
553500 -- [-871.078] (-870.976) (-868.802) (-870.056) * (-872.608) (-869.900) [-868.957] (-872.830) -- 0:00:26
554000 -- [-872.308] (-871.234) (-870.934) (-869.074) * (-868.953) (-868.853) (-869.968) [-872.941] -- 0:00:26
554500 -- (-869.768) (-874.148) (-868.644) [-869.247] * (-869.182) (-869.617) [-872.050] (-870.934) -- 0:00:26
555000 -- (-870.527) [-874.441] (-871.580) (-871.353) * (-871.273) (-870.203) [-869.592] (-870.396) -- 0:00:26
Average standard deviation of split frequencies: 0.009779
555500 -- (-872.570) [-868.005] (-872.205) (-872.047) * (-872.229) (-871.684) (-869.407) [-868.607] -- 0:00:26
556000 -- [-870.024] (-871.298) (-871.162) (-871.085) * (-870.212) [-870.700] (-870.470) (-870.890) -- 0:00:26
556500 -- (-869.623) (-872.773) [-870.277] (-868.796) * (-868.662) (-868.473) (-874.513) [-870.817] -- 0:00:26
557000 -- [-869.586] (-872.187) (-871.303) (-868.907) * (-868.565) [-870.413] (-872.613) (-874.542) -- 0:00:26
557500 -- [-868.843] (-868.968) (-871.622) (-869.502) * (-869.000) (-873.095) (-871.461) [-868.605] -- 0:00:26
558000 -- (-870.081) [-869.227] (-868.372) (-870.083) * [-869.105] (-879.950) (-868.890) (-873.564) -- 0:00:26
558500 -- (-869.385) (-869.270) (-872.037) [-868.961] * [-869.482] (-871.147) (-868.191) (-870.522) -- 0:00:26
559000 -- (-869.375) (-869.215) [-872.098] (-871.003) * (-870.524) (-869.756) (-869.182) [-869.797] -- 0:00:26
559500 -- (-869.466) (-872.436) (-871.071) [-871.055] * [-869.568] (-869.629) (-868.748) (-870.209) -- 0:00:25
560000 -- [-867.952] (-869.141) (-874.979) (-874.961) * (-869.142) [-868.417] (-868.619) (-869.727) -- 0:00:25
Average standard deviation of split frequencies: 0.009249
560500 -- (-868.012) (-868.787) (-870.434) [-876.087] * [-869.732] (-872.259) (-871.908) (-871.266) -- 0:00:25
561000 -- (-868.022) (-868.661) [-868.625] (-871.042) * (-870.535) [-871.021] (-873.446) (-871.219) -- 0:00:26
561500 -- (-868.677) (-870.880) (-868.301) [-870.523] * (-876.323) (-869.728) [-868.532] (-869.295) -- 0:00:26
562000 -- [-869.843] (-869.553) (-872.593) (-872.872) * (-872.002) (-869.440) (-868.467) [-870.335] -- 0:00:26
562500 -- [-871.577] (-871.316) (-873.897) (-870.313) * [-869.150] (-869.164) (-868.833) (-870.136) -- 0:00:26
563000 -- (-872.741) (-870.262) (-870.224) [-871.340] * [-868.453] (-871.347) (-869.812) (-871.600) -- 0:00:26
563500 -- [-871.582] (-876.546) (-871.699) (-871.303) * (-868.937) (-869.919) [-868.509] (-869.922) -- 0:00:26
564000 -- [-869.581] (-871.532) (-870.689) (-869.736) * (-868.891) (-868.953) [-869.561] (-874.548) -- 0:00:26
564500 -- [-869.225] (-868.333) (-869.084) (-869.689) * (-870.662) (-869.424) [-868.640] (-869.042) -- 0:00:26
565000 -- [-872.573] (-869.786) (-869.924) (-869.056) * [-868.667] (-870.028) (-871.094) (-870.314) -- 0:00:26
Average standard deviation of split frequencies: 0.008901
565500 -- [-871.603] (-870.395) (-870.625) (-872.436) * (-869.183) (-868.065) (-870.368) [-872.831] -- 0:00:26
566000 -- (-871.999) (-872.023) (-868.604) [-869.014] * (-876.648) [-868.818] (-874.107) (-868.744) -- 0:00:26
566500 -- (-868.871) (-869.043) [-868.733] (-874.884) * (-870.098) (-869.692) [-868.918] (-869.897) -- 0:00:26
567000 -- (-873.767) [-869.451] (-867.787) (-871.161) * (-871.413) (-869.156) [-868.504] (-868.782) -- 0:00:25
567500 -- (-870.700) [-869.790] (-869.908) (-869.249) * (-870.999) (-868.855) [-871.897] (-868.016) -- 0:00:25
568000 -- (-871.512) (-869.160) (-870.619) [-868.921] * (-871.222) (-869.722) [-872.341] (-868.158) -- 0:00:25
568500 -- (-867.757) [-869.456] (-872.520) (-868.993) * [-870.018] (-868.663) (-871.357) (-869.111) -- 0:00:25
569000 -- [-868.832] (-869.130) (-871.568) (-869.639) * (-875.398) (-869.493) [-868.740] (-868.690) -- 0:00:25
569500 -- (-869.220) (-870.997) (-869.518) [-870.333] * (-875.827) [-870.100] (-869.899) (-869.398) -- 0:00:25
570000 -- (-871.754) [-868.838] (-869.282) (-868.346) * (-875.261) (-873.584) (-871.022) [-868.922] -- 0:00:25
Average standard deviation of split frequencies: 0.008880
570500 -- (-870.334) (-869.993) [-869.370] (-870.439) * (-870.208) [-869.212] (-868.510) (-869.319) -- 0:00:25
571000 -- (-871.425) (-867.870) (-867.765) [-868.425] * (-870.000) (-868.968) (-870.227) [-868.026] -- 0:00:25
571500 -- (-871.549) (-870.999) (-869.439) [-870.799] * [-871.907] (-870.181) (-873.566) (-868.692) -- 0:00:25
572000 -- (-870.129) (-871.186) (-873.886) [-869.022] * (-874.161) (-870.451) [-869.528] (-869.528) -- 0:00:25
572500 -- (-872.503) [-870.240] (-871.278) (-871.042) * (-868.846) (-870.853) (-868.622) [-871.508] -- 0:00:25
573000 -- [-874.659] (-871.954) (-872.442) (-869.236) * [-871.317] (-871.537) (-871.422) (-877.759) -- 0:00:25
573500 -- (-874.234) [-869.628] (-874.790) (-870.722) * [-872.561] (-869.824) (-868.450) (-872.966) -- 0:00:25
574000 -- (-869.631) [-870.012] (-872.689) (-867.836) * (-871.103) [-869.638] (-869.616) (-872.077) -- 0:00:25
574500 -- [-868.974] (-869.235) (-870.497) (-869.954) * (-870.426) (-873.164) (-871.266) [-868.465] -- 0:00:25
575000 -- (-868.236) (-868.000) [-872.904] (-870.598) * (-869.874) (-872.432) (-870.764) [-869.278] -- 0:00:25
Average standard deviation of split frequencies: 0.008696
575500 -- [-870.902] (-869.851) (-869.810) (-867.986) * [-869.793] (-874.428) (-871.202) (-869.348) -- 0:00:25
576000 -- (-870.493) (-869.858) (-869.111) [-868.050] * (-869.839) (-870.844) (-870.542) [-870.994] -- 0:00:25
576500 -- (-871.514) (-868.901) [-868.471] (-870.044) * (-870.297) [-870.990] (-870.452) (-872.910) -- 0:00:24
577000 -- (-868.813) (-869.903) (-870.677) [-869.080] * [-869.823] (-871.132) (-869.331) (-869.258) -- 0:00:24
577500 -- (-871.009) (-871.351) (-870.105) [-869.058] * (-869.571) (-874.733) [-868.746] (-874.617) -- 0:00:25
578000 -- (-868.549) (-873.988) [-870.296] (-870.085) * [-869.379] (-869.189) (-869.057) (-868.289) -- 0:00:25
578500 -- [-868.888] (-870.285) (-869.202) (-868.404) * (-869.442) [-869.589] (-870.965) (-870.188) -- 0:00:25
579000 -- (-872.617) (-871.906) (-870.938) [-875.275] * (-867.788) [-868.147] (-870.698) (-871.211) -- 0:00:25
579500 -- (-871.260) (-872.365) [-872.313] (-869.994) * (-867.985) (-869.770) [-868.721] (-868.897) -- 0:00:25
580000 -- (-868.821) (-869.508) (-868.616) [-868.147] * (-867.986) [-870.966] (-869.172) (-871.271) -- 0:00:25
Average standard deviation of split frequencies: 0.008676
580500 -- (-870.656) (-868.625) (-871.284) [-868.615] * (-871.130) (-871.257) [-867.670] (-872.620) -- 0:00:25
581000 -- (-869.658) (-869.635) (-868.753) [-868.756] * [-870.609] (-873.073) (-867.670) (-869.711) -- 0:00:25
581500 -- [-869.967] (-868.906) (-870.141) (-869.501) * [-871.002] (-868.553) (-870.206) (-868.334) -- 0:00:25
582000 -- (-870.826) [-868.133] (-870.362) (-869.490) * (-871.587) [-868.372] (-869.313) (-870.934) -- 0:00:25
582500 -- (-870.973) (-868.757) (-874.748) [-868.234] * [-870.843] (-870.625) (-871.917) (-870.526) -- 0:00:25
583000 -- (-871.758) (-872.430) [-871.519] (-868.266) * [-870.490] (-870.663) (-869.945) (-870.391) -- 0:00:25
583500 -- (-872.925) (-871.212) [-876.414] (-868.182) * [-873.029] (-868.159) (-869.052) (-869.288) -- 0:00:24
584000 -- [-874.754] (-874.103) (-870.066) (-868.703) * (-871.617) (-869.592) [-870.760] (-870.243) -- 0:00:24
584500 -- [-869.890] (-869.160) (-868.744) (-870.267) * (-869.793) (-871.639) (-870.053) [-869.914] -- 0:00:24
585000 -- [-873.548] (-869.679) (-869.088) (-868.415) * [-868.959] (-868.853) (-868.918) (-874.035) -- 0:00:24
Average standard deviation of split frequencies: 0.008598
585500 -- (-870.535) (-869.478) (-869.576) [-871.619] * (-869.768) [-870.463] (-868.995) (-868.705) -- 0:00:24
586000 -- (-870.414) (-869.623) [-870.059] (-870.202) * [-868.778] (-870.348) (-870.044) (-869.469) -- 0:00:24
586500 -- (-869.829) [-868.633] (-868.278) (-870.044) * [-869.125] (-870.205) (-872.279) (-869.914) -- 0:00:24
587000 -- (-875.745) (-871.268) (-871.378) [-868.240] * (-872.275) (-873.298) (-873.279) [-868.499] -- 0:00:24
587500 -- (-868.798) (-869.852) [-868.612] (-869.305) * (-869.675) [-873.341] (-871.888) (-870.500) -- 0:00:24
588000 -- (-868.854) [-870.865] (-870.236) (-871.082) * [-868.484] (-873.055) (-869.877) (-867.977) -- 0:00:24
588500 -- [-869.655] (-868.398) (-871.276) (-870.816) * (-869.878) (-871.519) [-869.073] (-872.645) -- 0:00:24
589000 -- (-868.436) (-869.920) (-868.191) [-871.306] * (-877.646) (-872.905) [-869.531] (-869.931) -- 0:00:24
589500 -- (-871.051) (-868.931) (-870.570) [-869.120] * [-871.351] (-870.872) (-869.574) (-871.045) -- 0:00:24
590000 -- (-875.010) (-869.976) [-869.707] (-868.849) * (-872.547) [-870.174] (-870.853) (-870.778) -- 0:00:24
Average standard deviation of split frequencies: 0.008779
590500 -- [-870.429] (-876.030) (-868.491) (-869.998) * (-872.611) [-869.179] (-870.997) (-870.108) -- 0:00:24
591000 -- (-871.804) (-871.561) (-868.498) [-870.678] * (-869.493) (-873.650) [-869.072] (-871.412) -- 0:00:24
591500 -- (-869.310) (-869.341) (-868.609) [-873.332] * [-868.124] (-869.385) (-870.164) (-869.790) -- 0:00:24
592000 -- [-869.123] (-869.558) (-870.813) (-871.212) * [-868.311] (-869.782) (-871.399) (-870.025) -- 0:00:24
592500 -- [-868.979] (-869.748) (-869.152) (-870.567) * (-868.286) [-868.764] (-869.387) (-869.476) -- 0:00:24
593000 -- [-869.739] (-868.801) (-872.471) (-875.686) * [-869.681] (-870.623) (-869.998) (-868.458) -- 0:00:24
593500 -- [-872.394] (-872.509) (-870.573) (-871.906) * (-871.880) [-870.696] (-868.979) (-868.719) -- 0:00:23
594000 -- [-869.797] (-870.500) (-870.822) (-869.725) * (-868.938) (-871.204) [-868.625] (-870.120) -- 0:00:23
594500 -- (-868.581) (-869.619) (-869.539) [-870.030] * [-869.427] (-871.467) (-868.610) (-871.168) -- 0:00:24
595000 -- [-868.472] (-869.743) (-873.766) (-871.762) * (-871.700) [-870.639] (-869.426) (-868.506) -- 0:00:24
Average standard deviation of split frequencies: 0.008602
595500 -- (-870.834) [-869.424] (-871.239) (-868.318) * [-871.038] (-869.563) (-869.042) (-869.001) -- 0:00:24
596000 -- (-870.567) [-872.969] (-868.142) (-870.114) * (-869.472) (-870.614) (-869.220) [-872.344] -- 0:00:24
596500 -- (-869.966) [-871.669] (-870.300) (-869.719) * (-868.875) (-871.535) [-869.735] (-869.422) -- 0:00:24
597000 -- (-870.122) (-871.278) [-870.284] (-870.234) * (-869.751) [-869.810] (-870.482) (-870.596) -- 0:00:24
597500 -- (-869.632) [-870.384] (-871.603) (-873.561) * (-870.456) (-869.966) [-868.340] (-871.537) -- 0:00:24
598000 -- (-869.932) (-870.604) [-873.502] (-874.496) * [-870.560] (-869.751) (-869.934) (-869.422) -- 0:00:24
598500 -- (-869.474) (-868.260) [-872.438] (-870.313) * (-868.892) (-872.017) [-868.721] (-870.906) -- 0:00:24
599000 -- (-868.283) [-868.256] (-874.516) (-869.842) * (-868.103) (-869.011) [-871.289] (-869.457) -- 0:00:24
599500 -- (-871.513) (-869.082) (-869.435) [-870.592] * (-870.371) (-869.457) [-868.864] (-868.380) -- 0:00:24
600000 -- (-871.101) (-868.169) [-869.306] (-868.193) * (-870.739) (-870.151) [-869.516] (-869.035) -- 0:00:24
Average standard deviation of split frequencies: 0.008424
600500 -- (-873.060) (-871.591) (-872.681) [-868.617] * (-870.160) (-868.461) (-870.673) [-870.168] -- 0:00:23
601000 -- (-871.470) [-870.289] (-870.077) (-868.320) * (-871.782) (-871.193) (-874.364) [-868.729] -- 0:00:23
601500 -- (-874.348) (-870.622) (-870.506) [-869.040] * (-868.733) (-869.158) [-870.697] (-869.530) -- 0:00:23
602000 -- (-868.393) [-869.083] (-868.533) (-870.751) * [-869.002] (-870.777) (-870.043) (-872.237) -- 0:00:23
602500 -- (-871.386) (-868.953) (-868.570) [-869.846] * [-877.085] (-869.886) (-872.848) (-870.816) -- 0:00:23
603000 -- (-873.509) (-869.487) [-869.747] (-869.785) * (-869.878) (-870.587) (-876.613) [-874.748] -- 0:00:23
603500 -- [-872.146] (-869.140) (-868.871) (-871.024) * (-869.974) (-871.749) [-868.246] (-870.990) -- 0:00:23
604000 -- (-869.193) (-868.940) [-868.984] (-870.758) * (-870.126) (-870.889) [-868.707] (-871.751) -- 0:00:23
604500 -- (-869.412) (-869.444) [-868.767] (-868.923) * [-868.875] (-873.488) (-871.863) (-872.449) -- 0:00:23
605000 -- (-869.470) [-871.862] (-869.304) (-868.900) * [-868.468] (-870.604) (-869.924) (-870.434) -- 0:00:23
Average standard deviation of split frequencies: 0.008090
605500 -- (-870.884) (-873.959) [-868.350] (-872.262) * (-869.888) (-869.373) [-870.703] (-873.261) -- 0:00:23
606000 -- (-869.940) (-869.510) [-869.357] (-873.557) * (-870.400) (-867.819) [-872.217] (-872.662) -- 0:00:23
606500 -- (-871.202) (-868.058) [-868.579] (-869.328) * (-869.670) (-870.553) (-868.997) [-869.524] -- 0:00:23
607000 -- [-869.469] (-870.062) (-868.696) (-868.934) * (-872.189) (-869.052) [-868.850] (-872.102) -- 0:00:23
607500 -- [-870.064] (-872.182) (-874.262) (-868.823) * (-870.693) (-871.224) (-871.409) [-867.992] -- 0:00:23
608000 -- (-868.934) (-875.775) [-869.268] (-874.349) * (-869.246) [-871.824] (-869.691) (-868.761) -- 0:00:23
608500 -- [-871.116] (-869.535) (-870.869) (-870.984) * (-868.669) (-871.024) (-868.973) [-869.650] -- 0:00:23
609000 -- (-872.191) [-870.146] (-871.590) (-869.206) * (-871.749) (-869.197) (-871.614) [-869.542] -- 0:00:23
609500 -- (-868.544) (-872.675) [-870.089] (-868.851) * (-871.954) (-874.523) (-872.069) [-869.983] -- 0:00:23
610000 -- (-870.083) (-869.456) [-872.970] (-872.836) * (-868.619) [-870.843] (-868.480) (-871.413) -- 0:00:23
Average standard deviation of split frequencies: 0.008080
610500 -- (-867.841) [-870.924] (-871.444) (-871.114) * (-869.945) (-869.691) (-869.412) [-868.540] -- 0:00:23
611000 -- (-868.271) (-873.544) (-869.596) [-873.864] * (-871.577) (-870.711) (-870.413) [-868.088] -- 0:00:23
611500 -- (-872.908) (-872.754) [-869.298] (-871.187) * (-868.338) (-869.832) [-869.836] (-870.459) -- 0:00:23
612000 -- (-873.573) (-872.940) (-869.065) [-870.031] * [-870.317] (-869.574) (-871.953) (-869.112) -- 0:00:23
612500 -- (-869.289) (-875.217) [-870.437] (-869.502) * (-873.192) (-871.084) (-868.072) [-870.084] -- 0:00:23
613000 -- [-868.003] (-867.892) (-874.738) (-871.381) * (-869.730) (-874.027) (-871.142) [-870.085] -- 0:00:23
613500 -- (-870.931) (-868.614) (-874.897) [-870.267] * (-869.300) [-873.433] (-872.992) (-873.373) -- 0:00:23
614000 -- (-871.239) [-868.777] (-868.567) (-869.538) * (-871.388) (-870.785) [-871.003] (-873.016) -- 0:00:23
614500 -- (-869.648) (-868.176) (-868.512) [-871.020] * (-871.588) (-868.391) [-870.515] (-874.080) -- 0:00:23
615000 -- (-868.908) (-873.692) (-869.553) [-871.367] * (-869.236) (-868.530) [-869.287] (-870.001) -- 0:00:23
Average standard deviation of split frequencies: 0.008010
615500 -- (-868.897) (-876.199) (-871.223) [-868.439] * (-870.417) (-870.017) (-871.040) [-870.453] -- 0:00:23
616000 -- (-872.819) (-868.601) [-870.204] (-869.921) * [-871.385] (-869.312) (-868.124) (-869.124) -- 0:00:23
616500 -- [-870.050] (-870.880) (-870.205) (-871.431) * [-870.757] (-872.898) (-867.930) (-871.798) -- 0:00:23
617000 -- (-871.006) (-871.978) [-871.040] (-870.285) * (-870.799) [-869.468] (-868.170) (-871.420) -- 0:00:22
617500 -- (-870.731) (-869.251) (-868.712) [-870.203] * (-869.614) [-870.309] (-868.442) (-869.376) -- 0:00:22
618000 -- (-871.613) (-870.610) (-872.066) [-871.487] * (-874.306) (-869.254) (-868.267) [-868.965] -- 0:00:22
618500 -- (-871.806) (-869.560) [-872.450] (-870.989) * (-871.616) (-870.605) [-871.251] (-870.413) -- 0:00:22
619000 -- (-869.937) (-869.805) (-869.571) [-874.109] * (-868.518) (-871.622) [-869.292] (-870.678) -- 0:00:22
619500 -- (-876.733) [-871.258] (-868.686) (-868.605) * (-874.389) (-875.582) [-868.518] (-870.767) -- 0:00:22
620000 -- [-872.421] (-869.220) (-868.711) (-870.365) * (-870.028) (-873.264) [-869.369] (-869.731) -- 0:00:22
Average standard deviation of split frequencies: 0.008253
620500 -- (-870.656) (-873.101) (-868.645) [-870.111] * (-870.778) [-871.728] (-872.305) (-870.680) -- 0:00:22
