--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:43:37 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1351/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -869.31          -872.50
2       -869.34          -872.48
--------------------------------------
TOTAL     -869.32          -872.49
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893844    0.087664    0.359805    1.449046    0.863673   1443.45   1472.23    1.000
r(A<->C){all}   0.166218    0.018921    0.000159    0.441359    0.131300    316.40    397.03    1.006
r(A<->G){all}   0.163909    0.019267    0.000037    0.438457    0.129028    197.63    283.06    1.000
r(A<->T){all}   0.175413    0.020889    0.000014    0.460077    0.137527    225.03    234.81    1.000
r(C<->G){all}   0.162349    0.019607    0.000020    0.452484    0.124952    315.00    326.82    1.002
r(C<->T){all}   0.158556    0.019721    0.000029    0.454070    0.121822    210.97    250.07    1.000
r(G<->T){all}   0.173555    0.021011    0.000025    0.462860    0.133901    160.01    190.77    1.011
pi(A){all}      0.161243    0.000208    0.134535    0.191519    0.160696   1261.10   1298.87    1.000
pi(C){all}      0.304911    0.000327    0.269199    0.339418    0.304584    932.48   1124.40    1.000
pi(G){all}      0.317185    0.000330    0.281544    0.350790    0.317053   1165.53   1261.50    1.000
pi(T){all}      0.216662    0.000266    0.185275    0.249153    0.216425   1049.46   1170.99    1.000
alpha{1,2}      0.427965    0.233591    0.000192    1.402163    0.260075   1185.77   1242.29    1.000
alpha{3}        0.475847    0.258918    0.000172    1.550464    0.304447   1308.79   1314.05    1.000
pinvar{all}     0.997654    0.000008    0.992495    0.999997    0.998514   1246.82   1267.81    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-848.032626
Model 2: PositiveSelection	-848.032624
Model 0: one-ratio	-848.032629
Model 7: beta	-848.032649
Model 8: beta&w>1	-848.03262


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	5.800000008093775E-5
>C1
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C2
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C3
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C4
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C5
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C6
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=214 

C1              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C2              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C3              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C4              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C5              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C6              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
                **************************************************

C1              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C2              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C3              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C4              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C5              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C6              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
                **************************************************

C1              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C2              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C3              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C4              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C5              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C6              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
                **************************************************

C1              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C2              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C3              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C4              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C5              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C6              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
                **************************************************

C1              YRRSPRAPAPGASD
C2              YRRSPRAPAPGASD
C3              YRRSPRAPAPGASD
C4              YRRSPRAPAPGASD
C5              YRRSPRAPAPGASD
C6              YRRSPRAPAPGASD
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  214 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  214 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6420]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6420]--->[6420]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.484 Mb, Max= 30.760 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C2              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C3              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C4              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C5              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
C6              LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
                **************************************************

C1              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C2              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C3              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C4              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C5              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
C6              VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
                **************************************************

C1              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C2              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C3              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C4              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C5              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
C6              GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
                **************************************************

C1              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C2              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C3              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C4              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C5              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
C6              NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
                **************************************************

C1              YRRSPRAPAPGASD
C2              YRRSPRAPAPGASD
C3              YRRSPRAPAPGASD
C4              YRRSPRAPAPGASD
C5              YRRSPRAPAPGASD
C6              YRRSPRAPAPGASD
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C2              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C3              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C4              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C5              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
C6              TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
                **************************************************

C1              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C2              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C3              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C4              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C5              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
C6              GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
                **************************************************

C1              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C2              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C3              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C4              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C5              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
C6              CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
                **************************************************

C1              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C2              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C3              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C4              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C5              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
C6              GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
                **************************************************

C1              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C2              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C3              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C4              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C5              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
C6              GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
                **************************************************

C1              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C2              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C3              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C4              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C5              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
C6              ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
                **************************************************

C1              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C2              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C3              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C4              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C5              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
C6              GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
                **************************************************

C1              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C2              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C3              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C4              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C5              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
C6              CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
                **************************************************

C1              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C2              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C3              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C4              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C5              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
C6              CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
                **************************************************

C1              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C2              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C3              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C4              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C5              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
C6              AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
                **************************************************

C1              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C2              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C3              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C4              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C5              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
C6              TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
                **************************************************

C1              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C2              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C3              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C4              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C5              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
C6              CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
                **************************************************

C1              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C2              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C3              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C4              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C5              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
C6              TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
                ******************************************