621000 -- (-870.892) [-869.235] (-868.829) (-870.726) * (-872.709) (-871.372) [-868.750] (-870.159) -- 0:00:22
621500 -- (-872.351) (-869.000) (-869.287) [-871.592] * (-875.403) (-872.912) [-868.059] (-870.691) -- 0:00:22
622000 -- (-869.000) (-869.644) [-869.374] (-871.793) * (-868.192) (-870.470) [-868.527] (-873.080) -- 0:00:22
622500 -- (-870.960) [-873.550] (-870.353) (-871.928) * (-868.933) (-875.283) [-868.739] (-870.806) -- 0:00:22
623000 -- (-869.797) (-870.439) (-868.896) [-871.666] * (-869.647) (-868.774) [-869.176] (-871.394) -- 0:00:22
623500 -- (-869.485) (-869.540) (-868.504) [-872.132] * [-870.693] (-874.424) (-873.565) (-873.399) -- 0:00:22
624000 -- (-868.612) (-874.361) (-869.965) [-869.153] * (-876.013) (-871.500) [-874.264] (-872.331) -- 0:00:22
624500 -- (-868.881) (-871.826) [-868.467] (-869.160) * (-874.673) [-872.455] (-872.538) (-870.888) -- 0:00:22
625000 -- (-869.670) (-871.725) (-869.806) [-869.666] * (-871.207) (-870.427) [-868.989] (-869.360) -- 0:00:22
Average standard deviation of split frequencies: 0.008534
625500 -- [-868.494] (-871.328) (-870.072) (-869.949) * [-871.342] (-869.801) (-869.294) (-872.548) -- 0:00:22
626000 -- (-872.887) (-871.184) [-872.465] (-872.726) * (-869.760) (-871.006) (-869.971) [-872.249] -- 0:00:22
626500 -- [-872.708] (-869.384) (-869.787) (-870.755) * [-869.377] (-872.425) (-869.762) (-869.731) -- 0:00:22
627000 -- [-872.831] (-871.724) (-867.985) (-870.373) * (-869.621) (-868.007) (-869.006) [-870.227] -- 0:00:22
627500 -- (-872.277) [-877.256] (-867.951) (-872.550) * [-873.950] (-871.304) (-868.871) (-873.060) -- 0:00:22
628000 -- (-869.434) (-869.343) [-869.678] (-873.695) * (-869.368) (-869.502) [-869.593] (-873.708) -- 0:00:22
628500 -- (-868.520) [-870.796] (-874.309) (-869.146) * (-869.050) [-869.975] (-869.510) (-872.429) -- 0:00:22
629000 -- (-869.233) [-869.903] (-870.379) (-871.264) * (-870.246) [-870.362] (-868.408) (-871.869) -- 0:00:22
629500 -- [-872.757] (-869.692) (-871.043) (-873.461) * (-871.424) (-871.672) [-869.577] (-870.368) -- 0:00:22
630000 -- [-873.864] (-873.728) (-869.945) (-868.730) * (-869.150) (-874.722) [-874.323] (-871.596) -- 0:00:22
Average standard deviation of split frequencies: 0.008720
630500 -- [-868.619] (-874.616) (-870.869) (-868.808) * (-871.850) (-871.701) [-873.395] (-874.159) -- 0:00:22
631000 -- (-868.873) (-872.842) [-868.894] (-868.808) * (-872.676) (-871.637) [-868.927] (-871.076) -- 0:00:22
631500 -- (-869.926) [-870.661] (-868.167) (-870.022) * (-872.819) [-870.639] (-870.159) (-868.320) -- 0:00:22
632000 -- (-869.820) (-868.786) [-871.678] (-874.548) * (-868.944) [-869.351] (-869.769) (-868.714) -- 0:00:22
632500 -- (-871.864) [-873.291] (-870.379) (-870.115) * (-871.601) [-869.694] (-872.289) (-868.369) -- 0:00:22
633000 -- (-871.376) [-869.007] (-868.486) (-870.544) * (-870.012) (-872.634) [-869.255] (-870.990) -- 0:00:22
633500 -- [-869.768] (-868.548) (-870.695) (-871.185) * (-868.986) [-871.748] (-871.930) (-870.891) -- 0:00:21
634000 -- (-870.944) (-868.413) (-868.469) [-871.592] * [-869.810] (-873.845) (-875.198) (-868.344) -- 0:00:21
634500 -- (-870.224) (-868.817) [-869.374] (-873.653) * (-869.503) [-868.946] (-872.667) (-869.078) -- 0:00:21
635000 -- [-868.713] (-871.963) (-869.967) (-870.283) * (-871.400) (-870.529) [-868.960] (-869.984) -- 0:00:21
Average standard deviation of split frequencies: 0.008697
635500 -- (-868.182) (-871.142) [-868.224] (-873.466) * (-868.669) [-869.884] (-869.070) (-870.126) -- 0:00:21
636000 -- (-867.674) (-869.693) (-870.588) [-870.181] * (-869.979) (-871.830) [-868.596] (-868.991) -- 0:00:21
636500 -- (-869.435) (-869.559) (-871.959) [-869.068] * [-869.671] (-870.643) (-871.036) (-868.472) -- 0:00:21
637000 -- (-875.910) (-870.542) [-870.294] (-870.922) * (-869.524) (-869.686) (-868.809) [-869.083] -- 0:00:21
637500 -- [-869.053] (-868.777) (-869.569) (-870.548) * (-869.142) (-869.810) [-868.351] (-868.679) -- 0:00:21
638000 -- [-867.805] (-868.672) (-870.047) (-869.174) * [-868.378] (-869.926) (-870.497) (-868.628) -- 0:00:21
638500 -- (-870.758) [-868.920] (-870.875) (-871.903) * (-869.168) [-870.802] (-871.234) (-869.665) -- 0:00:21
639000 -- [-871.397] (-874.203) (-868.591) (-871.629) * (-870.979) (-871.644) (-871.274) [-868.478] -- 0:00:21
639500 -- (-868.779) (-873.738) [-868.410] (-871.588) * (-878.455) (-872.545) [-870.746] (-869.913) -- 0:00:21
640000 -- (-868.370) (-868.944) (-870.597) [-870.884] * (-871.471) [-870.273] (-872.432) (-873.339) -- 0:00:21
Average standard deviation of split frequencies: 0.008928
640500 -- (-879.285) (-868.943) [-869.656] (-871.672) * [-868.547] (-870.332) (-871.073) (-871.955) -- 0:00:21
641000 -- [-870.834] (-869.527) (-869.571) (-874.973) * [-870.196] (-871.376) (-871.020) (-868.903) -- 0:00:21
641500 -- (-870.885) (-875.287) [-869.593] (-869.613) * (-868.942) [-870.487] (-868.285) (-869.169) -- 0:00:21
642000 -- (-870.305) (-872.453) [-868.853] (-870.553) * [-868.375] (-870.720) (-871.592) (-871.827) -- 0:00:21
642500 -- (-870.449) (-869.620) (-869.271) [-869.441] * [-869.490] (-868.525) (-874.009) (-869.173) -- 0:00:21
643000 -- (-871.506) (-872.369) [-870.194] (-875.435) * [-870.165] (-869.268) (-868.415) (-870.692) -- 0:00:21
643500 -- (-870.284) [-870.669] (-869.025) (-870.070) * [-868.680] (-869.781) (-869.286) (-872.002) -- 0:00:21
644000 -- (-872.101) (-870.023) [-870.288] (-869.333) * (-871.731) (-869.434) [-872.504] (-871.091) -- 0:00:21
644500 -- (-871.443) (-869.254) (-869.242) [-869.763] * (-873.745) (-868.997) [-869.379] (-872.098) -- 0:00:21
645000 -- (-869.300) (-870.443) (-869.025) [-869.180] * [-871.178] (-875.188) (-869.873) (-871.292) -- 0:00:21
Average standard deviation of split frequencies: 0.008854
645500 -- (-870.599) (-869.531) [-868.702] (-870.883) * (-875.472) (-873.253) [-868.344] (-869.087) -- 0:00:21
646000 -- (-868.457) (-870.537) [-868.307] (-870.818) * [-870.106] (-875.187) (-869.791) (-869.653) -- 0:00:21
646500 -- [-868.379] (-872.316) (-870.322) (-871.105) * (-870.496) (-873.239) (-870.899) [-867.878] -- 0:00:21
647000 -- (-870.312) (-870.211) (-870.344) [-870.114] * (-870.171) (-871.748) [-872.295] (-869.316) -- 0:00:21
647500 -- (-868.652) [-868.430] (-872.466) (-868.800) * [-870.213] (-869.153) (-877.121) (-869.358) -- 0:00:21
648000 -- (-868.854) (-869.135) (-868.878) [-870.954] * (-871.683) (-869.348) (-870.838) [-870.294] -- 0:00:21
648500 -- (-874.415) (-869.840) [-868.162] (-869.502) * (-869.772) [-872.347] (-868.016) (-872.761) -- 0:00:21
649000 -- (-872.005) (-870.965) (-868.138) [-871.931] * (-869.664) [-869.881] (-872.377) (-871.083) -- 0:00:21
649500 -- (-870.829) (-871.478) (-874.272) [-869.155] * [-868.134] (-871.592) (-871.435) (-868.797) -- 0:00:21
650000 -- (-873.411) (-869.562) [-868.231] (-870.771) * (-872.210) (-872.146) [-870.186] (-872.357) -- 0:00:21
Average standard deviation of split frequencies: 0.008646
650500 -- (-870.595) (-870.895) (-870.169) [-869.943] * (-868.716) [-869.676] (-868.846) (-869.253) -- 0:00:20
651000 -- (-869.816) [-869.551] (-870.454) (-867.879) * (-868.831) (-868.380) [-869.048] (-868.724) -- 0:00:20
651500 -- [-872.218] (-871.563) (-875.242) (-872.984) * [-870.715] (-871.684) (-871.285) (-869.672) -- 0:00:20
652000 -- [-870.575] (-868.836) (-868.891) (-869.338) * (-871.795) [-868.586] (-869.633) (-871.476) -- 0:00:20
652500 -- (-869.408) (-870.309) [-870.214] (-870.313) * (-869.819) (-868.529) [-869.714] (-870.599) -- 0:00:20
653000 -- (-870.224) (-870.396) (-869.065) [-869.160] * (-869.620) [-869.341] (-869.545) (-870.169) -- 0:00:20
653500 -- [-870.682] (-869.901) (-868.803) (-869.604) * (-868.146) [-868.589] (-872.848) (-870.509) -- 0:00:20
654000 -- (-869.888) [-869.132] (-871.300) (-870.956) * (-870.740) (-869.087) [-871.652] (-872.906) -- 0:00:20
654500 -- (-869.785) [-869.100] (-870.293) (-870.788) * (-873.799) [-869.091] (-870.229) (-870.445) -- 0:00:20
655000 -- (-869.065) (-872.295) (-869.633) [-871.355] * (-871.403) [-869.531] (-870.982) (-869.577) -- 0:00:20
Average standard deviation of split frequencies: 0.008959
655500 -- (-869.231) (-877.991) [-870.880] (-871.931) * (-875.152) (-871.507) (-871.979) [-870.439] -- 0:00:20
656000 -- (-869.725) (-873.219) [-870.549] (-872.296) * (-872.756) [-870.933] (-872.259) (-871.555) -- 0:00:20
656500 -- (-871.091) (-869.371) [-870.713] (-875.914) * (-869.711) (-869.713) [-871.120] (-871.626) -- 0:00:20
657000 -- (-870.869) [-867.920] (-871.210) (-871.577) * (-870.265) [-871.827] (-869.249) (-869.672) -- 0:00:20
657500 -- (-872.472) (-870.229) [-871.043] (-871.429) * (-871.472) (-869.091) [-869.792] (-870.325) -- 0:00:20
658000 -- [-868.325] (-868.677) (-872.373) (-869.945) * [-870.121] (-871.034) (-869.345) (-872.795) -- 0:00:20
658500 -- (-871.332) [-868.833] (-867.915) (-869.332) * (-871.295) (-872.259) (-869.988) [-870.164] -- 0:00:20
659000 -- (-869.873) [-871.955] (-869.907) (-870.180) * [-870.405] (-870.826) (-871.190) (-872.831) -- 0:00:20
659500 -- [-870.186] (-873.133) (-869.056) (-873.773) * (-868.170) (-869.478) [-869.028] (-876.807) -- 0:00:20
660000 -- (-868.971) [-870.062] (-868.917) (-871.984) * (-868.419) (-868.422) (-873.646) [-868.340] -- 0:00:20
Average standard deviation of split frequencies: 0.009181
660500 -- (-869.330) (-868.791) (-869.260) [-869.011] * (-871.418) (-869.368) (-868.451) [-868.593] -- 0:00:20
661000 -- (-870.755) [-871.125] (-869.188) (-878.741) * (-869.061) (-868.951) (-868.303) [-868.849] -- 0:00:20
661500 -- (-869.689) (-873.107) [-871.032] (-870.199) * (-870.480) [-868.980] (-870.535) (-868.153) -- 0:00:20
662000 -- [-869.640] (-869.206) (-872.948) (-873.227) * (-872.496) (-871.507) (-867.830) [-870.943] -- 0:00:20
662500 -- (-868.890) [-869.103] (-871.099) (-871.508) * (-876.513) (-871.017) [-868.493] (-872.749) -- 0:00:20
663000 -- (-875.336) (-869.742) [-869.466] (-871.380) * (-872.236) (-869.641) [-869.391] (-872.446) -- 0:00:20
663500 -- (-873.533) (-869.686) [-872.210] (-870.923) * (-868.720) (-868.922) (-869.152) [-875.326] -- 0:00:20
664000 -- (-868.563) [-869.241] (-871.823) (-869.892) * (-874.242) [-868.980] (-868.847) (-871.634) -- 0:00:20
664500 -- (-874.749) [-868.368] (-871.610) (-869.675) * (-870.628) (-869.762) (-872.096) [-872.220] -- 0:00:20
665000 -- (-871.865) (-873.560) [-868.851] (-869.719) * [-870.124] (-868.719) (-869.942) (-872.962) -- 0:00:20
Average standard deviation of split frequencies: 0.008871
665500 -- (-872.303) (-872.688) [-871.447] (-869.484) * (-869.022) (-869.349) [-871.963] (-871.557) -- 0:00:20
666000 -- (-868.468) (-870.859) [-868.265] (-868.871) * (-869.214) [-871.771] (-868.484) (-871.515) -- 0:00:20
666500 -- (-868.674) (-869.483) (-869.044) [-868.486] * (-871.580) (-873.049) [-869.356] (-869.925) -- 0:00:20
667000 -- (-868.152) [-868.750] (-870.411) (-870.616) * (-874.102) [-869.341] (-869.383) (-868.044) -- 0:00:19
667500 -- (-870.179) (-871.906) [-869.364] (-868.331) * (-875.059) (-871.701) [-871.380] (-869.990) -- 0:00:19
668000 -- (-874.454) (-869.652) [-869.808] (-868.415) * [-870.803] (-868.743) (-872.486) (-872.310) -- 0:00:19
668500 -- (-870.666) (-868.986) (-872.519) [-869.073] * (-869.564) (-872.168) [-870.362] (-869.184) -- 0:00:19
669000 -- (-868.938) (-871.297) (-873.150) [-870.086] * (-872.688) (-872.524) (-874.664) [-869.052] -- 0:00:19
669500 -- [-869.268] (-871.462) (-872.171) (-870.196) * (-869.962) (-869.415) [-873.332] (-870.544) -- 0:00:19
670000 -- (-873.532) [-869.050] (-869.928) (-869.873) * (-871.434) (-874.893) [-868.871] (-869.207) -- 0:00:19
Average standard deviation of split frequencies: 0.008575
670500 -- (-870.031) [-868.240] (-868.665) (-870.354) * (-870.333) (-872.953) [-869.185] (-869.871) -- 0:00:19
671000 -- (-871.334) (-877.039) (-869.554) [-872.292] * [-867.836] (-876.711) (-870.548) (-869.562) -- 0:00:19
671500 -- (-868.707) (-868.747) [-869.181] (-872.821) * [-868.106] (-875.624) (-871.630) (-868.670) -- 0:00:19
672000 -- [-870.134] (-868.383) (-868.374) (-869.754) * (-871.166) (-872.155) (-873.864) [-869.457] -- 0:00:19
672500 -- [-870.948] (-868.716) (-870.970) (-868.717) * [-872.557] (-870.501) (-872.408) (-870.187) -- 0:00:19
673000 -- (-871.066) (-868.539) (-871.353) [-869.831] * (-872.847) [-870.451] (-868.207) (-870.426) -- 0:00:19
673500 -- (-870.486) (-869.015) [-871.313] (-871.358) * (-871.450) (-868.463) (-869.701) [-869.980] -- 0:00:19
674000 -- (-869.120) (-872.235) (-870.662) [-869.771] * (-873.415) (-869.616) [-870.899] (-870.610) -- 0:00:19
674500 -- (-870.160) [-872.758] (-869.763) (-871.217) * [-874.619] (-872.684) (-871.216) (-869.077) -- 0:00:19
675000 -- [-869.272] (-873.373) (-870.576) (-871.864) * (-873.555) (-868.243) [-870.102] (-869.580) -- 0:00:19
Average standard deviation of split frequencies: 0.008229
675500 -- [-867.884] (-870.309) (-868.666) (-870.615) * (-870.389) (-869.221) (-868.515) [-870.793] -- 0:00:19
676000 -- (-869.589) (-868.904) (-870.690) [-873.436] * (-870.075) (-868.546) [-871.795] (-869.810) -- 0:00:19
676500 -- [-872.054] (-872.028) (-867.958) (-868.566) * [-870.453] (-871.311) (-872.389) (-870.707) -- 0:00:19
677000 -- (-872.695) (-869.641) (-868.632) [-869.079] * (-868.691) (-868.632) (-870.351) [-868.542] -- 0:00:19
677500 -- (-875.444) (-868.898) (-868.629) [-868.833] * [-871.203] (-871.233) (-872.490) (-870.187) -- 0:00:19
678000 -- (-868.696) (-871.747) [-871.281] (-870.451) * (-867.968) [-869.440] (-872.351) (-868.391) -- 0:00:19
678500 -- (-869.240) [-868.888] (-872.901) (-868.301) * (-868.539) [-868.242] (-875.246) (-870.109) -- 0:00:19
679000 -- (-871.968) (-868.599) (-870.899) [-869.157] * (-871.224) [-868.512] (-873.184) (-872.758) -- 0:00:19
679500 -- (-869.343) (-871.120) [-869.481] (-869.371) * [-868.234] (-871.057) (-873.919) (-872.676) -- 0:00:19
680000 -- (-870.044) (-871.026) [-868.483] (-871.350) * (-869.333) (-870.458) [-869.699] (-871.228) -- 0:00:19
Average standard deviation of split frequencies: 0.008495
680500 -- (-872.020) (-869.591) (-869.502) [-869.999] * (-869.135) (-874.321) (-869.634) [-871.050] -- 0:00:19
681000 -- (-870.437) (-870.108) [-868.218] (-868.295) * (-871.355) (-869.552) [-869.450] (-870.490) -- 0:00:19
681500 -- (-869.681) (-869.959) (-871.823) [-871.314] * (-874.202) (-873.192) (-871.843) [-871.569] -- 0:00:19
682000 -- (-872.769) (-871.024) (-871.653) [-871.449] * [-868.782] (-869.674) (-870.653) (-876.199) -- 0:00:19
682500 -- (-871.645) (-872.111) [-870.888] (-870.567) * (-870.492) (-872.168) (-870.536) [-869.098] -- 0:00:19
683000 -- (-871.878) (-872.064) (-870.784) [-873.701] * [-869.578] (-870.413) (-868.632) (-870.122) -- 0:00:19
683500 -- (-869.790) (-869.764) [-869.906] (-869.715) * (-871.789) (-869.822) (-869.900) [-869.202] -- 0:00:18
684000 -- (-873.294) (-870.344) (-870.621) [-869.592] * (-869.299) [-870.077] (-868.237) (-870.781) -- 0:00:18
684500 -- (-868.501) (-869.754) (-874.329) [-870.567] * (-868.158) (-870.269) [-868.746] (-871.162) -- 0:00:18
685000 -- (-868.361) (-868.215) [-868.796] (-868.771) * (-870.244) [-869.418] (-872.012) (-873.117) -- 0:00:18
Average standard deviation of split frequencies: 0.008704
685500 -- (-868.374) (-868.379) (-868.092) [-868.692] * (-868.705) (-870.668) (-875.434) [-870.710] -- 0:00:18
686000 -- [-869.176] (-870.147) (-877.815) (-870.848) * (-868.645) [-870.484] (-868.180) (-871.610) -- 0:00:18
686500 -- (-871.183) (-872.962) (-874.159) [-870.056] * (-871.447) [-872.681] (-871.408) (-869.594) -- 0:00:18
687000 -- [-871.589] (-871.369) (-871.662) (-869.722) * (-872.775) (-873.665) (-869.908) [-869.693] -- 0:00:18
687500 -- (-870.640) [-869.893] (-872.554) (-874.270) * (-869.631) [-871.310] (-869.440) (-870.857) -- 0:00:18
688000 -- (-870.570) (-869.189) [-869.334] (-870.105) * (-869.397) (-869.193) [-872.641] (-869.770) -- 0:00:18
688500 -- (-869.030) (-870.430) (-869.453) [-876.189] * (-869.875) (-874.137) [-871.193] (-869.431) -- 0:00:18
689000 -- [-868.841] (-872.272) (-870.277) (-873.035) * [-872.493] (-874.346) (-872.247) (-868.687) -- 0:00:18
689500 -- (-869.805) (-871.886) [-868.887] (-872.524) * (-874.268) (-868.151) [-870.548] (-869.825) -- 0:00:18
690000 -- (-873.897) [-869.227] (-872.378) (-870.626) * (-873.108) (-868.557) [-870.493] (-868.819) -- 0:00:18
Average standard deviation of split frequencies: 0.009237
690500 -- (-870.267) (-870.167) (-869.546) [-871.460] * (-868.724) (-868.703) [-868.987] (-869.043) -- 0:00:18
691000 -- (-869.615) [-870.014] (-870.463) (-869.649) * (-869.569) [-869.539] (-869.169) (-869.913) -- 0:00:18
691500 -- (-869.827) [-868.667] (-870.651) (-871.068) * (-870.369) [-870.617] (-871.615) (-875.240) -- 0:00:18
692000 -- (-869.217) (-869.978) [-868.759] (-868.927) * (-873.971) (-869.569) [-870.557] (-875.346) -- 0:00:18
692500 -- (-870.504) [-870.099] (-870.306) (-867.991) * (-869.989) [-870.188] (-872.769) (-877.039) -- 0:00:18
693000 -- (-870.517) (-872.199) (-870.854) [-869.004] * (-870.496) (-870.858) [-870.779] (-872.117) -- 0:00:18
693500 -- (-869.580) (-868.870) [-870.962] (-869.602) * (-871.902) [-872.047] (-868.512) (-869.840) -- 0:00:18
694000 -- (-871.187) (-868.174) [-870.754] (-869.517) * [-869.908] (-869.480) (-868.982) (-869.787) -- 0:00:18
694500 -- [-868.632] (-868.628) (-868.241) (-869.834) * (-872.761) (-870.682) [-869.642] (-870.894) -- 0:00:18
695000 -- (-869.556) (-876.691) [-868.482] (-869.305) * (-868.649) [-870.764] (-871.402) (-871.610) -- 0:00:18
Average standard deviation of split frequencies: 0.009076
695500 -- (-869.093) (-868.120) [-873.863] (-868.985) * (-872.374) (-868.307) (-869.322) [-870.546] -- 0:00:18
696000 -- (-872.797) (-872.042) [-872.157] (-871.185) * (-870.339) (-867.969) (-873.623) [-868.900] -- 0:00:18
696500 -- (-872.084) [-870.179] (-873.943) (-870.497) * (-870.494) (-869.377) [-870.127] (-867.970) -- 0:00:18
697000 -- (-869.893) [-869.830] (-872.720) (-872.943) * (-872.473) (-878.501) (-877.224) [-869.383] -- 0:00:18
697500 -- (-871.002) (-869.615) [-869.871] (-870.038) * (-878.266) (-872.686) [-870.230] (-869.376) -- 0:00:18
698000 -- [-868.858] (-870.202) (-869.624) (-870.897) * (-868.875) (-868.866) (-868.433) [-870.586] -- 0:00:18
698500 -- (-868.158) (-870.449) (-870.048) [-868.302] * (-875.074) (-870.751) [-870.117] (-870.788) -- 0:00:18
699000 -- (-868.590) (-879.716) [-869.119] (-868.074) * (-869.109) (-873.369) (-869.381) [-872.530] -- 0:00:18
699500 -- [-870.883] (-870.091) (-870.978) (-869.622) * [-869.733] (-871.698) (-869.919) (-869.976) -- 0:00:18
700000 -- [-868.951] (-869.450) (-870.105) (-873.132) * (-869.911) [-869.935] (-870.878) (-871.231) -- 0:00:18
Average standard deviation of split frequencies: 0.009105
700500 -- (-872.023) (-871.608) (-869.306) [-869.692] * (-872.335) (-872.115) (-871.461) [-869.758] -- 0:00:17
701000 -- (-871.706) [-870.448] (-869.405) (-869.435) * (-871.764) [-869.687] (-870.539) (-876.203) -- 0:00:17
701500 -- (-870.682) (-868.287) (-868.404) [-869.766] * (-870.507) [-872.450] (-871.376) (-872.149) -- 0:00:17
702000 -- (-870.101) (-868.726) (-869.079) [-868.509] * (-876.488) (-870.637) [-869.881] (-870.297) -- 0:00:17
702500 -- [-869.622] (-873.507) (-868.832) (-871.146) * (-868.845) (-871.585) (-869.235) [-870.996] -- 0:00:17
703000 -- (-870.542) [-870.778] (-870.318) (-868.795) * [-870.272] (-870.941) (-869.480) (-872.268) -- 0:00:17
703500 -- (-869.938) [-870.073] (-868.322) (-868.707) * (-870.848) (-869.249) [-868.234] (-870.744) -- 0:00:17
704000 -- (-870.917) (-870.960) (-868.320) [-869.867] * (-868.622) [-872.046] (-868.252) (-870.913) -- 0:00:17
704500 -- [-870.329] (-869.666) (-868.842) (-869.823) * (-870.747) [-870.019] (-871.957) (-869.746) -- 0:00:17
705000 -- [-870.569] (-872.542) (-868.876) (-870.675) * (-869.050) [-868.759] (-873.841) (-871.849) -- 0:00:17
Average standard deviation of split frequencies: 0.009482
705500 -- (-869.491) [-868.782] (-869.412) (-871.056) * (-868.951) [-868.676] (-869.062) (-871.590) -- 0:00:17
706000 -- (-870.364) (-867.978) (-869.465) [-867.819] * (-868.910) (-870.379) [-870.511] (-868.946) -- 0:00:17
706500 -- (-870.840) (-868.963) [-869.170] (-869.728) * (-869.644) [-869.158] (-869.233) (-870.958) -- 0:00:17
707000 -- [-869.070] (-869.412) (-872.978) (-870.236) * (-871.439) (-871.532) [-868.944] (-874.061) -- 0:00:17
707500 -- [-868.819] (-868.912) (-869.203) (-868.830) * (-870.988) (-871.168) [-869.342] (-871.230) -- 0:00:17
708000 -- (-870.376) [-868.065] (-875.095) (-869.434) * [-871.249] (-870.634) (-870.528) (-869.083) -- 0:00:17
708500 -- (-869.306) (-870.216) (-871.317) [-869.635] * (-868.003) (-871.095) [-868.510] (-875.101) -- 0:00:17
709000 -- (-869.040) [-868.855] (-869.156) (-868.134) * (-869.669) (-872.003) [-868.366] (-870.463) -- 0:00:17
709500 -- (-868.563) [-870.640] (-869.026) (-868.134) * (-873.518) [-870.805] (-870.068) (-869.879) -- 0:00:17
710000 -- [-869.064] (-869.261) (-869.674) (-870.019) * (-877.633) [-868.828] (-869.228) (-871.709) -- 0:00:17
Average standard deviation of split frequencies: 0.009552
710500 -- (-872.188) [-868.517] (-873.258) (-873.791) * (-873.985) (-872.963) (-869.710) [-869.593] -- 0:00:17
711000 -- (-867.955) (-874.853) (-869.379) [-870.240] * (-872.061) [-869.370] (-869.056) (-869.505) -- 0:00:17
711500 -- (-868.465) (-868.303) [-872.199] (-870.493) * (-870.800) (-870.596) (-868.065) [-870.346] -- 0:00:17
712000 -- (-873.178) (-870.773) (-870.836) [-870.920] * [-868.398] (-869.898) (-870.350) (-871.153) -- 0:00:17
712500 -- (-868.819) (-868.891) [-867.991] (-871.443) * (-872.127) [-872.033] (-872.203) (-868.700) -- 0:00:17
713000 -- (-868.819) (-870.703) [-868.723] (-871.049) * (-871.905) (-871.936) (-871.111) [-868.723] -- 0:00:17
713500 -- (-868.564) (-868.419) [-871.737] (-868.088) * (-873.066) (-869.046) [-870.536] (-869.633) -- 0:00:17
714000 -- [-868.808] (-868.505) (-871.072) (-868.319) * [-873.653] (-869.257) (-872.050) (-868.645) -- 0:00:17
714500 -- (-873.782) (-870.029) [-870.370] (-869.145) * [-870.680] (-872.569) (-872.469) (-870.532) -- 0:00:17
715000 -- (-870.165) (-870.336) (-869.666) [-870.126] * (-869.549) (-870.254) [-871.109] (-869.952) -- 0:00:17
Average standard deviation of split frequencies: 0.009612
715500 -- (-869.737) [-869.865] (-869.327) (-874.576) * (-871.291) (-872.974) [-869.736] (-869.424) -- 0:00:17
716000 -- (-870.226) (-869.553) [-870.309] (-869.478) * (-871.402) (-871.651) [-870.972] (-869.651) -- 0:00:17
716500 -- (-874.316) (-869.985) (-873.092) [-870.716] * (-870.672) [-869.098] (-871.267) (-871.197) -- 0:00:17
717000 -- (-878.799) (-870.471) (-874.101) [-872.766] * (-875.226) (-868.297) [-868.711] (-870.298) -- 0:00:16
717500 -- [-869.641] (-871.116) (-874.473) (-868.821) * (-870.324) (-868.386) (-869.390) [-868.299] -- 0:00:16
718000 -- [-869.103] (-870.050) (-872.280) (-869.864) * (-872.450) (-870.145) [-871.030] (-868.103) -- 0:00:16
718500 -- [-869.459] (-878.197) (-874.582) (-869.637) * (-870.651) [-874.923] (-869.862) (-870.676) -- 0:00:16
719000 -- [-868.700] (-877.134) (-870.423) (-870.245) * (-869.659) [-871.399] (-870.367) (-872.031) -- 0:00:16
719500 -- (-872.354) [-871.213] (-868.775) (-871.371) * (-868.739) (-871.667) [-872.389] (-871.314) -- 0:00:16
720000 -- (-872.111) [-872.509] (-868.031) (-877.006) * [-869.236] (-870.512) (-872.097) (-870.459) -- 0:00:16
Average standard deviation of split frequencies: 0.009507
720500 -- (-869.901) (-869.174) [-868.495] (-868.092) * (-872.466) (-869.509) [-868.657] (-872.480) -- 0:00:16
721000 -- (-871.127) [-870.832] (-870.960) (-870.915) * (-870.031) [-868.613] (-869.100) (-870.413) -- 0:00:16
721500 -- (-869.236) (-874.468) (-869.601) [-871.114] * [-869.216] (-868.999) (-873.309) (-869.553) -- 0:00:16
722000 -- (-868.244) [-869.288] (-871.056) (-869.315) * (-872.167) [-870.675] (-876.694) (-871.672) -- 0:00:16
722500 -- [-868.281] (-871.923) (-870.058) (-870.767) * (-870.609) (-868.386) [-871.465] (-873.917) -- 0:00:16
723000 -- (-868.726) (-871.981) (-868.392) [-870.327] * (-870.454) (-873.269) (-868.995) [-868.889] -- 0:00:16
723500 -- [-868.107] (-869.927) (-868.938) (-869.946) * (-870.111) [-868.443] (-869.078) (-869.660) -- 0:00:16
724000 -- (-868.530) [-869.820] (-870.097) (-873.879) * (-870.993) (-869.190) (-868.505) [-867.989] -- 0:00:16
724500 -- (-868.415) (-869.208) [-869.430] (-872.518) * (-872.663) (-869.743) (-868.530) [-870.064] -- 0:00:16
725000 -- (-869.198) (-869.053) [-868.198] (-870.963) * [-872.879] (-870.006) (-871.827) (-871.466) -- 0:00:16
Average standard deviation of split frequencies: 0.010086
725500 -- (-872.729) (-874.428) (-868.914) [-871.753] * (-875.601) (-869.116) (-870.253) [-872.638] -- 0:00:16
726000 -- (-869.678) (-869.948) (-869.615) [-871.275] * (-870.802) [-868.933] (-871.475) (-869.146) -- 0:00:16
726500 -- (-870.773) [-869.182] (-869.109) (-868.760) * (-873.228) (-868.682) [-868.491] (-870.978) -- 0:00:16
727000 -- (-871.080) [-868.719] (-870.223) (-870.004) * (-870.983) (-869.533) [-871.718] (-870.611) -- 0:00:16
727500 -- (-869.039) [-867.803] (-870.485) (-872.248) * (-868.231) (-872.430) [-869.838] (-869.390) -- 0:00:16
728000 -- (-869.283) (-867.837) [-869.439] (-871.062) * [-867.983] (-867.752) (-868.684) (-869.331) -- 0:00:16
728500 -- (-870.140) (-870.095) [-872.391] (-872.225) * (-869.203) (-868.606) (-873.046) [-868.407] -- 0:00:16
729000 -- [-869.828] (-868.952) (-870.633) (-870.212) * (-868.030) (-869.012) [-871.035] (-871.293) -- 0:00:16
729500 -- (-869.937) (-871.426) (-870.760) [-869.984] * (-868.040) [-869.022] (-869.702) (-868.879) -- 0:00:16
730000 -- (-869.472) [-869.285] (-872.738) (-868.976) * (-868.020) (-868.857) [-870.336] (-868.065) -- 0:00:16
Average standard deviation of split frequencies: 0.009635
730500 -- (-874.657) [-868.263] (-868.756) (-870.283) * (-869.101) [-868.974] (-868.437) (-871.397) -- 0:00:16
731000 -- (-871.601) (-869.528) [-868.303] (-869.651) * (-869.615) [-870.512] (-869.117) (-871.348) -- 0:00:16
731500 -- (-871.733) [-870.731] (-869.808) (-869.371) * (-876.396) [-871.515] (-869.071) (-868.676) -- 0:00:16
732000 -- (-872.527) (-871.014) (-869.993) [-868.815] * (-871.873) (-870.155) (-870.156) [-875.191] -- 0:00:16
732500 -- (-868.749) (-871.299) [-869.542] (-868.390) * (-874.462) [-870.391] (-867.791) (-870.135) -- 0:00:16
733000 -- (-868.043) (-873.018) (-871.102) [-868.908] * (-872.177) (-873.590) [-868.853] (-869.671) -- 0:00:16
733500 -- (-871.474) [-869.494] (-868.950) (-873.733) * (-869.573) (-869.727) (-868.437) [-868.946] -- 0:00:15
734000 -- [-868.529] (-869.202) (-869.542) (-871.256) * [-870.775] (-869.476) (-870.819) (-869.703) -- 0:00:15
734500 -- (-873.171) [-870.582] (-870.182) (-869.562) * [-870.556] (-868.247) (-873.444) (-869.343) -- 0:00:15
735000 -- [-869.681] (-870.402) (-876.139) (-871.208) * (-870.809) [-869.044] (-869.622) (-869.616) -- 0:00:15
Average standard deviation of split frequencies: 0.009778
735500 -- [-869.868] (-867.895) (-872.936) (-870.130) * [-870.039] (-872.328) (-868.578) (-869.995) -- 0:00:15
736000 -- (-871.991) [-868.878] (-868.675) (-870.284) * [-870.170] (-869.837) (-869.525) (-869.466) -- 0:00:15
736500 -- [-871.706] (-868.672) (-869.330) (-869.024) * (-871.419) [-870.976] (-869.649) (-869.192) -- 0:00:15
737000 -- (-869.666) [-868.424] (-869.368) (-868.654) * (-869.075) (-868.900) (-876.070) [-869.643] -- 0:00:15
737500 -- (-872.240) (-868.190) (-870.802) [-870.928] * (-873.429) (-871.199) (-869.107) [-869.047] -- 0:00:15
738000 -- (-873.310) (-869.980) [-868.192] (-871.390) * [-870.985] (-872.586) (-869.372) (-871.714) -- 0:00:15
738500 -- [-872.497] (-869.612) (-869.657) (-871.679) * (-870.082) (-871.435) (-870.026) [-869.534] -- 0:00:15
739000 -- (-867.939) (-871.168) (-868.826) [-870.377] * (-870.162) [-867.880] (-869.830) (-869.400) -- 0:00:15
739500 -- (-868.010) (-869.873) (-870.138) [-870.878] * (-869.209) (-868.805) [-872.246] (-871.546) -- 0:00:15
740000 -- [-871.399] (-872.718) (-872.241) (-868.963) * (-870.680) [-869.909] (-870.404) (-872.989) -- 0:00:15
Average standard deviation of split frequencies: 0.009632
740500 -- (-869.221) (-872.694) (-873.204) [-869.781] * (-870.214) (-868.996) (-869.161) [-870.797] -- 0:00:15
741000 -- (-873.506) (-872.393) (-872.891) [-867.837] * (-870.790) (-868.343) (-871.124) [-868.793] -- 0:00:15
741500 -- (-872.857) [-869.773] (-872.076) (-867.883) * (-870.222) [-869.218] (-870.433) (-868.800) -- 0:00:15
742000 -- (-868.753) [-871.142] (-872.148) (-868.024) * [-869.968] (-869.356) (-870.385) (-871.686) -- 0:00:15
742500 -- (-869.767) [-873.410] (-869.085) (-871.070) * (-868.968) (-868.376) (-872.133) [-869.944] -- 0:00:15
743000 -- (-870.752) (-869.590) [-869.242] (-868.258) * (-867.638) (-868.748) [-868.150] (-871.577) -- 0:00:15
743500 -- (-870.524) (-869.708) [-869.376] (-870.837) * [-871.341] (-868.498) (-869.004) (-871.275) -- 0:00:15
744000 -- (-870.692) (-870.273) [-868.791] (-868.637) * [-868.982] (-870.228) (-871.789) (-871.373) -- 0:00:15
744500 -- (-874.584) [-870.925] (-869.992) (-869.769) * (-871.706) (-869.994) (-868.636) [-871.448] -- 0:00:15
745000 -- (-874.386) [-871.216] (-869.884) (-870.435) * (-872.293) (-869.359) (-869.027) [-869.960] -- 0:00:15
Average standard deviation of split frequencies: 0.009521
745500 -- (-868.609) (-870.713) [-869.789] (-871.887) * (-870.801) [-871.804] (-870.975) (-869.406) -- 0:00:15
746000 -- [-871.590] (-871.086) (-870.184) (-872.846) * [-868.188] (-869.053) (-869.576) (-870.438) -- 0:00:15
746500 -- (-870.022) (-871.833) [-868.743] (-872.386) * [-875.437] (-868.969) (-872.138) (-870.536) -- 0:00:15
747000 -- (-869.603) (-870.355) (-868.702) [-870.734] * (-871.579) [-871.715] (-870.355) (-872.677) -- 0:00:15
747500 -- (-868.380) (-871.086) (-870.875) [-872.147] * (-871.654) (-873.315) [-869.591] (-871.880) -- 0:00:15
748000 -- (-867.706) (-870.419) (-868.894) [-870.668] * (-870.801) [-872.787] (-871.738) (-870.894) -- 0:00:15
748500 -- (-867.706) [-870.648] (-868.388) (-869.467) * (-870.669) [-870.980] (-877.357) (-870.536) -- 0:00:15
749000 -- (-867.706) (-870.369) [-869.258] (-868.843) * (-871.654) (-870.228) [-869.868] (-869.148) -- 0:00:15
749500 -- (-871.599) (-868.681) [-869.130] (-869.782) * (-870.347) (-869.432) (-869.398) [-868.529] -- 0:00:15
750000 -- (-870.327) (-868.746) [-874.093] (-871.384) * (-872.396) [-869.797] (-869.852) (-869.730) -- 0:00:15
Average standard deviation of split frequencies: 0.009503
750500 -- (-871.082) (-868.769) [-870.280] (-871.780) * (-870.910) (-870.239) (-869.621) [-869.258] -- 0:00:14
751000 -- [-869.450] (-869.486) (-873.511) (-871.174) * (-869.408) [-870.223] (-871.523) (-871.021) -- 0:00:14
751500 -- (-871.587) [-871.235] (-874.965) (-869.702) * [-869.757] (-868.902) (-869.177) (-870.802) -- 0:00:14
752000 -- (-869.294) (-871.958) (-869.465) [-870.874] * (-869.630) (-868.114) [-871.899] (-870.601) -- 0:00:14
752500 -- (-870.281) (-870.349) (-869.912) [-868.445] * [-869.742] (-872.438) (-869.943) (-868.625) -- 0:00:14
753000 -- [-868.715] (-869.275) (-874.049) (-871.252) * (-868.327) (-868.891) [-869.909] (-868.304) -- 0:00:14
753500 -- (-868.518) (-870.151) [-870.094] (-869.066) * [-872.516] (-870.245) (-873.652) (-868.015) -- 0:00:14
754000 -- (-869.364) [-870.311] (-871.773) (-870.044) * (-870.712) (-874.711) [-869.523] (-874.037) -- 0:00:14
754500 -- (-869.032) [-871.015] (-880.070) (-870.704) * (-873.030) [-871.217] (-869.946) (-870.968) -- 0:00:14
755000 -- (-870.306) [-868.555] (-874.231) (-870.575) * (-868.848) (-867.958) (-869.556) [-869.773] -- 0:00:14
Average standard deviation of split frequencies: 0.009769
755500 -- [-871.730] (-870.748) (-871.388) (-868.901) * (-875.195) [-868.453] (-871.183) (-868.529) -- 0:00:14
756000 -- [-871.409] (-869.514) (-870.057) (-868.644) * [-868.001] (-868.775) (-872.171) (-868.730) -- 0:00:14
756500 -- (-872.680) (-870.849) [-871.263] (-868.798) * [-869.494] (-870.511) (-876.936) (-868.935) -- 0:00:14
757000 -- (-870.909) (-870.661) [-868.475] (-869.918) * (-870.138) [-869.235] (-871.296) (-869.582) -- 0:00:14
757500 -- (-870.349) [-868.609] (-868.501) (-869.220) * [-870.560] (-870.515) (-868.243) (-869.195) -- 0:00:14
758000 -- (-871.923) [-868.765] (-868.817) (-872.365) * (-871.803) (-870.169) [-867.734] (-869.240) -- 0:00:14
758500 -- (-871.969) [-868.190] (-872.452) (-869.934) * (-872.799) [-869.666] (-867.720) (-872.048) -- 0:00:14
759000 -- (-870.818) (-869.928) (-868.492) [-869.240] * (-869.399) (-871.404) (-868.691) [-870.453] -- 0:00:14
759500 -- (-871.080) (-869.219) [-869.295] (-868.907) * (-871.853) (-871.695) [-873.305] (-872.166) -- 0:00:14
760000 -- (-868.508) (-870.712) (-872.934) [-869.701] * (-869.276) (-870.110) [-871.421] (-871.929) -- 0:00:14
Average standard deviation of split frequencies: 0.009833
760500 -- (-869.733) [-874.439] (-872.233) (-874.808) * (-869.096) (-871.134) (-869.790) [-870.510] -- 0:00:14
761000 -- (-870.745) (-869.082) (-868.893) [-870.784] * (-869.222) [-869.587] (-869.725) (-868.311) -- 0:00:14
761500 -- (-869.170) [-869.138] (-871.719) (-870.798) * (-870.906) (-869.520) [-872.031] (-868.069) -- 0:00:14
762000 -- [-868.299] (-869.741) (-869.676) (-872.263) * (-871.073) (-868.826) (-871.945) [-869.720] -- 0:00:14
762500 -- (-868.094) (-868.789) [-874.897] (-872.260) * (-872.946) (-869.963) (-873.016) [-871.838] -- 0:00:14
763000 -- [-868.158] (-869.545) (-874.066) (-868.707) * (-868.253) (-868.798) (-869.764) [-872.242] -- 0:00:14
763500 -- [-868.376] (-868.849) (-873.363) (-869.504) * (-872.052) (-874.215) (-869.511) [-871.194] -- 0:00:14
764000 -- (-873.500) (-870.446) [-868.779] (-869.729) * (-869.100) [-872.680] (-873.633) (-871.564) -- 0:00:14
764500 -- (-868.686) (-868.952) (-874.677) [-870.802] * (-868.575) (-871.405) (-868.415) [-871.280] -- 0:00:14
765000 -- (-869.358) (-870.351) (-872.189) [-871.654] * (-869.762) (-869.310) [-872.942] (-868.497) -- 0:00:14
Average standard deviation of split frequencies: 0.010134
765500 -- (-869.151) [-870.529] (-871.350) (-872.712) * (-870.353) (-872.904) (-868.841) [-868.794] -- 0:00:14
766000 -- [-870.795] (-873.892) (-870.117) (-876.114) * [-869.419] (-871.541) (-870.049) (-870.926) -- 0:00:14
766500 -- (-870.247) (-872.410) (-868.869) [-872.559] * (-875.034) (-871.439) (-871.995) [-868.659] -- 0:00:14
767000 -- (-870.214) [-871.509] (-868.666) (-872.369) * (-869.803) (-872.898) (-874.713) [-868.755] -- 0:00:13
767500 -- (-868.808) [-868.325] (-872.476) (-871.040) * [-868.866] (-868.479) (-872.687) (-871.622) -- 0:00:13
768000 -- [-868.888] (-871.313) (-871.685) (-869.690) * [-869.061] (-871.683) (-870.648) (-867.918) -- 0:00:13
768500 -- [-868.827] (-868.853) (-871.383) (-872.105) * (-870.380) (-872.045) [-868.291] (-869.906) -- 0:00:13
769000 -- (-871.191) (-869.159) [-869.632] (-870.812) * (-871.500) [-868.352] (-870.418) (-872.414) -- 0:00:13
769500 -- (-870.009) (-870.169) (-873.258) [-870.591] * [-869.066] (-868.810) (-871.709) (-869.352) -- 0:00:13
770000 -- (-876.854) [-871.926] (-871.221) (-870.122) * (-869.286) (-868.878) [-869.591] (-872.229) -- 0:00:13
Average standard deviation of split frequencies: 0.010072
770500 -- (-875.606) (-870.746) [-872.606] (-874.937) * (-870.216) [-868.481] (-870.817) (-870.671) -- 0:00:13
771000 -- (-873.852) [-870.665] (-873.169) (-869.745) * [-871.099] (-871.292) (-872.323) (-869.855) -- 0:00:13
771500 -- [-868.990] (-871.288) (-870.536) (-870.165) * (-871.426) [-868.444] (-869.136) (-870.147) -- 0:00:13
772000 -- [-872.285] (-869.746) (-868.798) (-870.269) * (-875.657) (-868.782) [-870.207] (-869.268) -- 0:00:13
772500 -- (-868.078) [-871.243] (-871.726) (-869.457) * (-875.426) (-869.172) (-876.865) [-868.401] -- 0:00:13
773000 -- [-870.831] (-872.782) (-871.254) (-869.151) * (-869.655) (-871.424) (-869.660) [-868.491] -- 0:00:13
773500 -- [-870.464] (-870.249) (-875.205) (-868.007) * (-874.776) (-869.074) [-870.003] (-868.734) -- 0:00:13
774000 -- [-871.040] (-869.475) (-871.104) (-868.957) * (-871.368) (-869.964) [-872.723] (-871.984) -- 0:00:13
774500 -- [-872.012] (-868.442) (-872.169) (-871.594) * (-871.120) (-875.157) [-873.863] (-869.600) -- 0:00:13
775000 -- [-873.953] (-869.944) (-871.118) (-871.253) * (-871.426) (-871.323) [-868.824] (-868.298) -- 0:00:13
Average standard deviation of split frequencies: 0.009882
775500 -- (-869.202) [-870.844] (-870.237) (-868.823) * (-869.167) [-868.464] (-868.258) (-867.981) -- 0:00:13
776000 -- [-868.873] (-869.067) (-871.975) (-869.331) * (-873.036) [-876.185] (-868.954) (-867.947) -- 0:00:13
776500 -- (-868.310) (-869.042) (-869.227) [-868.381] * (-875.901) (-875.319) [-869.885] (-874.580) -- 0:00:13
777000 -- (-868.976) [-869.635] (-868.421) (-870.742) * (-873.388) (-869.932) [-870.646] (-875.415) -- 0:00:13
777500 -- (-872.624) (-873.914) [-868.390] (-873.574) * (-872.247) [-869.565] (-869.429) (-868.944) -- 0:00:13
778000 -- (-873.238) [-870.436] (-868.719) (-869.722) * (-870.111) [-868.988] (-869.695) (-868.722) -- 0:00:13
778500 -- (-870.371) (-871.351) [-869.083] (-869.100) * [-870.292] (-874.075) (-870.035) (-871.744) -- 0:00:13
779000 -- [-870.680] (-869.380) (-869.454) (-868.975) * [-870.057] (-872.190) (-868.852) (-871.471) -- 0:00:13
779500 -- (-869.998) [-869.109] (-870.338) (-868.564) * [-870.872] (-870.208) (-869.515) (-871.242) -- 0:00:13
780000 -- (-870.238) [-869.598] (-871.577) (-869.536) * (-872.655) (-869.456) (-868.858) [-869.276] -- 0:00:13
Average standard deviation of split frequencies: 0.009541
780500 -- (-869.777) (-872.146) [-871.754] (-870.360) * (-870.756) [-869.310] (-869.523) (-870.691) -- 0:00:13
781000 -- (-869.331) [-869.032] (-868.689) (-870.244) * (-867.861) (-868.283) [-869.952] (-872.004) -- 0:00:13
781500 -- (-873.043) (-870.845) (-868.536) [-868.440] * (-877.110) [-870.847] (-872.168) (-872.306) -- 0:00:13
782000 -- (-869.621) [-870.237] (-868.403) (-867.893) * [-869.911] (-869.549) (-868.882) (-874.326) -- 0:00:13
782500 -- (-868.841) [-870.360] (-870.449) (-870.748) * (-872.555) [-869.833] (-879.606) (-870.916) -- 0:00:13
783000 -- (-870.662) (-870.609) [-871.246] (-874.768) * (-871.749) (-871.352) (-872.098) [-868.018] -- 0:00:13
783500 -- (-873.246) (-869.228) [-868.891] (-872.827) * [-870.661] (-869.804) (-872.166) (-870.656) -- 0:00:12
784000 -- (-871.258) (-873.627) (-870.769) [-870.671] * (-871.351) (-875.229) [-873.504] (-868.646) -- 0:00:12
784500 -- (-869.929) (-868.385) [-868.598] (-869.705) * (-873.010) (-868.611) [-868.736] (-868.324) -- 0:00:12
785000 -- (-872.849) (-868.498) [-869.370] (-871.851) * (-869.152) (-874.341) (-868.702) [-869.307] -- 0:00:12
Average standard deviation of split frequencies: 0.009316
785500 -- (-868.491) (-870.426) [-869.291] (-869.522) * (-873.544) (-870.831) [-870.868] (-868.477) -- 0:00:12
786000 -- (-873.417) (-870.783) [-872.705] (-870.366) * [-870.171] (-869.868) (-869.874) (-870.624) -- 0:00:12
786500 -- (-871.640) (-871.198) [-868.799] (-870.697) * (-870.203) (-870.136) (-870.970) [-870.059] -- 0:00:12
787000 -- (-870.902) (-869.186) [-868.403] (-870.146) * (-868.653) (-870.619) [-868.230] (-872.692) -- 0:00:12
787500 -- (-870.868) (-871.414) (-868.635) [-869.091] * (-868.757) [-870.264] (-872.385) (-869.188) -- 0:00:12
788000 -- (-871.696) (-871.826) (-868.971) [-869.833] * [-868.406] (-869.846) (-868.193) (-869.475) -- 0:00:12
788500 -- (-872.684) (-870.187) [-869.146] (-873.248) * (-869.516) (-870.650) [-870.250] (-873.767) -- 0:00:12
789000 -- (-871.992) (-870.076) [-868.340] (-868.853) * [-867.971] (-870.491) (-870.123) (-870.967) -- 0:00:12
789500 -- (-876.534) (-869.752) (-872.826) [-870.512] * [-868.738] (-871.321) (-869.055) (-869.631) -- 0:00:12
790000 -- [-868.231] (-869.908) (-870.247) (-869.754) * (-870.788) (-872.314) (-869.486) [-870.320] -- 0:00:12
Average standard deviation of split frequencies: 0.009182
790500 -- (-870.046) (-868.390) [-868.793] (-870.351) * (-868.890) (-869.281) [-868.612] (-868.652) -- 0:00:12
791000 -- [-869.264] (-871.013) (-869.565) (-868.870) * (-869.825) [-869.353] (-873.070) (-868.689) -- 0:00:12
791500 -- (-870.666) (-869.867) (-868.322) [-869.280] * (-868.882) (-869.492) (-871.772) [-868.236] -- 0:00:12
792000 -- [-868.702] (-868.247) (-869.392) (-870.761) * (-870.520) (-869.591) [-872.251] (-871.960) -- 0:00:12
792500 -- (-868.819) (-871.352) [-868.305] (-869.074) * (-871.590) (-871.337) [-872.267] (-869.838) -- 0:00:12
793000 -- (-869.263) [-868.797] (-869.737) (-868.467) * [-868.687] (-870.565) (-871.564) (-868.517) -- 0:00:12
793500 -- (-868.413) [-869.729] (-872.713) (-869.856) * (-874.142) (-872.174) [-869.738] (-869.229) -- 0:00:12
794000 -- (-869.208) (-868.025) (-872.461) [-871.322] * (-871.998) (-868.807) [-870.451] (-870.018) -- 0:00:12
794500 -- (-872.689) (-869.825) [-870.185] (-871.812) * (-871.630) [-868.620] (-872.886) (-870.273) -- 0:00:12
795000 -- [-870.177] (-871.463) (-868.141) (-870.105) * [-870.303] (-869.493) (-870.132) (-870.582) -- 0:00:12
Average standard deviation of split frequencies: 0.009397
795500 -- (-869.289) (-871.385) (-867.989) [-870.419] * [-869.803] (-868.495) (-871.249) (-871.232) -- 0:00:12
796000 -- (-868.811) (-871.397) [-869.102] (-870.934) * (-870.493) (-868.134) [-869.418] (-870.731) -- 0:00:12
796500 -- [-868.908] (-871.384) (-869.209) (-870.955) * (-870.116) [-869.145] (-869.399) (-869.192) -- 0:00:12
797000 -- (-868.859) [-867.801] (-868.198) (-869.921) * [-871.472] (-873.164) (-871.114) (-872.353) -- 0:00:12
797500 -- [-874.234] (-868.383) (-872.167) (-870.549) * (-869.622) (-871.670) (-868.660) [-870.318] -- 0:00:12
798000 -- (-869.081) (-869.783) [-870.457] (-870.226) * (-873.187) [-868.376] (-870.829) (-869.885) -- 0:00:12
798500 -- (-869.307) (-869.143) (-872.553) [-869.412] * (-869.037) [-871.118] (-869.213) (-870.922) -- 0:00:12
799000 -- (-870.735) [-870.051] (-869.643) (-871.139) * [-870.443] (-869.851) (-869.583) (-872.706) -- 0:00:12
799500 -- [-868.850] (-871.906) (-869.959) (-870.669) * (-867.847) (-869.792) [-869.671] (-872.599) -- 0:00:12
800000 -- (-869.687) (-872.555) [-868.399] (-874.416) * (-868.732) [-869.291] (-868.808) (-870.919) -- 0:00:12
Average standard deviation of split frequencies: 0.009931
800500 -- [-869.347] (-869.604) (-868.932) (-870.234) * (-870.690) (-870.561) [-868.309] (-873.690) -- 0:00:11
801000 -- (-869.763) (-868.955) [-869.060] (-869.478) * (-873.230) (-870.633) (-868.815) [-869.687] -- 0:00:11
801500 -- (-870.032) (-870.091) [-869.573] (-874.156) * [-874.592] (-872.108) (-868.902) (-868.232) -- 0:00:11
802000 -- (-869.090) (-870.507) [-868.316] (-874.262) * (-869.186) (-869.955) [-868.912] (-871.140) -- 0:00:11
802500 -- (-872.220) (-872.466) [-869.492] (-872.492) * (-869.108) [-868.569] (-868.669) (-870.203) -- 0:00:11
803000 -- (-870.191) (-869.069) (-869.899) [-870.911] * (-870.433) (-870.389) [-870.873] (-872.760) -- 0:00:11
803500 -- (-868.558) (-870.095) [-869.855] (-875.321) * (-870.886) (-873.796) (-870.811) [-869.868] -- 0:00:11
804000 -- [-867.975] (-868.559) (-869.771) (-873.301) * [-871.103] (-869.011) (-871.097) (-869.798) -- 0:00:11
804500 -- [-870.105] (-868.761) (-869.722) (-870.703) * (-871.531) (-868.191) (-868.443) [-868.097] -- 0:00:11
805000 -- (-869.376) (-875.576) [-870.935] (-870.271) * (-871.346) [-869.243] (-869.092) (-871.316) -- 0:00:11
Average standard deviation of split frequencies: 0.009255
805500 -- (-868.226) (-868.844) [-871.410] (-872.550) * (-869.991) (-870.433) (-875.719) [-869.904] -- 0:00:11
806000 -- [-868.509] (-869.085) (-869.556) (-871.884) * [-868.498] (-874.412) (-868.945) (-870.179) -- 0:00:11
806500 -- (-875.674) (-869.770) (-868.176) [-869.078] * (-868.482) (-873.195) (-872.242) [-869.452] -- 0:00:11
807000 -- (-873.906) (-870.021) (-868.515) [-870.336] * (-868.358) [-872.400] (-869.053) (-872.000) -- 0:00:11
807500 -- (-873.002) (-868.933) (-868.632) [-871.100] * (-868.291) (-870.761) [-868.662] (-869.899) -- 0:00:11
808000 -- (-868.424) (-868.310) (-867.901) [-868.798] * (-872.065) [-869.524] (-869.825) (-871.204) -- 0:00:11
808500 -- (-868.789) (-868.390) (-868.661) [-869.447] * [-872.200] (-871.510) (-874.471) (-870.151) -- 0:00:11
809000 -- (-868.894) (-869.691) [-870.583] (-871.723) * [-870.374] (-869.474) (-869.879) (-869.195) -- 0:00:11
809500 -- (-869.999) (-868.526) [-871.733] (-868.426) * (-875.961) (-872.280) [-869.886] (-868.506) -- 0:00:11
810000 -- (-868.457) (-872.504) (-874.963) [-868.725] * (-868.203) [-870.417] (-869.645) (-869.473) -- 0:00:11
Average standard deviation of split frequencies: 0.009133
810500 -- (-876.189) (-872.767) (-869.958) [-870.520] * (-868.144) (-869.903) [-868.234] (-870.203) -- 0:00:11
811000 -- (-869.842) (-870.913) [-869.093] (-872.526) * (-868.440) (-876.603) [-868.723] (-870.059) -- 0:00:11
811500 -- (-871.736) (-870.199) [-869.831] (-867.872) * (-874.060) [-870.590] (-874.961) (-869.297) -- 0:00:11
812000 -- (-868.796) (-870.999) [-869.654] (-868.171) * (-868.260) [-872.769] (-873.130) (-876.099) -- 0:00:11
812500 -- (-870.035) (-870.356) [-870.523] (-867.939) * [-868.548] (-872.030) (-869.414) (-875.280) -- 0:00:11
813000 -- (-869.062) (-869.352) [-870.326] (-868.899) * (-869.519) (-869.147) (-868.495) [-872.987] -- 0:00:11
813500 -- (-870.936) (-871.855) (-870.002) [-871.871] * (-871.254) [-868.370] (-871.170) (-871.474) -- 0:00:11
814000 -- [-870.934] (-871.183) (-869.149) (-870.205) * [-871.732] (-870.642) (-869.583) (-872.500) -- 0:00:11
814500 -- (-873.694) [-869.340] (-872.648) (-870.003) * (-869.132) [-868.923] (-872.597) (-868.749) -- 0:00:11
815000 -- [-868.413] (-870.523) (-870.407) (-870.859) * (-871.397) (-868.882) [-868.307] (-872.065) -- 0:00:11
Average standard deviation of split frequencies: 0.008801
815500 -- [-870.585] (-872.278) (-870.052) (-870.236) * (-870.271) (-870.599) [-869.078] (-870.850) -- 0:00:11
816000 -- [-870.384] (-870.842) (-869.560) (-871.009) * (-868.608) (-869.841) [-868.479] (-869.736) -- 0:00:11
816500 -- (-872.593) (-871.848) [-871.305] (-877.302) * [-869.053] (-868.910) (-870.094) (-870.962) -- 0:00:11
817000 -- [-870.444] (-869.426) (-870.137) (-870.731) * (-869.087) (-869.868) [-869.054] (-870.173) -- 0:00:10
817500 -- (-869.689) (-870.047) (-873.130) [-868.832] * (-871.509) (-871.236) (-872.066) [-871.847] -- 0:00:10
818000 -- (-869.618) (-870.031) (-868.543) [-869.093] * (-872.125) [-869.599] (-874.092) (-870.301) -- 0:00:10
818500 -- (-869.637) (-870.493) (-868.930) [-869.736] * (-868.899) (-869.312) (-874.218) [-869.120] -- 0:00:10
819000 -- (-868.559) (-869.708) [-868.933] (-870.355) * [-871.054] (-870.631) (-873.027) (-870.048) -- 0:00:10
819500 -- (-868.903) (-872.596) [-868.983] (-873.913) * (-869.074) (-870.594) (-871.322) [-869.300] -- 0:00:10
820000 -- (-877.080) (-868.669) [-868.788] (-878.664) * (-869.462) (-870.062) [-869.907] (-870.639) -- 0:00:10
Average standard deviation of split frequencies: 0.009152
820500 -- (-867.846) (-868.602) (-870.957) [-875.059] * (-868.916) (-870.376) (-870.743) [-868.335] -- 0:00:10
821000 -- (-871.063) (-870.621) [-868.423] (-876.939) * [-870.317] (-869.100) (-868.919) (-868.776) -- 0:00:10
821500 -- [-869.848] (-870.738) (-870.967) (-872.762) * [-869.032] (-870.912) (-869.394) (-868.073) -- 0:00:10
822000 -- (-871.781) (-870.587) [-868.810] (-869.992) * (-870.836) (-867.825) (-870.195) [-868.777] -- 0:00:10
822500 -- (-873.763) (-870.562) (-869.833) [-868.702] * (-871.570) (-869.320) (-869.195) [-867.737] -- 0:00:10
823000 -- (-875.563) (-869.029) (-869.179) [-868.781] * (-868.264) (-873.854) (-869.421) [-868.475] -- 0:00:10
823500 -- (-876.690) [-869.760] (-870.373) (-873.549) * (-869.263) [-870.311] (-868.959) (-872.379) -- 0:00:10
824000 -- (-869.129) (-871.268) [-869.987] (-868.578) * (-869.313) (-874.680) (-869.326) [-870.933] -- 0:00:10
824500 -- (-871.690) [-871.339] (-869.821) (-869.873) * [-871.066] (-873.790) (-868.542) (-870.293) -- 0:00:10
825000 -- [-870.309] (-869.181) (-870.512) (-869.931) * (-870.068) (-869.015) (-869.950) [-869.093] -- 0:00:10
Average standard deviation of split frequencies: 0.009167
825500 -- [-869.135] (-871.503) (-871.936) (-870.189) * (-870.512) (-870.438) [-869.276] (-869.596) -- 0:00:10
826000 -- (-872.051) (-868.831) [-871.381] (-870.956) * [-869.744] (-869.401) (-871.006) (-870.834) -- 0:00:10
826500 -- [-870.075] (-868.889) (-870.582) (-868.107) * [-869.410] (-872.682) (-874.672) (-869.832) -- 0:00:10
827000 -- (-872.161) (-868.869) (-870.161) [-870.761] * [-871.063] (-869.240) (-875.865) (-874.543) -- 0:00:10
827500 -- (-868.899) [-872.323] (-868.506) (-871.549) * [-870.570] (-868.735) (-870.216) (-869.136) -- 0:00:10
828000 -- (-869.940) [-870.511] (-868.164) (-870.247) * (-869.656) (-869.817) [-869.699] (-872.534) -- 0:00:10
828500 -- [-876.360] (-870.759) (-878.357) (-870.442) * [-873.195] (-868.730) (-868.303) (-875.257) -- 0:00:10
829000 -- (-874.834) [-868.876] (-870.741) (-869.104) * (-868.915) (-869.297) [-871.642] (-870.247) -- 0:00:10
829500 -- (-869.076) (-870.251) (-873.772) [-871.854] * (-868.574) [-869.883] (-870.366) (-870.952) -- 0:00:10
830000 -- [-868.570] (-876.796) (-868.468) (-870.220) * (-873.311) [-874.005] (-869.908) (-870.933) -- 0:00:10
Average standard deviation of split frequencies: 0.009435
830500 -- (-870.914) [-870.010] (-868.810) (-869.324) * (-871.304) (-877.078) [-871.167] (-868.033) -- 0:00:10
831000 -- (-872.394) (-871.006) [-871.514] (-870.276) * (-872.422) (-868.288) (-870.082) [-868.774] -- 0:00:10
831500 -- (-870.776) (-872.102) [-871.966] (-868.142) * (-874.779) [-869.557] (-868.248) (-870.166) -- 0:00:10
832000 -- (-871.051) [-869.890] (-870.015) (-869.356) * (-875.514) [-872.738] (-872.198) (-870.274) -- 0:00:10
832500 -- [-868.258] (-872.330) (-869.051) (-869.546) * (-870.924) (-868.798) (-869.972) [-870.313] -- 0:00:10
833000 -- [-868.127] (-872.111) (-869.350) (-869.854) * (-871.461) (-870.906) [-868.010] (-869.081) -- 0:00:10
833500 -- (-872.533) (-869.347) (-874.143) [-871.657] * (-872.157) [-869.422] (-869.807) (-873.912) -- 0:00:09
834000 -- [-869.245] (-868.772) (-872.980) (-869.901) * (-870.413) [-870.267] (-868.835) (-872.637) -- 0:00:09
834500 -- (-870.767) (-871.407) (-872.942) [-870.681] * [-868.979] (-873.466) (-870.240) (-874.068) -- 0:00:09
835000 -- [-869.035] (-869.524) (-870.110) (-872.412) * (-871.323) [-871.621] (-869.626) (-869.027) -- 0:00:09
Average standard deviation of split frequencies: 0.009375
835500 -- (-868.851) [-868.585] (-870.468) (-872.956) * [-869.858] (-869.663) (-868.854) (-870.115) -- 0:00:09
836000 -- (-869.481) [-869.693] (-869.734) (-870.992) * [-867.987] (-869.353) (-868.871) (-870.942) -- 0:00:09
836500 -- (-869.942) (-874.101) (-868.243) [-868.639] * (-870.697) (-868.681) (-870.345) [-870.338] -- 0:00:09
837000 -- (-869.887) (-870.471) (-868.155) [-868.760] * (-869.393) (-871.739) (-868.305) [-870.937] -- 0:00:09
837500 -- (-868.936) (-870.058) (-872.842) [-870.357] * (-872.674) (-871.998) (-868.469) [-870.409] -- 0:00:09
838000 -- (-868.257) (-868.629) [-872.496] (-870.283) * (-869.237) [-871.568] (-870.004) (-868.546) -- 0:00:09
838500 -- [-868.152] (-868.626) (-870.040) (-869.810) * (-871.330) (-870.729) (-871.995) [-868.822] -- 0:00:09
839000 -- (-869.809) [-869.524] (-868.853) (-869.287) * [-868.547] (-868.476) (-874.679) (-873.097) -- 0:00:09
839500 -- (-868.172) (-869.763) (-868.949) [-867.948] * (-868.023) (-869.008) (-869.392) [-870.952] -- 0:00:09
840000 -- (-871.115) (-869.490) (-869.207) [-871.010] * [-868.275] (-868.461) (-871.529) (-870.992) -- 0:00:09
Average standard deviation of split frequencies: 0.009358
840500 -- [-869.249] (-870.732) (-869.393) (-870.613) * (-872.976) (-868.641) (-870.261) [-869.996] -- 0:00:09
841000 -- [-869.197] (-870.198) (-870.881) (-870.521) * (-870.390) (-867.883) (-869.288) [-872.393] -- 0:00:09
841500 -- (-870.401) (-869.098) (-868.554) [-869.773] * (-871.125) [-870.667] (-868.661) (-871.525) -- 0:00:09
842000 -- (-870.630) (-870.725) (-869.689) [-870.077] * (-870.410) (-875.670) [-873.838] (-872.629) -- 0:00:09
842500 -- (-872.261) (-871.290) (-867.939) [-870.003] * (-871.330) (-870.774) (-868.841) [-870.794] -- 0:00:09
843000 -- (-872.394) (-873.152) (-867.949) [-869.470] * (-870.153) (-870.367) [-870.463] (-872.982) -- 0:00:09
843500 -- (-870.335) (-872.845) [-869.698] (-869.385) * (-869.690) (-877.174) [-869.220] (-876.866) -- 0:00:09
844000 -- (-869.638) [-870.909] (-868.561) (-868.498) * (-869.720) (-869.461) (-872.513) [-869.420] -- 0:00:09
844500 -- (-869.157) [-869.837] (-877.340) (-869.849) * (-869.823) (-871.807) (-871.102) [-870.528] -- 0:00:09
845000 -- [-867.633] (-875.982) (-869.106) (-868.746) * (-868.898) [-870.343] (-870.814) (-873.481) -- 0:00:09
Average standard deviation of split frequencies: 0.008950
845500 -- (-869.449) (-870.219) [-870.708] (-869.936) * (-870.263) (-869.307) [-871.634] (-872.028) -- 0:00:09
846000 -- (-869.512) (-869.676) (-869.051) [-870.105] * (-871.289) [-868.593] (-870.042) (-871.120) -- 0:00:09
846500 -- [-870.619] (-873.444) (-871.028) (-868.005) * (-870.156) (-868.501) [-873.304] (-872.029) -- 0:00:09
847000 -- (-869.471) [-869.623] (-871.512) (-870.488) * (-869.384) (-870.153) (-871.947) [-871.768] -- 0:00:09
847500 -- [-868.728] (-872.172) (-870.427) (-867.975) * (-870.108) (-868.763) [-869.820] (-871.309) -- 0:00:09
848000 -- [-868.667] (-870.480) (-872.216) (-872.122) * (-868.335) (-869.254) [-868.849] (-871.522) -- 0:00:09
848500 -- [-870.136] (-869.937) (-869.707) (-871.106) * [-870.053] (-870.763) (-869.705) (-868.998) -- 0:00:09
849000 -- [-869.925] (-870.303) (-871.501) (-869.509) * [-868.042] (-869.574) (-870.419) (-872.437) -- 0:00:09
849500 -- (-868.775) (-870.495) [-875.375] (-868.848) * [-869.829] (-869.891) (-868.422) (-872.139) -- 0:00:09
850000 -- (-871.401) (-868.663) (-868.991) [-870.169] * (-871.790) (-877.354) (-869.393) [-875.217] -- 0:00:09
Average standard deviation of split frequencies: 0.008756
850500 -- [-870.709] (-871.635) (-870.824) (-869.529) * (-872.373) [-868.532] (-870.307) (-869.313) -- 0:00:08
851000 -- (-871.272) (-870.610) (-868.803) [-869.317] * (-870.666) (-869.054) (-868.833) [-871.346] -- 0:00:08
851500 -- (-868.909) (-870.891) [-870.176] (-868.795) * (-869.792) (-870.524) [-873.241] (-871.830) -- 0:00:08
852000 -- (-872.806) (-869.529) [-869.622] (-873.717) * (-868.157) [-869.406] (-871.217) (-873.185) -- 0:00:08
852500 -- (-871.130) (-869.388) (-871.907) [-870.803] * (-869.799) (-870.456) [-870.255] (-870.084) -- 0:00:08
853000 -- (-870.022) (-868.908) (-870.958) [-873.371] * (-869.135) [-868.244] (-869.145) (-870.023) -- 0:00:08
853500 -- (-867.814) [-870.612] (-871.679) (-872.438) * [-868.793] (-870.665) (-869.164) (-870.150) -- 0:00:08
854000 -- (-869.187) [-870.874] (-868.945) (-870.078) * (-871.555) [-869.222] (-871.014) (-871.985) -- 0:00:08
854500 -- (-868.969) (-872.530) (-873.472) [-873.958] * [-870.058] (-871.600) (-873.396) (-870.409) -- 0:00:08
855000 -- (-868.585) (-871.600) (-872.181) [-868.822] * (-869.690) (-872.387) (-869.197) [-870.851] -- 0:00:08
Average standard deviation of split frequencies: 0.008811
855500 -- [-868.708] (-871.259) (-868.833) (-868.870) * [-871.396] (-869.326) (-872.563) (-870.948) -- 0:00:08
856000 -- (-871.576) [-870.958] (-872.119) (-868.406) * (-873.884) (-869.787) (-870.707) [-868.862] -- 0:00:08
856500 -- (-873.117) [-868.598] (-870.102) (-869.692) * (-868.869) [-868.808] (-868.938) (-869.059) -- 0:00:08
857000 -- (-870.525) (-870.248) (-871.703) [-868.067] * (-868.803) (-872.627) [-868.409] (-877.378) -- 0:00:08
857500 -- (-870.675) [-869.871] (-872.110) (-870.400) * (-868.980) (-870.631) [-870.775] (-870.268) -- 0:00:08
858000 -- (-870.938) [-868.697] (-870.935) (-873.941) * [-869.641] (-868.211) (-869.154) (-869.498) -- 0:00:08
858500 -- (-876.114) (-869.027) (-868.778) [-871.220] * (-869.543) (-868.784) [-868.823] (-869.184) -- 0:00:08
859000 -- (-874.562) (-870.528) [-869.500] (-872.833) * (-870.518) (-871.720) (-868.606) [-870.590] -- 0:00:08
859500 -- (-875.371) [-869.694] (-868.866) (-868.350) * (-874.018) (-869.271) (-869.060) [-868.785] -- 0:00:08
860000 -- (-871.582) [-870.649] (-869.623) (-868.833) * (-869.958) (-869.244) [-868.809] (-867.740) -- 0:00:08
Average standard deviation of split frequencies: 0.008946
860500 -- (-868.775) (-868.449) [-868.506] (-870.349) * [-868.329] (-870.729) (-871.230) (-867.954) -- 0:00:08
861000 -- (-872.760) (-868.121) [-868.280] (-869.739) * (-868.957) (-869.561) [-868.684] (-870.579) -- 0:00:08
861500 -- (-875.744) (-868.163) (-870.204) [-871.094] * (-872.856) (-868.088) [-868.218] (-868.427) -- 0:00:08
862000 -- (-870.013) (-869.093) (-869.757) [-870.936] * [-869.846] (-868.169) (-868.446) (-870.433) -- 0:00:08
862500 -- (-868.835) [-869.469] (-868.924) (-868.559) * (-872.287) [-868.934] (-869.422) (-870.447) -- 0:00:08
863000 -- (-871.305) [-868.308] (-872.450) (-872.275) * [-869.881] (-868.077) (-870.913) (-869.366) -- 0:00:08
863500 -- (-870.685) (-870.945) (-873.329) [-873.677] * (-869.749) (-868.946) [-872.277] (-872.466) -- 0:00:08
864000 -- (-869.347) (-870.002) [-871.939] (-869.875) * [-873.724] (-869.716) (-870.917) (-872.441) -- 0:00:08
864500 -- (-872.372) [-870.909] (-871.770) (-868.610) * [-870.336] (-872.475) (-870.102) (-871.099) -- 0:00:08
865000 -- (-871.914) (-869.804) [-868.665] (-868.578) * (-872.658) (-873.966) [-870.883] (-868.779) -- 0:00:08
Average standard deviation of split frequencies: 0.008601
865500 -- (-872.597) (-873.281) [-868.603] (-871.217) * (-872.213) (-873.339) (-873.459) [-868.916] -- 0:00:08
866000 -- (-871.363) (-869.224) [-870.567] (-873.131) * (-872.274) (-871.920) [-868.529] (-872.046) -- 0:00:08
866500 -- (-869.316) (-869.738) [-870.112] (-870.726) * [-871.636] (-869.980) (-869.308) (-870.716) -- 0:00:08
867000 -- (-871.132) (-870.190) (-870.284) [-872.293] * (-868.987) (-869.762) (-869.212) [-868.598] -- 0:00:07
867500 -- [-868.201] (-871.923) (-870.065) (-871.102) * (-868.470) [-873.342] (-871.583) (-872.268) -- 0:00:07
868000 -- [-869.554] (-872.276) (-870.035) (-869.465) * (-871.540) (-870.619) [-872.808] (-870.954) -- 0:00:07
868500 -- (-874.360) (-874.106) [-868.222] (-870.035) * (-871.118) [-871.378] (-871.757) (-879.301) -- 0:00:07
869000 -- (-872.311) (-875.137) (-868.648) [-870.850] * [-868.945] (-869.620) (-869.645) (-868.592) -- 0:00:07
869500 -- (-871.877) (-872.891) (-868.648) [-870.335] * (-869.050) (-870.010) [-874.369] (-872.231) -- 0:00:07
870000 -- [-870.913] (-872.642) (-870.746) (-870.068) * (-869.107) [-868.279] (-872.171) (-873.288) -- 0:00:07
Average standard deviation of split frequencies: 0.008518
870500 -- [-873.483] (-871.590) (-870.936) (-871.405) * (-869.901) [-873.908] (-869.582) (-871.342) -- 0:00:07
871000 -- (-871.526) [-870.787] (-870.034) (-870.858) * (-870.490) (-869.583) [-869.036] (-868.821) -- 0:00:07
871500 -- [-870.049] (-870.248) (-871.015) (-868.739) * [-873.954] (-868.536) (-869.134) (-869.508) -- 0:00:07
872000 -- (-870.776) (-872.177) (-868.152) [-869.510] * (-870.841) [-868.945] (-869.839) (-873.247) -- 0:00:07
872500 -- (-869.407) [-870.012] (-868.896) (-870.057) * [-868.499] (-869.963) (-873.014) (-870.640) -- 0:00:07
873000 -- (-869.421) [-869.371] (-868.751) (-869.706) * (-871.640) (-868.497) (-868.354) [-869.982] -- 0:00:07
873500 -- [-870.533] (-868.940) (-867.985) (-868.926) * (-872.655) (-869.667) [-868.045] (-869.537) -- 0:00:07
874000 -- (-870.724) (-868.854) (-875.037) [-868.705] * (-869.473) (-872.079) (-871.345) [-867.950] -- 0:00:07
874500 -- [-871.595] (-872.807) (-870.878) (-873.089) * [-870.062] (-869.474) (-872.056) (-872.295) -- 0:00:07
875000 -- [-870.608] (-875.076) (-868.905) (-870.955) * (-869.841) (-871.143) [-871.180] (-872.016) -- 0:00:07
Average standard deviation of split frequencies: 0.008825
875500 -- [-870.506] (-870.864) (-874.668) (-868.808) * (-869.293) (-876.846) (-872.581) [-871.902] -- 0:00:07
876000 -- (-869.611) (-870.304) [-871.902] (-870.556) * (-869.388) (-873.072) (-870.386) [-869.759] -- 0:00:07
876500 -- [-869.574] (-869.878) (-869.768) (-868.716) * (-870.179) (-869.482) (-869.510) [-875.220] -- 0:00:07
877000 -- (-870.775) (-871.218) (-869.889) [-870.063] * (-869.964) (-868.435) (-877.011) [-870.542] -- 0:00:07
877500 -- (-870.361) (-869.832) [-868.457] (-871.961) * (-872.498) (-868.521) (-872.980) [-871.346] -- 0:00:07
878000 -- (-868.908) [-870.681] (-869.409) (-874.548) * (-868.669) (-870.748) [-869.234] (-869.806) -- 0:00:07
878500 -- (-868.973) (-869.662) (-871.633) [-869.906] * (-872.033) (-871.534) (-869.050) [-869.162] -- 0:00:07
879000 -- (-870.113) (-869.286) [-869.571] (-869.358) * [-872.020] (-869.645) (-869.212) (-869.458) -- 0:00:07
879500 -- [-873.437] (-869.528) (-874.183) (-870.242) * (-870.027) (-869.516) (-869.781) [-868.598] -- 0:00:07
880000 -- (-868.200) (-870.116) (-871.823) [-871.482] * (-869.610) (-870.414) (-870.292) [-868.553] -- 0:00:07
Average standard deviation of split frequencies: 0.008386
880500 -- [-870.727] (-871.524) (-872.117) (-870.072) * [-869.232] (-869.258) (-869.140) (-868.115) -- 0:00:07
881000 -- (-869.762) (-874.223) [-871.420] (-872.534) * (-869.880) (-871.414) (-871.309) [-869.399] -- 0:00:07
881500 -- (-873.536) [-870.149] (-868.353) (-870.525) * (-868.967) (-872.814) (-870.685) [-869.821] -- 0:00:07
882000 -- (-869.022) (-868.595) (-869.163) [-867.759] * (-869.250) (-874.658) [-872.970] (-870.761) -- 0:00:07
882500 -- [-871.536] (-868.614) (-869.317) (-868.716) * (-870.547) (-871.587) [-868.716] (-874.028) -- 0:00:07
883000 -- (-874.766) (-872.531) (-869.258) [-870.209] * (-868.930) (-869.960) (-869.532) [-873.478] -- 0:00:07
883500 -- (-870.769) [-870.017] (-872.502) (-869.595) * [-867.942] (-872.040) (-870.004) (-869.096) -- 0:00:06
884000 -- (-876.325) [-869.242] (-873.632) (-869.308) * [-869.819] (-869.113) (-869.495) (-869.763) -- 0:00:06
884500 -- (-874.101) (-870.826) [-869.056] (-870.471) * (-868.611) (-869.550) [-870.274] (-868.206) -- 0:00:06
885000 -- (-874.081) (-869.170) [-870.049] (-868.686) * (-868.333) (-869.185) (-868.933) [-868.652] -- 0:00:06
Average standard deviation of split frequencies: 0.008336
885500 -- (-876.521) (-870.951) [-869.282] (-870.744) * (-869.119) (-870.320) (-870.592) [-869.688] -- 0:00:06
886000 -- (-871.092) (-871.491) [-869.305] (-872.464) * (-868.859) (-871.429) [-869.225] (-868.529) -- 0:00:06
886500 -- [-870.261] (-869.874) (-868.588) (-871.883) * (-869.860) [-868.213] (-869.642) (-870.315) -- 0:00:06
887000 -- [-873.294] (-869.693) (-870.036) (-870.376) * (-875.567) [-868.252] (-873.010) (-868.382) -- 0:00:06
887500 -- (-869.610) [-869.296] (-869.594) (-873.112) * (-873.339) [-869.040] (-868.760) (-869.411) -- 0:00:06
888000 -- (-873.895) [-869.677] (-872.170) (-872.810) * [-870.149] (-869.795) (-869.836) (-868.672) -- 0:00:06
888500 -- (-872.607) (-872.252) [-868.805] (-869.160) * [-870.496] (-869.505) (-869.295) (-873.045) -- 0:00:06
889000 -- (-872.501) (-869.953) (-868.797) [-868.015] * (-872.498) (-873.125) (-871.060) [-872.975] -- 0:00:06
889500 -- (-872.531) [-869.999] (-868.238) (-869.503) * [-871.256] (-872.335) (-868.978) (-874.098) -- 0:00:06
890000 -- (-872.319) [-870.334] (-868.588) (-870.935) * [-873.109] (-868.743) (-871.326) (-869.555) -- 0:00:06
Average standard deviation of split frequencies: 0.008574
890500 -- (-871.009) (-872.903) (-868.849) [-869.418] * (-870.321) (-871.687) (-872.300) [-869.618] -- 0:00:06
891000 -- [-868.380] (-869.076) (-868.829) (-869.344) * (-872.287) (-871.284) [-873.900] (-868.915) -- 0:00:06
891500 -- [-870.386] (-871.741) (-869.383) (-869.857) * [-868.322] (-868.628) (-870.463) (-870.087) -- 0:00:06
892000 -- (-868.135) (-871.564) [-870.373] (-869.706) * (-872.167) (-872.468) (-874.264) [-871.308] -- 0:00:06
892500 -- (-868.437) (-872.379) [-868.270] (-869.206) * (-868.723) [-868.967] (-872.391) (-872.018) -- 0:00:06
893000 -- (-868.813) (-871.352) [-871.895] (-871.635) * [-872.521] (-868.955) (-870.710) (-870.876) -- 0:00:06
893500 -- (-869.557) (-871.645) (-870.322) [-869.159] * (-868.495) (-868.540) [-874.684] (-870.115) -- 0:00:06
894000 -- [-867.779] (-871.668) (-871.793) (-868.980) * (-869.745) [-869.350] (-871.739) (-872.869) -- 0:00:06
894500 -- (-869.334) (-870.831) [-871.694] (-871.686) * [-868.932] (-870.464) (-871.454) (-872.526) -- 0:00:06
895000 -- (-871.151) (-869.520) [-869.820] (-871.682) * (-870.608) (-868.857) (-870.809) [-870.422] -- 0:00:06
Average standard deviation of split frequencies: 0.008558
895500 -- (-870.479) (-869.494) (-870.352) [-868.174] * (-871.215) (-868.736) [-868.074] (-871.903) -- 0:00:06
896000 -- (-872.169) (-868.952) [-869.522] (-869.263) * [-868.243] (-869.468) (-875.403) (-870.673) -- 0:00:06
896500 -- [-868.826] (-869.422) (-871.352) (-869.212) * (-874.908) (-870.951) [-869.500] (-869.322) -- 0:00:06
897000 -- (-869.365) [-869.099] (-872.902) (-874.080) * [-871.438] (-869.698) (-869.717) (-871.505) -- 0:00:06
897500 -- (-870.886) (-871.178) [-868.919] (-872.477) * (-868.851) [-869.785] (-875.428) (-871.225) -- 0:00:06
898000 -- (-870.747) (-871.758) (-868.364) [-872.971] * (-869.273) (-869.576) [-869.791] (-869.485) -- 0:00:06
898500 -- [-869.983] (-871.638) (-874.319) (-871.760) * (-872.192) (-870.820) [-868.896] (-869.495) -- 0:00:06
899000 -- [-873.449] (-870.721) (-869.479) (-871.601) * (-869.143) (-873.035) [-868.310] (-870.148) -- 0:00:06
899500 -- [-869.051] (-871.344) (-870.644) (-873.010) * [-872.329] (-872.894) (-868.364) (-869.436) -- 0:00:06
900000 -- (-869.811) [-868.071] (-870.493) (-868.765) * (-870.128) (-870.203) [-868.485] (-868.964) -- 0:00:06
Average standard deviation of split frequencies: 0.008688
900500 -- (-868.686) (-870.251) [-870.484] (-869.349) * [-869.457] (-870.020) (-871.785) (-868.642) -- 0:00:05
901000 -- [-870.087] (-872.839) (-871.702) (-869.442) * (-868.998) (-869.915) (-874.612) [-869.340] -- 0:00:05
901500 -- (-871.625) (-872.621) (-868.930) [-868.807] * (-869.442) (-872.291) [-868.906] (-871.874) -- 0:00:05
902000 -- (-869.048) (-871.269) [-868.589] (-869.138) * (-871.417) (-870.787) (-870.380) [-869.688] -- 0:00:05
902500 -- (-869.520) (-869.132) [-872.123] (-870.399) * (-874.165) [-870.792] (-869.816) (-872.974) -- 0:00:05
903000 -- (-868.617) [-869.067] (-878.127) (-869.868) * (-868.934) (-871.367) [-870.680] (-868.414) -- 0:00:05
903500 -- (-869.642) [-870.556] (-875.492) (-870.250) * (-868.815) (-870.505) [-871.177] (-873.584) -- 0:00:05
904000 -- (-869.436) (-868.939) [-869.792] (-868.595) * [-870.063] (-872.029) (-869.848) (-872.248) -- 0:00:05
904500 -- (-877.477) (-868.192) [-870.578] (-869.171) * [-871.253] (-871.290) (-869.773) (-868.620) -- 0:00:05
905000 -- [-869.122] (-872.243) (-872.434) (-869.201) * [-869.362] (-875.583) (-869.130) (-871.366) -- 0:00:05
Average standard deviation of split frequencies: 0.008290
905500 -- (-871.213) (-869.505) (-871.832) [-868.170] * (-869.459) (-873.657) (-868.380) [-876.365] -- 0:00:05
906000 -- (-868.625) (-869.487) (-871.245) [-867.977] * (-870.718) (-869.799) [-868.692] (-869.838) -- 0:00:05
906500 -- (-868.717) (-869.957) [-869.354] (-868.814) * (-868.509) (-870.617) [-869.699] (-870.153) -- 0:00:05
907000 -- (-871.517) (-870.570) (-872.747) [-868.779] * (-877.433) (-870.965) (-868.603) [-868.939] -- 0:00:05
907500 -- [-869.773] (-870.918) (-870.247) (-867.991) * (-872.457) [-870.674] (-872.153) (-868.187) -- 0:00:05
908000 -- [-869.527] (-870.610) (-871.911) (-869.519) * [-868.585] (-873.098) (-869.606) (-869.290) -- 0:00:05
908500 -- (-872.190) (-868.279) [-869.608] (-869.776) * (-870.548) [-869.962] (-869.366) (-870.668) -- 0:00:05
909000 -- (-869.737) (-871.129) (-867.862) [-869.786] * [-871.278] (-871.874) (-870.590) (-870.878) -- 0:00:05
909500 -- [-869.214] (-873.756) (-868.219) (-871.812) * (-869.795) (-870.209) (-869.769) [-868.575] -- 0:00:05
910000 -- (-871.960) [-870.246] (-870.047) (-870.406) * (-871.670) (-868.942) [-870.911] (-871.976) -- 0:00:05
Average standard deviation of split frequencies: 0.008041
910500 -- (-868.757) (-870.649) (-869.228) [-870.821] * (-872.365) (-871.044) (-869.465) [-869.414] -- 0:00:05
911000 -- (-869.686) (-873.013) (-869.254) [-874.096] * (-874.972) [-868.374] (-870.269) (-869.382) -- 0:00:05
911500 -- (-868.508) (-869.143) (-871.583) [-872.663] * (-869.582) (-869.642) [-870.378] (-869.912) -- 0:00:05
912000 -- [-868.972] (-871.853) (-869.795) (-873.834) * (-870.359) [-869.071] (-873.036) (-869.037) -- 0:00:05
912500 -- (-870.325) (-869.481) [-869.620] (-869.914) * (-875.802) (-869.049) (-868.291) [-869.138] -- 0:00:05
913000 -- (-870.457) (-869.522) [-870.448] (-868.593) * [-871.069] (-873.699) (-871.056) (-870.200) -- 0:00:05
913500 -- (-876.697) (-870.148) [-868.864] (-871.853) * (-871.565) (-872.727) [-869.740] (-870.413) -- 0:00:05
914000 -- [-872.042] (-869.871) (-868.830) (-871.650) * [-869.083] (-869.795) (-870.095) (-874.514) -- 0:00:05
914500 -- (-870.446) (-868.768) (-870.072) [-869.188] * (-869.340) (-869.200) (-871.729) [-872.233] -- 0:00:05
915000 -- (-870.299) (-868.157) [-874.172] (-870.660) * (-876.121) [-869.519] (-871.083) (-867.910) -- 0:00:05
Average standard deviation of split frequencies: 0.007582
915500 -- (-869.734) [-868.837] (-874.128) (-870.750) * (-870.220) [-873.507] (-870.180) (-874.278) -- 0:00:05
916000 -- (-869.526) [-870.329] (-870.756) (-868.426) * (-871.672) (-873.310) [-869.277] (-869.125) -- 0:00:05
916500 -- [-867.912] (-872.520) (-870.481) (-869.799) * (-875.206) (-870.029) [-870.468] (-873.926) -- 0:00:05
917000 -- (-868.449) (-871.217) (-871.368) [-869.939] * (-874.237) [-870.570] (-872.202) (-874.407) -- 0:00:04
917500 -- (-870.809) [-870.949] (-871.209) (-871.297) * (-871.998) (-869.639) [-872.668] (-869.498) -- 0:00:04
918000 -- [-870.850] (-870.944) (-875.099) (-870.631) * (-868.167) [-868.440] (-870.355) (-869.805) -- 0:00:04
918500 -- (-869.780) [-873.047] (-874.664) (-870.937) * (-870.147) [-870.697] (-868.495) (-871.332) -- 0:00:04
919000 -- [-871.773] (-869.037) (-869.843) (-870.153) * (-869.461) (-869.136) [-870.600] (-868.562) -- 0:00:04
919500 -- (-868.984) [-869.107] (-871.664) (-868.965) * (-870.803) (-868.630) [-868.760] (-869.117) -- 0:00:04
920000 -- [-868.665] (-868.375) (-869.223) (-870.612) * [-868.702] (-869.370) (-869.934) (-870.396) -- 0:00:04
Average standard deviation of split frequencies: 0.007134
920500 -- (-869.467) (-868.590) [-868.021] (-870.818) * (-870.713) (-869.996) (-871.325) [-871.691] -- 0:00:04
921000 -- (-870.132) [-870.066] (-870.117) (-871.395) * (-870.012) (-876.391) [-871.780] (-873.618) -- 0:00:04
921500 -- (-873.148) (-868.500) [-868.538] (-873.525) * [-870.237] (-870.995) (-873.917) (-873.682) -- 0:00:04
922000 -- (-870.450) (-872.965) (-869.532) [-869.512] * (-870.702) (-870.587) [-868.868] (-873.433) -- 0:00:04
922500 -- (-869.668) (-871.150) (-872.567) [-870.340] * [-870.230] (-868.779) (-868.328) (-869.994) -- 0:00:04
923000 -- (-869.780) (-871.263) (-869.880) [-870.710] * (-870.899) [-869.324] (-872.119) (-869.493) -- 0:00:04
923500 -- (-871.484) (-869.699) [-869.670] (-870.729) * (-868.370) [-869.464] (-871.682) (-869.409) -- 0:00:04
924000 -- (-869.161) (-869.272) (-868.513) [-870.696] * (-867.831) (-871.728) (-873.964) [-869.887] -- 0:00:04
924500 -- [-868.362] (-870.634) (-872.283) (-871.726) * [-870.273] (-869.769) (-875.286) (-869.405) -- 0:00:04
925000 -- (-870.743) [-871.715] (-874.608) (-870.839) * (-870.361) [-869.590] (-870.036) (-871.440) -- 0:00:04
Average standard deviation of split frequencies: 0.007127
925500 -- (-872.941) [-869.955] (-870.432) (-870.894) * [-869.129] (-870.987) (-870.737) (-870.151) -- 0:00:04
926000 -- (-869.898) (-868.994) [-869.171] (-870.924) * (-869.056) (-869.371) [-869.637] (-869.313) -- 0:00:04
926500 -- (-870.299) (-868.925) (-870.346) [-869.838] * [-870.138] (-869.270) (-870.825) (-874.832) -- 0:00:04
927000 -- [-869.314] (-868.754) (-869.993) (-872.295) * (-867.890) [-868.708] (-876.180) (-869.704) -- 0:00:04
927500 -- (-868.769) (-873.604) (-869.658) [-869.260] * (-868.606) (-871.451) (-869.911) [-873.148] -- 0:00:04
928000 -- (-870.025) (-868.170) (-870.636) [-872.869] * (-868.464) (-871.553) [-868.092] (-875.278) -- 0:00:04
928500 -- (-870.013) (-878.288) [-869.226] (-872.734) * (-872.254) (-872.271) [-868.339] (-874.329) -- 0:00:04
929000 -- (-868.741) [-871.655] (-869.697) (-869.737) * [-873.172] (-871.482) (-869.788) (-872.216) -- 0:00:04
929500 -- (-868.383) (-870.063) [-868.329] (-872.712) * (-869.509) (-874.915) [-869.641] (-873.494) -- 0:00:04
930000 -- (-872.890) (-871.404) (-870.745) [-869.306] * (-871.008) [-872.109] (-870.624) (-870.866) -- 0:00:04
Average standard deviation of split frequencies: 0.007159
930500 -- (-875.457) [-871.662] (-872.433) (-868.202) * (-870.310) (-870.835) (-871.117) [-869.050] -- 0:00:04
931000 -- (-870.207) (-874.753) (-872.266) [-869.229] * (-870.880) (-871.226) [-871.021] (-868.781) -- 0:00:04
931500 -- [-869.900] (-869.255) (-871.767) (-873.183) * (-873.604) (-870.202) [-869.551] (-869.041) -- 0:00:04
932000 -- [-872.671] (-868.676) (-870.168) (-872.916) * [-869.375] (-868.869) (-869.512) (-869.104) -- 0:00:04
932500 -- [-872.397] (-871.977) (-872.779) (-871.687) * (-868.960) [-870.880] (-869.915) (-868.175) -- 0:00:04
933000 -- [-868.057] (-870.059) (-871.994) (-871.053) * (-869.512) (-868.750) (-873.648) [-868.185] -- 0:00:04
933500 -- (-870.099) (-869.954) [-869.676] (-875.559) * [-870.536] (-869.057) (-869.025) (-869.546) -- 0:00:03
934000 -- [-869.698] (-870.400) (-868.145) (-868.927) * [-869.479] (-868.445) (-871.977) (-868.179) -- 0:00:03
934500 -- (-868.265) [-869.222] (-868.703) (-871.136) * (-870.635) [-870.902] (-868.789) (-872.229) -- 0:00:03
935000 -- (-870.951) (-869.576) [-868.598] (-873.172) * (-871.184) (-871.022) [-869.766] (-875.257) -- 0:00:03
Average standard deviation of split frequencies: 0.007286
935500 -- (-869.846) [-872.997] (-869.181) (-870.899) * (-871.717) (-872.658) [-869.493] (-873.791) -- 0:00:03
936000 -- [-870.215] (-870.210) (-869.913) (-869.516) * [-871.380] (-874.857) (-869.493) (-869.954) -- 0:00:03
936500 -- (-872.037) (-869.036) (-873.992) [-870.446] * (-869.149) (-869.364) [-869.383] (-868.900) -- 0:00:03
937000 -- (-872.613) [-868.397] (-871.626) (-870.679) * (-868.403) (-869.697) [-869.053] (-871.336) -- 0:00:03
937500 -- (-878.845) [-869.040] (-872.487) (-868.988) * (-868.285) [-869.205] (-868.685) (-873.430) -- 0:00:03
938000 -- (-871.783) [-869.269] (-869.003) (-869.533) * (-870.449) (-872.013) (-870.389) [-868.442] -- 0:00:03
938500 -- (-868.994) [-870.065] (-869.699) (-868.057) * (-867.986) (-872.446) [-869.548] (-868.630) -- 0:00:03
939000 -- (-868.320) [-868.670] (-874.275) (-868.693) * (-868.454) (-872.239) (-870.943) [-869.039] -- 0:00:03
939500 -- (-869.098) (-869.198) [-873.222] (-870.200) * (-868.155) [-872.202] (-872.994) (-870.042) -- 0:00:03
940000 -- (-869.195) (-868.962) (-876.785) [-871.808] * (-872.949) [-870.893] (-873.502) (-870.874) -- 0:00:03
Average standard deviation of split frequencies: 0.007150
940500 -- (-868.566) (-869.028) [-870.808] (-872.556) * [-872.083] (-869.650) (-872.405) (-869.348) -- 0:00:03
941000 -- (-868.948) (-869.433) [-870.645] (-869.441) * [-875.324] (-870.403) (-874.585) (-868.136) -- 0:00:03
941500 -- [-870.758] (-870.138) (-872.795) (-871.617) * (-869.953) (-869.898) (-869.206) [-869.761] -- 0:00:03
942000 -- [-871.840] (-869.653) (-870.657) (-871.330) * (-869.969) [-871.873] (-868.587) (-869.641) -- 0:00:03
942500 -- [-869.972] (-868.507) (-871.243) (-874.119) * (-869.835) (-874.197) (-867.969) [-869.946] -- 0:00:03
943000 -- (-877.609) [-868.714] (-868.738) (-869.246) * [-871.382] (-869.966) (-867.971) (-870.217) -- 0:00:03
943500 -- (-872.140) (-873.730) [-869.512] (-869.587) * (-871.744) (-869.767) (-870.571) [-869.481] -- 0:00:03
944000 -- (-871.841) (-872.106) [-870.191] (-869.554) * (-873.591) [-870.543] (-873.688) (-870.749) -- 0:00:03
944500 -- (-869.846) [-868.400] (-869.206) (-871.891) * [-870.556] (-871.245) (-869.608) (-868.686) -- 0:00:03
945000 -- (-872.304) (-870.264) (-870.001) [-870.329] * [-867.913] (-868.448) (-871.434) (-870.927) -- 0:00:03
Average standard deviation of split frequencies: 0.007907
945500 -- [-870.198] (-870.776) (-872.062) (-869.197) * (-874.006) (-868.657) [-868.246] (-870.682) -- 0:00:03
946000 -- (-869.473) (-872.534) (-868.763) [-867.890] * (-875.163) (-869.914) (-868.174) [-873.232] -- 0:00:03
946500 -- [-870.900] (-873.463) (-868.809) (-868.169) * [-876.685] (-875.078) (-870.312) (-869.672) -- 0:00:03
947000 -- (-874.280) [-869.583] (-869.914) (-868.002) * (-871.232) (-873.687) [-872.441] (-870.786) -- 0:00:03
947500 -- (-873.866) (-869.138) [-871.185] (-868.327) * (-874.046) [-870.956] (-869.764) (-875.384) -- 0:00:03
948000 -- (-870.319) (-869.808) (-869.619) [-868.327] * [-869.731] (-869.389) (-868.852) (-871.042) -- 0:00:03
948500 -- (-871.792) [-869.332] (-869.160) (-868.906) * (-869.213) (-872.868) (-868.413) [-871.365] -- 0:00:03
949000 -- (-868.438) (-868.687) (-868.538) [-871.127] * (-873.330) [-870.933] (-875.677) (-872.940) -- 0:00:03
949500 -- (-869.031) (-870.994) [-869.115] (-871.090) * [-870.124] (-869.015) (-869.783) (-869.665) -- 0:00:03
950000 -- [-868.102] (-870.170) (-869.541) (-869.414) * [-871.988] (-869.401) (-868.943) (-874.510) -- 0:00:03
Average standard deviation of split frequencies: 0.007636
950500 -- (-868.884) (-872.398) [-874.580] (-868.444) * [-867.697] (-868.417) (-870.835) (-870.085) -- 0:00:02
951000 -- [-868.737] (-869.186) (-868.934) (-870.470) * (-867.699) (-870.390) (-872.117) [-869.974] -- 0:00:02
951500 -- (-868.650) [-869.116] (-869.056) (-869.443) * (-870.355) (-869.287) [-868.141] (-869.207) -- 0:00:02
952000 -- (-872.304) [-870.192] (-871.887) (-871.945) * (-869.350) (-869.400) (-868.162) [-868.402] -- 0:00:02
952500 -- (-871.259) [-868.810] (-870.320) (-871.138) * (-873.381) (-868.981) (-867.754) [-868.470] -- 0:00:02
953000 -- [-868.693] (-871.264) (-870.681) (-870.759) * [-868.975] (-875.836) (-868.249) (-869.839) -- 0:00:02
953500 -- (-868.343) [-869.609] (-870.304) (-869.955) * (-871.793) [-871.896] (-870.282) (-870.625) -- 0:00:02
954000 -- (-868.020) (-869.353) (-868.607) [-869.988] * (-869.743) (-870.999) (-872.844) [-871.199] -- 0:00:02
954500 -- (-868.121) (-869.136) [-868.882] (-870.017) * (-869.005) (-871.412) (-868.256) [-870.551] -- 0:00:02
955000 -- [-872.015] (-868.265) (-869.791) (-869.960) * (-871.034) (-873.009) (-868.365) [-870.464] -- 0:00:02
Average standard deviation of split frequencies: 0.007890
955500 -- (-869.932) (-868.003) (-871.172) [-870.665] * [-868.452] (-873.786) (-869.857) (-872.916) -- 0:00:02
956000 -- (-870.340) (-871.243) [-870.376] (-873.825) * [-872.319] (-873.899) (-871.453) (-869.136) -- 0:00:02
956500 -- (-868.816) (-871.142) (-873.144) [-871.253] * [-873.487] (-874.268) (-869.726) (-871.588) -- 0:00:02
957000 -- [-869.384] (-873.453) (-871.282) (-870.976) * [-868.507] (-871.435) (-872.771) (-869.463) -- 0:00:02
957500 -- (-874.402) (-869.188) (-870.366) [-870.893] * [-872.345] (-871.451) (-875.807) (-870.235) -- 0:00:02
958000 -- (-870.704) (-871.890) (-871.562) [-868.487] * (-871.577) (-869.037) [-870.175] (-869.831) -- 0:00:02
958500 -- (-870.729) [-868.372] (-868.284) (-869.199) * (-873.050) [-868.319] (-868.287) (-877.483) -- 0:00:02
959000 -- (-868.554) (-869.769) (-868.359) [-868.934] * (-871.830) [-867.712] (-869.310) (-878.658) -- 0:00:02
959500 -- (-868.712) (-870.752) (-869.809) [-869.375] * (-873.079) (-867.766) [-869.892] (-878.116) -- 0:00:02
960000 -- (-870.702) [-868.163] (-869.711) (-868.355) * (-871.293) (-871.763) [-869.749] (-874.176) -- 0:00:02
Average standard deviation of split frequencies: 0.007884
960500 -- (-869.327) [-868.340] (-872.507) (-871.796) * [-870.115] (-870.755) (-868.647) (-872.252) -- 0:00:02
961000 -- [-869.397] (-873.496) (-873.767) (-872.187) * (-869.479) (-870.420) [-872.617] (-870.878) -- 0:00:02
961500 -- [-868.710] (-869.545) (-870.641) (-870.825) * [-868.923] (-871.287) (-872.119) (-869.828) -- 0:00:02
962000 -- (-869.950) (-868.980) (-871.610) [-871.060] * (-871.378) (-870.355) (-869.981) [-870.474] -- 0:00:02
962500 -- (-871.540) [-869.920] (-869.600) (-873.383) * [-869.756] (-870.639) (-873.313) (-870.257) -- 0:00:02
963000 -- (-872.281) [-876.208] (-869.785) (-870.007) * (-870.001) [-870.337] (-870.033) (-868.789) -- 0:00:02
963500 -- (-872.479) (-873.182) [-872.042] (-869.889) * (-870.128) (-871.068) [-870.222] (-867.993) -- 0:00:02
964000 -- (-869.672) (-868.912) [-870.146] (-871.968) * [-868.565] (-868.956) (-868.961) (-868.742) -- 0:00:02
964500 -- (-868.289) (-870.832) [-867.919] (-869.077) * (-869.287) (-871.310) (-873.134) [-868.831] -- 0:00:02
965000 -- [-868.293] (-872.427) (-868.002) (-873.349) * (-868.602) (-871.321) (-869.557) [-871.153] -- 0:00:02
Average standard deviation of split frequencies: 0.007710
965500 -- (-869.630) (-870.003) [-868.579] (-871.025) * (-870.836) (-868.559) [-869.551] (-869.476) -- 0:00:02
966000 -- [-868.280] (-871.303) (-870.265) (-870.997) * (-869.924) (-869.088) [-868.470] (-872.295) -- 0:00:02
966500 -- [-868.393] (-869.959) (-873.096) (-869.624) * (-872.896) (-869.175) [-868.556] (-870.015) -- 0:00:02
967000 -- (-868.863) (-872.536) [-871.011] (-872.768) * (-869.153) (-870.952) [-868.554] (-871.560) -- 0:00:01
967500 -- (-869.180) [-870.931] (-870.420) (-870.739) * (-868.542) (-871.231) [-869.014] (-871.397) -- 0:00:01
968000 -- [-867.859] (-874.040) (-869.182) (-869.446) * (-868.593) (-873.654) (-871.279) [-869.858] -- 0:00:01
968500 -- (-867.838) (-872.371) (-875.624) [-869.114] * (-868.724) [-869.585] (-870.471) (-870.584) -- 0:00:01
969000 -- [-868.929] (-871.675) (-873.547) (-868.655) * (-869.012) (-872.741) [-870.556] (-870.250) -- 0:00:01
969500 -- (-868.923) (-870.567) (-868.818) [-868.198] * (-868.813) (-871.865) [-873.174] (-872.747) -- 0:00:01
970000 -- (-870.394) [-872.819] (-869.325) (-868.726) * [-870.850] (-873.470) (-876.297) (-869.418) -- 0:00:01
Average standard deviation of split frequencies: 0.008256
970500 -- (-869.144) (-869.450) [-869.059] (-868.417) * [-869.319] (-870.306) (-870.985) (-871.029) -- 0:00:01
971000 -- (-870.429) (-870.116) [-869.095] (-869.621) * (-871.055) (-868.580) [-869.426] (-869.579) -- 0:00:01
971500 -- (-869.579) [-871.246] (-868.850) (-872.418) * (-869.725) (-869.485) (-868.298) [-874.873] -- 0:00:01
972000 -- [-868.099] (-875.497) (-870.934) (-870.065) * [-869.332] (-872.146) (-870.211) (-873.409) -- 0:00:01
972500 -- [-868.452] (-870.375) (-869.225) (-869.941) * (-872.987) (-871.133) (-869.044) [-868.488] -- 0:00:01
973000 -- (-868.903) (-869.427) (-871.552) [-869.789] * (-870.678) [-871.170] (-871.755) (-869.974) -- 0:00:01
973500 -- [-868.338] (-870.394) (-871.824) (-869.231) * [-870.859] (-874.676) (-869.903) (-869.577) -- 0:00:01
974000 -- (-870.929) [-871.585] (-869.869) (-874.997) * (-870.596) (-871.773) (-872.095) [-870.521] -- 0:00:01
974500 -- (-872.498) (-871.683) (-870.255) [-871.452] * (-870.387) [-870.428] (-870.321) (-870.288) -- 0:00:01
975000 -- (-871.727) (-869.590) (-868.304) [-870.994] * (-873.097) [-867.600] (-870.064) (-870.251) -- 0:00:01
Average standard deviation of split frequencies: 0.008630
975500 -- (-871.486) [-868.345] (-871.626) (-872.117) * (-871.714) [-868.143] (-869.594) (-871.165) -- 0:00:01
976000 -- (-871.530) (-872.780) [-871.277] (-870.376) * (-873.110) [-871.619] (-869.596) (-868.838) -- 0:00:01
976500 -- (-870.842) [-870.028] (-873.367) (-871.571) * [-871.408] (-868.922) (-869.817) (-869.026) -- 0:00:01
977000 -- [-870.572] (-868.787) (-870.967) (-870.686) * [-869.230] (-868.589) (-870.749) (-872.691) -- 0:00:01
977500 -- [-869.089] (-869.523) (-868.745) (-870.892) * (-869.054) (-873.873) (-871.502) [-871.810] -- 0:00:01
978000 -- (-869.137) [-869.220] (-870.980) (-870.804) * (-871.120) (-874.552) [-870.640] (-868.535) -- 0:00:01
978500 -- (-868.237) (-871.450) [-870.645] (-869.290) * [-875.083] (-871.442) (-873.065) (-872.267) -- 0:00:01
979000 -- (-869.061) (-871.266) (-870.783) [-868.258] * (-875.479) (-868.290) (-872.787) [-872.761] -- 0:00:01
979500 -- [-869.092] (-871.959) (-870.385) (-872.047) * (-873.680) [-870.208] (-868.801) (-869.737) -- 0:00:01
980000 -- [-867.682] (-868.889) (-868.615) (-870.584) * (-876.940) (-870.738) [-870.692] (-869.477) -- 0:00:01
Average standard deviation of split frequencies: 0.008749
980500 -- (-869.238) (-876.001) (-870.388) [-870.737] * (-873.077) (-872.604) (-871.197) [-868.938] -- 0:00:01
981000 -- (-870.505) (-871.127) (-870.350) [-868.993] * [-870.581] (-872.697) (-874.002) (-869.120) -- 0:00:01
981500 -- (-872.918) (-871.686) [-870.830] (-867.749) * (-871.809) (-871.606) (-873.846) [-869.096] -- 0:00:01
982000 -- (-869.921) (-869.041) [-869.593] (-870.121) * [-868.374] (-868.492) (-871.921) (-869.238) -- 0:00:01
982500 -- [-872.680] (-868.078) (-867.988) (-868.385) * (-871.765) (-868.806) (-870.015) [-868.237] -- 0:00:01
983000 -- (-868.676) [-870.741] (-872.294) (-873.192) * (-868.909) (-875.397) [-870.861] (-869.337) -- 0:00:01
983500 -- (-869.319) (-870.816) [-868.994] (-869.150) * (-870.772) [-868.906] (-870.949) (-870.277) -- 0:00:00
984000 -- (-872.653) (-870.873) (-870.247) [-872.885] * [-870.537] (-871.243) (-870.676) (-870.713) -- 0:00:00
984500 -- (-873.312) (-869.812) [-868.146] (-872.746) * (-871.203) (-870.557) [-869.798] (-871.309) -- 0:00:00
985000 -- (-870.797) (-873.937) (-867.765) [-871.626] * (-872.509) [-869.360] (-870.152) (-869.258) -- 0:00:00
Average standard deviation of split frequencies: 0.008797
985500 -- (-873.216) (-867.889) [-870.211] (-870.086) * (-873.064) (-870.957) [-868.825] (-868.291) -- 0:00:00
986000 -- (-872.304) (-867.855) (-868.578) [-868.305] * (-874.013) (-870.868) [-871.842] (-869.698) -- 0:00:00
986500 -- (-872.516) (-869.370) (-870.980) [-868.522] * [-871.723] (-869.012) (-872.968) (-868.730) -- 0:00:00
987000 -- (-869.620) (-875.338) [-870.476] (-870.653) * [-869.891] (-869.884) (-870.402) (-868.853) -- 0:00:00
987500 -- (-874.480) (-871.266) [-870.865] (-870.633) * (-869.817) [-870.148] (-870.176) (-871.320) -- 0:00:00
988000 -- (-870.073) (-868.652) [-870.765] (-870.750) * (-870.239) [-868.015] (-869.962) (-869.977) -- 0:00:00
988500 -- (-870.168) (-870.141) (-871.846) [-868.585] * (-870.115) [-868.919] (-869.734) (-870.302) -- 0:00:00
989000 -- (-869.572) [-871.649] (-872.209) (-868.591) * (-871.090) [-868.713] (-872.576) (-872.229) -- 0:00:00
989500 -- (-868.768) (-869.571) (-875.342) [-873.619] * (-871.719) (-875.384) (-870.468) [-870.594] -- 0:00:00
990000 -- [-869.671] (-869.669) (-868.087) (-869.205) * (-870.536) (-873.809) (-870.297) [-869.195] -- 0:00:00
Average standard deviation of split frequencies: 0.008660
990500 -- [-868.779] (-869.310) (-871.483) (-868.161) * (-870.207) [-878.034] (-869.703) (-870.076) -- 0:00:00
991000 -- (-870.105) [-872.121] (-872.610) (-870.658) * (-870.800) (-870.280) (-870.904) [-870.178] -- 0:00:00
991500 -- (-868.628) (-877.700) (-874.273) [-870.812] * (-871.349) [-870.011] (-868.155) (-870.679) -- 0:00:00
992000 -- (-869.935) [-868.562] (-874.763) (-872.605) * (-870.388) [-869.590] (-869.453) (-870.233) -- 0:00:00
992500 -- (-870.394) (-869.514) [-874.255] (-870.754) * [-870.045] (-869.687) (-870.647) (-869.400) -- 0:00:00
993000 -- (-870.115) [-869.848] (-870.906) (-871.263) * (-869.244) [-869.290] (-869.431) (-869.931) -- 0:00:00
993500 -- [-868.953] (-871.365) (-869.802) (-870.082) * (-870.916) [-869.816] (-868.695) (-873.321) -- 0:00:00
994000 -- (-868.954) (-869.878) [-868.657] (-868.837) * (-870.868) [-869.488] (-869.940) (-867.955) -- 0:00:00
994500 -- (-868.837) (-871.279) (-868.509) [-869.833] * (-872.783) [-868.709] (-870.618) (-868.667) -- 0:00:00
995000 -- (-869.495) (-870.421) [-868.754] (-871.556) * [-871.203] (-869.393) (-871.484) (-869.194) -- 0:00:00
Average standard deviation of split frequencies: 0.008677
995500 -- (-869.436) (-870.630) (-868.599) [-870.762] * (-868.914) (-870.244) (-870.316) [-868.740] -- 0:00:00
996000 -- (-868.978) [-869.087] (-872.997) (-869.853) * (-869.364) (-872.471) (-871.862) [-870.161] -- 0:00:00
996500 -- (-869.860) (-871.593) [-871.362] (-873.060) * (-868.485) [-868.203] (-874.810) (-873.765) -- 0:00:00
997000 -- (-871.837) (-870.162) (-875.465) [-871.861] * (-870.955) (-868.371) (-868.332) [-871.021] -- 0:00:00
997500 -- (-869.250) [-871.746] (-868.271) (-870.197) * (-873.498) (-868.398) (-868.491) [-869.306] -- 0:00:00
998000 -- (-869.006) (-869.886) [-867.733] (-869.873) * (-878.783) (-868.396) [-868.273] (-868.793) -- 0:00:00
998500 -- (-869.663) (-869.268) [-867.756] (-873.379) * (-869.140) [-868.521] (-872.144) (-868.132) -- 0:00:00
999000 -- [-869.244] (-868.914) (-871.501) (-874.157) * (-871.470) (-874.232) (-872.615) [-867.916] -- 0:00:00
999500 -- [-870.067] (-869.505) (-870.453) (-869.488) * (-868.815) (-873.087) (-870.189) [-869.938] -- 0:00:00
1000000 -- [-870.387] (-871.984) (-869.535) (-875.034) * (-870.546) [-873.941] (-868.828) (-869.170) -- 0:00:00
Average standard deviation of split frequencies: 0.008857
Analysis completed in 60 seconds
Analysis used 59.24 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -867.61
Likelihood of best state for "cold" chain of run 2 was -867.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.8 % ( 33 %) Dirichlet(Pi{all})
30.3 % ( 27 %) Slider(Pi{all})
79.2 % ( 61 %) Multiplier(Alpha{1,2})
78.0 % ( 59 %) Multiplier(Alpha{3})
21.2 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.5 % ( 17 %) Dirichlet(Pi{all})
30.3 % ( 27 %) Slider(Pi{all})
79.0 % ( 52 %) Multiplier(Alpha{1,2})
77.5 % ( 51 %) Multiplier(Alpha{3})
21.4 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.5 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167030 0.82 0.67
3 | 167252 166364 0.84
4 | 166499 166705 166150
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166069 0.82 0.67
3 | 166879 167223 0.84
4 | 166160 166901 166768
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -869.38
| 1 1 |
| 1 1 1 1 |
| 1 2 2 1 1 12 1 |
| 2 1 22 221 2 2 2 1 1 |
| *1 2221 2 2 1 1 1 12|
| 2 1 2 21 2 * 1 1 21 1 2 2122 |
| 12 21 1 2 1 2 11 *22 1 2 11 |
|2 1 1 2 2 2 2 222 1 1 2 21|
| 2 1 2 1 22 1 |
| 2 21 11 2 |
|1 22 1 1 2 2 2 |
| 1 2 1 1 |
| 1 1 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -871.09
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -869.31 -872.50
2 -869.34 -872.48
--------------------------------------
TOTAL -869.32 -872.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893844 0.087664 0.359805 1.449046 0.863673 1443.45 1472.23 1.000
r(A<->C){all} 0.166218 0.018921 0.000159 0.441359 0.131300 316.40 397.03 1.006
r(A<->G){all} 0.163909 0.019267 0.000037 0.438457 0.129028 197.63 283.06 1.000
r(A<->T){all} 0.175413 0.020889 0.000014 0.460077 0.137527 225.03 234.81 1.000
r(C<->G){all} 0.162349 0.019607 0.000020 0.452484 0.124952 315.00 326.82 1.002
r(C<->T){all} 0.158556 0.019721 0.000029 0.454070 0.121822 210.97 250.07 1.000
r(G<->T){all} 0.173555 0.021011 0.000025 0.462860 0.133901 160.01 190.77 1.011
pi(A){all} 0.161243 0.000208 0.134535 0.191519 0.160696 1261.10 1298.87 1.000
pi(C){all} 0.304911 0.000327 0.269199 0.339418 0.304584 932.48 1124.40 1.000
pi(G){all} 0.317185 0.000330 0.281544 0.350790 0.317053 1165.53 1261.50 1.000
pi(T){all} 0.216662 0.000266 0.185275 0.249153 0.216425 1049.46 1170.99 1.000
alpha{1,2} 0.427965 0.233591 0.000192 1.402163 0.260075 1185.77 1242.29 1.000
alpha{3} 0.475847 0.258918 0.000172 1.550464 0.304447 1308.79 1314.05 1.000
pinvar{all} 0.997654 0.000008 0.992495 0.999997 0.998514 1246.82 1267.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .**.**
9 -- ..*.*.
10 -- .*..*.
11 -- .***.*
12 -- .*.***
13 -- .*.*..
14 -- .**...
15 -- ..**..
16 -- ....**
17 -- .****.
18 -- ...*.*
19 -- ...**.
20 -- ..*..*
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.004240 0.149234 0.155230 2
8 457 0.152232 0.026852 0.133245 0.171219 2
9 443 0.147568 0.012719 0.138574 0.156562 2
10 443 0.147568 0.012719 0.138574 0.156562 2
11 436 0.145237 0.010364 0.137908 0.152565 2
12 434 0.144570 0.001884 0.143238 0.145903 2
13 432 0.143904 0.003769 0.141239 0.146569 2
14 427 0.142239 0.002355 0.140573 0.143904 2
15 427 0.142239 0.010835 0.134577 0.149900 2
16 423 0.140906 0.008951 0.134577 0.147235 2
17 420 0.139907 0.006595 0.135243 0.144570 2
18 418 0.139241 0.003769 0.136576 0.141905 2
19 415 0.138241 0.014604 0.127915 0.148568 2
20 412 0.137242 0.008480 0.131246 0.143238 2
21 400 0.133245 0.004711 0.129913 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100941 0.009961 0.000017 0.304052 0.069866 1.000 2
length{all}[2] 0.097664 0.009593 0.000059 0.294032 0.069825 1.000 2
length{all}[3] 0.098698 0.009991 0.000006 0.295681 0.069058 1.000 2
length{all}[4] 0.098903 0.009627 0.000005 0.297231 0.070803 1.000 2
length{all}[5] 0.099079 0.010032 0.000073 0.293671 0.068804 1.000 2
length{all}[6] 0.097575 0.009307 0.000012 0.294719 0.067030 1.000 2
length{all}[7] 0.099805 0.008453 0.000574 0.283577 0.070333 0.998 2
length{all}[8] 0.103046 0.010052 0.000001 0.295074 0.070421 0.998 2
length{all}[9] 0.095146 0.008812 0.000016 0.269039 0.065332 0.999 2
length{all}[10] 0.098401 0.009360 0.000100 0.285415 0.070003 1.007 2
length{all}[11] 0.096504 0.008496 0.000006 0.276001 0.071511 0.999 2
length{all}[12] 0.100404 0.010327 0.000247 0.304287 0.062655 1.002 2
length{all}[13] 0.101538 0.009264 0.000190 0.292741 0.074448 1.001 2
length{all}[14] 0.111215 0.012115 0.000565 0.316850 0.075770 1.010 2
length{all}[15] 0.097627 0.008872 0.000039 0.304264 0.071191 0.999 2
length{all}[16] 0.105838 0.008699 0.001144 0.287189 0.079907 1.004 2
length{all}[17] 0.102034 0.010861 0.000164 0.306635 0.070824 0.999 2
length{all}[18] 0.099086 0.010146 0.000116 0.278292 0.068927 0.998 2
length{all}[19] 0.098859 0.009956 0.000705 0.293360 0.070005 0.998 2
length{all}[20] 0.101811 0.010004 0.000100 0.313811 0.069732 0.998 2
length{all}[21] 0.104641 0.013370 0.000059 0.304450 0.070764 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008857
Maximum standard deviation of split frequencies = 0.026852
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 642
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 214 / 214 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 214 / 214 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016337 0.103599 0.075478 0.043248 0.103798 0.013973 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -922.759238
Iterating by ming2
Initial: fx= 922.759238
x= 0.01634 0.10360 0.07548 0.04325 0.10380 0.01397 0.30000 1.30000
1 h-m-p 0.0000 0.0001 511.8826 ++ 905.366921 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0055 56.1600 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 467.6924 ++ 902.911642 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0065 47.4322 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 417.4882 ++ 880.478104 m 0.0001 73 | 3/8
6 h-m-p 0.0012 0.0083 37.5086 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 362.4884 ++ 860.091600 m 0.0002 104 | 4/8
8 h-m-p 0.0020 0.0139 22.9896 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 297.2133 ++ 848.075462 m 0.0001 136 | 5/8
10 h-m-p 0.0026 0.0313 11.1816 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 211.2485 ++ 848.032629 m 0.0000 168 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 C 848.032629 0 0.0160 179 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 -----------Y 848.032629 0 0.0000 203
Out..
lnL = -848.032629
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038595 0.070960 0.073571 0.028505 0.100501 0.094705 0.299882 0.527774 0.543306
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.109210
np = 9
lnL0 = -932.666227
Iterating by ming2
Initial: fx= 932.666227
x= 0.03860 0.07096 0.07357 0.02850 0.10050 0.09471 0.29988 0.52777 0.54331
1 h-m-p 0.0000 0.0001 502.4607 ++ 897.634262 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 235.3378 ++ 887.108069 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0001 1841.7388 ++ 861.071055 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 408.8848 ++ 858.842238 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0001 2866.7507 ++ 849.224042 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 17330.4415 ++ 848.032637 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0006 ++ 848.032637 m 8.0000 86 | 6/9
8 h-m-p 0.0204 4.3847 0.2263 ++++ 848.032631 m 4.3847 103 | 7/9
9 h-m-p 1.6000 8.0000 0.0268 ++ 848.032630 m 8.0000 118 | 7/9
10 h-m-p 0.0224 0.1119 5.6492 -------------.. | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 848.032630 m 8.0000 158 | 7/9
12 h-m-p 0.0794 8.0000 0.0017 ++++ 848.032630 m 8.0000 174 | 7/9
13 h-m-p 0.0160 8.0000 1.0946 -----------Y 848.032630 0 0.0000 199 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 848.032630 m 8.0000 239 | 7/9
16 h-m-p 0.0004 0.1768 1.2181 +++++ 848.032626 m 0.1768 256 | 8/9
17 h-m-p 1.6000 8.0000 0.0000 Y 848.032626 0 1.6000 268 | 8/9
18 h-m-p 0.0160 8.0000 0.0000 Y 848.032626 0 0.0160 281
Out..
lnL = -848.032626
282 lfun, 846 eigenQcodon, 3384 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048317 0.051711 0.047008 0.102129 0.069784 0.025403 0.000100 1.363121 0.217639 0.279335 1.353086
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.259692
np = 11
lnL0 = -917.446881
Iterating by ming2
Initial: fx= 917.446881
x= 0.04832 0.05171 0.04701 0.10213 0.06978 0.02540 0.00011 1.36312 0.21764 0.27933 1.35309
1 h-m-p 0.0000 0.0000 473.2133 ++ 916.733046 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 252.0483 +++ 886.307755 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0002 339.2738 ++ 866.789228 m 0.0002 45 | 3/11
4 h-m-p 0.0001 0.0003 72.0074 ++ 864.892121 m 0.0003 59 | 4/11
5 h-m-p 0.0000 0.0000 107473.2897 ++ 861.326973 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 179076.8148 ++ 859.044738 m 0.0000 87 | 6/11
7 h-m-p 0.0003 0.0013 18.5397 ----------.. | 6/11
8 h-m-p 0.0000 0.0001 286.3583 ++ 853.840086 m 0.0001 123 | 7/11
9 h-m-p 0.0160 8.0000 4.9602 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 205.3958 ++ 848.032632 m 0.0001 162 | 8/11
11 h-m-p 0.9366 8.0000 0.0000 ++ 848.032632 m 8.0000 176 | 8/11
12 h-m-p 0.0474 8.0000 0.0011 ++++ 848.032632 m 8.0000 195 | 8/11
13 h-m-p 0.0160 8.0000 2.4990 +++Y 848.032624 0 2.5136 215 | 8/11
14 h-m-p 1.6000 8.0000 0.1091 ++ 848.032624 m 8.0000 229 | 8/11
15 h-m-p 0.1989 8.0000 4.3896 ----------C 848.032624 0 0.0000 256 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 -Y 848.032624 0 0.0010 271 | 8/11
17 h-m-p 0.0160 8.0000 0.0005 ---Y 848.032624 0 0.0001 291
Out..
lnL = -848.032624
292 lfun, 1168 eigenQcodon, 5256 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -848.035428 S = -848.028708 -0.002569
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:02
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084797 0.080186 0.109188 0.034956 0.080215 0.081413 0.000100 0.696481 1.466354
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.242279
np = 9
lnL0 = -942.662449
Iterating by ming2
Initial: fx= 942.662449
x= 0.08480 0.08019 0.10919 0.03496 0.08021 0.08141 0.00011 0.69648 1.46635
1 h-m-p 0.0000 0.0000 469.3470 ++ 942.308475 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0132 53.6019 +++++ 919.659378 m 0.0132 29 | 2/9
3 h-m-p 0.0002 0.0012 131.8081 ++ 904.740757 m 0.0012 41 | 3/9
4 h-m-p 0.0003 0.0013 91.8045 ++ 869.405692 m 0.0013 53 | 4/9
5 h-m-p 0.0377 0.1886 2.7558 --------------.. | 4/9
6 h-m-p 0.0000 0.0000 414.7116 ++ 864.986754 m 0.0000 89 | 5/9
7 h-m-p 0.0019 0.0301 4.7500 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 358.6828 ++ 863.732955 m 0.0000 123 | 6/9
9 h-m-p 0.0007 0.0433 4.1217 -----------.. | 6/9
10 h-m-p 0.0000 0.0000 290.0739 ++ 863.706711 m 0.0000 156 | 7/9
11 h-m-p 0.0160 8.0000 1.0847 -------------.. | 7/9
12 h-m-p 0.0000 0.0004 197.9296 +++ 848.032649 m 0.0004 192 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 848.032649 0 1.6000 204 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 Y 848.032649 0 0.0160 217 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 Y 848.032649 0 1.6000 231 | 7/9
16 h-m-p 0.0020 0.0102 0.0000 --Y 848.032649 0 0.0000 247
Out..
lnL = -848.032649
248 lfun, 2728 eigenQcodon, 14880 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068215 0.044703 0.105773 0.042407 0.024287 0.067310 0.000100 0.900000 0.576321 1.088457 1.300027
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.672463
np = 11
lnL0 = -918.482793
Iterating by ming2
Initial: fx= 918.482793
x= 0.06821 0.04470 0.10577 0.04241 0.02429 0.06731 0.00011 0.90000 0.57632 1.08846 1.30003
1 h-m-p 0.0000 0.0000 464.8754 ++ 917.951809 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 147.5973 ++++ 888.800826 m 0.0015 32 | 2/11
3 h-m-p 0.0000 0.0002 549.4463 ++ 870.687835 m 0.0002 46 | 3/11
4 h-m-p 0.0001 0.0005 85.8258 ++ 869.164226 m 0.0005 60 | 4/11
5 h-m-p 0.0000 0.0001 2334.1854 ++ 857.678525 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 4182.9545 ++ 857.325249 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 4249.9241 ++ 852.802999 m 0.0001 102 | 7/11
8 h-m-p 0.0119 0.0594 9.7686 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 205.8384 ++ 848.032629 m 0.0001 141 | 8/11
10 h-m-p 1.4583 8.0000 0.0000 ++ 848.032629 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0041 +++++ 848.032629 m 8.0000 175 | 8/11
12 h-m-p 0.0294 2.5209 1.1092 ++++ 848.032620 m 2.5209 194 | 9/11
13 h-m-p 1.6000 8.0000 0.0596 -----------N 848.032620 0 0.0000 219 | 9/11
14 h-m-p 1.1873 8.0000 0.0000 N 848.032620 0 1.1873 235
Out..
lnL = -848.032620
236 lfun, 2832 eigenQcodon, 15576 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -848.031366 S = -848.028000 -0.001474
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:10
did 20 / 55 patterns 0:10
did 30 / 55 patterns 0:11
did 40 / 55 patterns 0:11
did 50 / 55 patterns 0:11
did 55 / 55 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
NC_002677_1_NP_301965_1_837_ML1351 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
**************************************************
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
NC_002677_1_NP_301965_1_837_ML1351 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
**************************************************
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NC_002677_1_NP_301965_1_837_ML1351 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
**************************************************
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
NC_002677_1_NP_301965_1_837_ML1351 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
**************************************************
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 YRRSPRAPAPGASD
NC_002677_1_NP_301965_1_837_ML1351 YRRSPRAPAPGASD
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 YRRSPRAPAPGASD
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 YRRSPRAPAPGASD
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 YRRSPRAPAPGASD
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 YRRSPRAPAPGASD
**************
>NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC >NC_002677_1_NP_301965_1_837_ML1351 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC >NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC >NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC >NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC >NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>NC_011896_1_WP_010908286_1_1423_MLBR_RS06715 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD >NC_002677_1_NP_301965_1_837_ML1351 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD >NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD >NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD >NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD >NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525 LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST YRRSPRAPAPGASD
#NEXUS
[ID: 5600241292]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908286_1_1423_MLBR_RS06715
NC_002677_1_NP_301965_1_837_ML1351
NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455
NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365
NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360
NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908286_1_1423_MLBR_RS06715,
2 NC_002677_1_NP_301965_1_837_ML1351,
3 NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455,
4 NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365,
5 NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360,
6 NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06986589,2:0.06982473,3:0.06905784,4:0.07080261,5:0.06880368,6:0.06703008);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06986589,2:0.06982473,3:0.06905784,4:0.07080261,5:0.06880368,6:0.06703008);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -869.31 -872.50
2 -869.34 -872.48
--------------------------------------
TOTAL -869.32 -872.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893844 0.087664 0.359805 1.449046 0.863673 1443.45 1472.23 1.000
r(A<->C){all} 0.166218 0.018921 0.000159 0.441359 0.131300 316.40 397.03 1.006
r(A<->G){all} 0.163909 0.019267 0.000037 0.438457 0.129028 197.63 283.06 1.000
r(A<->T){all} 0.175413 0.020889 0.000014 0.460077 0.137527 225.03 234.81 1.000
r(C<->G){all} 0.162349 0.019607 0.000020 0.452484 0.124952 315.00 326.82 1.002
r(C<->T){all} 0.158556 0.019721 0.000029 0.454070 0.121822 210.97 250.07 1.000
r(G<->T){all} 0.173555 0.021011 0.000025 0.462860 0.133901 160.01 190.77 1.011
pi(A){all} 0.161243 0.000208 0.134535 0.191519 0.160696 1261.10 1298.87 1.000
pi(C){all} 0.304911 0.000327 0.269199 0.339418 0.304584 932.48 1124.40 1.000
pi(G){all} 0.317185 0.000330 0.281544 0.350790 0.317053 1165.53 1261.50 1.000
pi(T){all} 0.216662 0.000266 0.185275 0.249153 0.216425 1049.46 1170.99 1.000
alpha{1,2} 0.427965 0.233591 0.000192 1.402163 0.260075 1185.77 1242.29 1.000
alpha{3} 0.475847 0.258918 0.000172 1.550464 0.304447 1308.79 1314.05 1.000
pinvar{all} 0.997654 0.000008 0.992495 0.999997 0.998514 1246.82 1267.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1351/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 214
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 4 4 4 4 4 4
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 4 4 4 4 4 4 | CCC 9 9 9 9 9 9 | CAC 4 4 4 4 4 4 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 8 8 8 8 8 8
CTG 2 2 2 2 2 2 | CCG 6 6 6 6 6 6 | CAG 1 1 1 1 1 1 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 3 3 3 3 3 3
ATC 5 5 5 5 5 5 | ACC 2 2 2 2 2 2 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 8 8 8 8 8 8 | Ala GCT 11 11 11 11 11 11 | Asp GAT 3 3 3 3 3 3 | Gly GGT 7 7 7 7 7 7
GTC 7 7 7 7 7 7 | GCC 13 13 13 13 13 13 | GAC 10 10 10 10 10 10 | GGC 7 7 7 7 7 7
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 6 6 6 6 6 6
GTG 5 5 5 5 5 5 | GCG 6 6 6 6 6 6 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908286_1_1423_MLBR_RS06715
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
#2: NC_002677_1_NP_301965_1_837_ML1351
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
#3: NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
#4: NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
#5: NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
#6: NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 24
TTC 0 | TCC 6 | TAC 24 | TGC 18
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 30
CTC 24 | CCC 54 | CAC 24 | CGC 6
CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 48
CTG 12 | CCG 36 | CAG 6 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 18
ATC 30 | ACC 12 | AAC 24 | AGC 18
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 48 | Ala A GCT 66 | Asp D GAT 18 | Gly G GGT 42
GTC 42 | GCC 78 | GAC 60 | GGC 42
GTA 12 | GCA 12 | Glu E GAA 12 | GGA 36
GTG 30 | GCG 36 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14486 C:0.25234 A:0.15421 G:0.44860
position 2: T:0.22897 C:0.30374 A:0.18692 G:0.28037
position 3: T:0.27570 C:0.35981 A:0.14019 G:0.22430
Average T:0.21651 C:0.30530 A:0.16044 G:0.31776
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -848.032629 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299882 1.300027
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908286_1_1423_MLBR_RS06715: 0.000004, NC_002677_1_NP_301965_1_837_ML1351: 0.000004, NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455: 0.000004, NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365: 0.000004, NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360: 0.000004, NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29988
omega (dN/dS) = 1.30003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 461.1 180.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -848.032626 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.619827 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908286_1_1423_MLBR_RS06715: 0.000004, NC_002677_1_NP_301965_1_837_ML1351: 0.000004, NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455: 0.000004, NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365: 0.000004, NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360: 0.000004, NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61983 0.38017
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 470.0 172.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -848.032624 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.013503 0.866049 0.000001 5.057597
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908286_1_1423_MLBR_RS06715: 0.000004, NC_002677_1_NP_301965_1_837_ML1351: 0.000004, NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455: 0.000004, NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365: 0.000004, NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360: 0.000004, NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01350 0.86605 0.12045
w: 0.00000 1.00000 5.05760
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
7..2 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
7..3 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
7..4 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
7..5 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
7..6 0.000 470.0 172.0 1.4752 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908286_1_1423_MLBR_RS06715)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908286_1_1423_MLBR_RS06715)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -848.032649 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.350286
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908286_1_1423_MLBR_RS06715: 0.000004, NC_002677_1_NP_301965_1_837_ML1351: 0.000004, NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455: 0.000004, NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365: 0.000004, NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360: 0.000004, NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.35029
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 470.0 172.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -848.032620 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.214821 4.437779
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908286_1_1423_MLBR_RS06715: 0.000004, NC_002677_1_NP_301965_1_837_ML1351: 0.000004, NZ_LVXE01000016_1_WP_010908286_1_593_A3216_RS06455: 0.000004, NZ_LYPH01000019_1_WP_010908286_1_711_A8144_RS03365: 0.000004, NZ_CP029543_1_WP_010908286_1_1445_DIJ64_RS07360: 0.000004, NZ_AP014567_1_WP_010908286_1_1478_JK2ML_RS07525: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.21482
(p1 = 0.99999) w = 4.43778
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 4.43778
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
7..2 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
7..3 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
7..4 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
7..5 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
7..6 0.000 470.0 172.0 4.4377 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908286_1_1423_MLBR_RS06715)
Pr(w>1) post mean +- SE for w
1 L 1.000** 4.438
2 R 1.000** 4.438
3 S 1.000** 4.438
4 P 1.000** 4.438
5 R 1.000** 4.438
6 R 1.000** 4.438
7 C 1.000** 4.438
8 K 1.000** 4.438
9 I 1.000** 4.438
10 C 1.000** 4.438
11 A 1.000** 4.438
12 V 1.000** 4.438
13 S 1.000** 4.438
14 A 1.000** 4.438
15 D 1.000** 4.438
16 Q 1.000** 4.438
17 L 1.000** 4.438
18 V 1.000** 4.438
19 V 1.000** 4.438
20 D 1.000** 4.438
21 P 1.000** 4.438
22 V 1.000** 4.438
23 V 1.000** 4.438
24 A 1.000** 4.438
25 A 1.000** 4.438
26 H 1.000** 4.438
27 R 1.000** 4.438
28 L 1.000** 4.438
29 L 1.000** 4.438
30 G 1.000** 4.438
31 A 1.000** 4.438
32 T 1.000** 4.438
33 I 1.000** 4.438
34 T 1.000** 4.438
35 G 1.000** 4.438
36 R 1.000** 4.438
37 G 1.000** 4.438
38 V 1.000** 4.438
39 C 1.000** 4.438
40 A 1.000** 4.438
41 I 1.000** 4.438
42 V 1.000** 4.438
43 V 1.000** 4.438
44 E 1.000** 4.438
45 V 1.000** 4.438
46 E 1.000** 4.438
47 A 1.000** 4.438
48 Y 1.000** 4.438
49 G 1.000** 4.438
50 G 1.000** 4.438
51 V 1.000** 4.438
52 P 1.000** 4.438
53 D 1.000** 4.438
54 G 1.000** 4.438
55 P 1.000** 4.438
56 W 1.000** 4.438
57 P 1.000** 4.438
58 D 1.000** 4.438
59 A 1.000** 4.438
60 A 1.000** 4.438
61 A 1.000** 4.438
62 H 1.000** 4.438
63 S 1.000** 4.438
64 Y 1.000** 4.438
65 H 1.000** 4.438
66 G 1.000** 4.438
67 R 1.000** 4.438
68 N 1.000** 4.438
69 D 1.000** 4.438
70 R 1.000** 4.438
71 N 1.000** 4.438
72 A 1.000** 4.438
73 V 1.000** 4.438
74 M 1.000** 4.438
75 F 1.000** 4.438
76 G 1.000** 4.438
77 P 1.000** 4.438
78 P 1.000** 4.438
79 G 1.000** 4.438
80 R 1.000** 4.438
81 L 1.000** 4.438
82 Y 1.000** 4.438
83 T 1.000** 4.438
84 Y 1.000** 4.438
85 C 1.000** 4.438
86 S 1.000** 4.438
87 H 1.000** 4.438
88 G 1.000** 4.438
89 I 1.000** 4.438
90 H 1.000** 4.438
91 V 1.000** 4.438
92 C 1.000** 4.438
93 A 1.000** 4.438
94 N 1.000** 4.438
95 V 1.000** 4.438
96 S 1.000** 4.438
97 C 1.000** 4.438
98 G 1.000** 4.438
99 P 1.000** 4.438
100 D 1.000** 4.438
101 G 1.000** 4.438
102 T 1.000** 4.438
103 A 1.000** 4.438
104 A 1.000** 4.438
105 A 1.000** 4.438
106 V 1.000** 4.438
107 L 1.000** 4.438
108 I 1.000** 4.438
109 R 1.000** 4.438
110 A 1.000** 4.438
111 G 1.000** 4.438
112 A 1.000** 4.438
113 L 1.000** 4.438
114 E 1.000** 4.438
115 N 1.000** 4.438
116 G 1.000** 4.438
117 A 1.000** 4.438
118 D 1.000** 4.438
119 V 1.000** 4.438
120 A 1.000** 4.438
121 R 1.000** 4.438
122 S 1.000** 4.438
123 R 1.000** 4.438
124 R 1.000** 4.438
125 G 1.000** 4.438
126 A 1.000** 4.438
127 S 1.000** 4.438
128 V 1.000** 4.438
129 R 1.000** 4.438
130 T 1.000** 4.438
131 V 1.000** 4.438
132 A 1.000** 4.438
133 L 1.000** 4.438
134 A 1.000** 4.438
135 R 1.000** 4.438
136 G 1.000** 4.438
137 P 1.000** 4.438
138 G 1.000** 4.438
139 N 1.000** 4.438
140 L 1.000** 4.438
141 C 1.000** 4.438
142 S 1.000** 4.438
143 A 1.000** 4.438
144 L 1.000** 4.438
145 G 1.000** 4.438
146 I 1.000** 4.438
147 T 1.000** 4.438
148 M 1.000** 4.438
149 D 1.000** 4.438
150 D 1.000** 4.438
151 N 1.000** 4.438
152 G 1.000** 4.438
153 I 1.000** 4.438
154 D 1.000** 4.438
155 V 1.000** 4.438
156 F 1.000** 4.438
157 A 1.000** 4.438
158 A 1.000** 4.438
159 D 1.000** 4.438
160 S 1.000** 4.438
161 P 1.000** 4.438
162 V 1.000** 4.438
163 T 1.000** 4.438
164 L 1.000** 4.438
165 V 1.000** 4.438
166 L 1.000** 4.438
167 N 1.000** 4.438
168 E 1.000** 4.438
169 A 1.000** 4.438
170 Q 1.000** 4.438
171 E 1.000** 4.438
172 A 1.000** 4.438
173 M 1.000** 4.438
174 S 1.000** 4.438
175 G 1.000** 4.438
176 P 1.000** 4.438
177 R 1.000** 4.438
178 V 1.000** 4.438
179 G 1.000** 4.438
180 I 1.000** 4.438
181 S 1.000** 4.438
182 H 1.000** 4.438
183 A 1.000** 4.438
184 A 1.000** 4.438
185 D 1.000** 4.438
186 R 1.000** 4.438
187 P 1.000** 4.438
188 W 1.000** 4.438
189 R 1.000** 4.438
190 L 1.000** 4.438
191 W 1.000** 4.438
192 L 1.000** 4.438
193 P 1.000** 4.438
194 G 1.000** 4.438
195 R 1.000** 4.438
196 P 1.000** 4.438
197 E 1.000** 4.438
198 V 1.000** 4.438
199 S 1.000** 4.438
200 T 1.000** 4.438
201 Y 1.000** 4.438
202 R 1.000** 4.438
203 R 1.000** 4.438
204 S 1.000** 4.438
205 P 1.000** 4.438
206 R 1.000** 4.438
207 A 1.000** 4.438
208 P 1.000** 4.438
209 A 1.000** 4.438
210 P 1.000** 4.438
211 G 1.000** 4.438
212 A 1.000** 4.438
213 S 1.000** 4.438
214 D 1.000** 4.438
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908286_1_1423_MLBR_RS06715)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:11
Model 1: NearlyNeutral -848.032626 Model 2: PositiveSelection -848.032624 Model 0: one-ratio -848.032629 Model 7: beta -848.032649 Model 8: beta&w>1 -848.03262 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 5.800000008093775E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