>C1
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C2
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C3
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C4
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C5
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C6
TTGCGATCACCACGGCGGTGCAAAATCTGTGCCGTGAGTGCTGACCAATT
GGTTGTTGACCCGGTTGTTGCCGCGCATCGACTACTCGGTGCCACCATCA
CCGGCCGGGGAGTGTGTGCCATCGTCGTTGAGGTGGAGGCGTACGGTGGG
GTTCCCGACGGTCCCTGGCCCGACGCCGCCGCCCACTCCTACCACGGCCG
GAACGACCGTAACGCTGTGATGTTTGGGCCGCCCGGCCGACTCTACACTT
ACTGTAGCCACGGCATCCATGTATGCGCCAATGTCTCGTGTGGACCGGAT
GGGACGGCTGCCGCAGTCCTTATTCGGGCCGGTGCTCTCGAGAACGGCGC
CGACGTCGCCCGGTCTCGGCGCGGCGCGTCAGTCCGTACTGTTGCGTTAG
CGCGTGGACCCGGAAATCTGTGCTCTGCTTTAGGAATTACTATGGATGAC
AACGGTATTGATGTATTTGCTGCTGACAGCCCGGTGACATTGGTCCTCAA
TGAGGCTCAGGAAGCGATGTCGGGTCCACGTGTTGGAATCAGTCACGCAG
CCGACCGACCCTGGCGATTGTGGCTGCCGGGCCGACCCGAAGTCTCGACT
TATCGTCGAAGTCCCCGAGCTCCGGCTCCCGGTGCTAGCGAC
>C1
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C2
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C3
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C4
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C5
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD
>C6
LRSPRRCKICAVSADQLVVDPVVAAHRLLGATITGRGVCAIVVEVEAYGG
VPDGPWPDAAAHSYHGRNDRNAVMFGPPGRLYTYCSHGIHVCANVSCGPD
GTAAAVLIRAGALENGADVARSRRGASVRTVALARGPGNLCSALGITMDD
NGIDVFAADSPVTLVLNEAQEAMSGPRVGISHAADRPWRLWLPGRPEVST
YRRSPRAPAPGASD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 642 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858933
      Setting output file names to "/data/6res/ML1351/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1685683152
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5600241292
      Seed = 1918191050
      Swapseed = 1579858933
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1436.826776 -- -24.965149
         Chain 2 -- -1436.826693 -- -24.965149
         Chain 3 -- -1436.826693 -- -24.965149
         Chain 4 -- -1436.826693 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1436.826776 -- -24.965149
         Chain 2 -- -1436.826693 -- -24.965149
         Chain 3 -- -1436.826776 -- -24.965149
         Chain 4 -- -1436.826776 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1436.827] (-1436.827) (-1436.827) (-1436.827) * [-1436.827] (-1436.827) (-1436.827) (-1436.827) 
        500 -- (-887.122) (-893.473) (-901.313) [-881.502] * [-880.379] (-879.794) (-901.591) (-882.889) -- 0:00:00
       1000 -- (-887.614) (-883.486) (-877.502) [-877.143] * (-884.972) (-883.709) (-881.327) [-883.471] -- 0:00:00
       1500 -- (-879.263) (-882.951) (-884.531) [-879.213] * (-880.479) (-879.642) [-879.992] (-880.203) -- 0:00:00
       2000 -- (-893.325) (-882.685) [-881.015] (-881.071) * [-876.120] (-886.287) (-877.575) (-883.627) -- 0:00:00
       2500 -- (-875.968) (-879.918) [-874.606] (-879.742) * (-880.210) (-877.047) [-879.443] (-896.760) -- 0:00:00
       3000 -- [-878.641] (-884.266) (-873.907) (-879.545) * (-873.543) (-871.408) [-876.113] (-877.959) -- 0:00:00
       3500 -- (-879.375) [-878.571] (-879.752) (-881.032) * (-887.211) (-883.616) (-882.597) [-876.135] -- 0:00:00
       4000 -- (-887.368) [-882.348] (-879.912) (-881.322) * [-878.547] (-877.266) (-878.711) (-872.158) -- 0:00:00
       4500 -- [-873.515] (-877.584) (-881.451) (-877.561) * [-875.664] (-874.519) (-878.248) (-886.538) -- 0:00:00
       5000 -- [-879.944] (-875.951) (-881.359) (-879.864) * (-878.043) (-876.639) (-880.955) [-879.352] -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-882.053) [-882.078] (-876.976) (-872.785) * (-876.905) (-879.619) (-878.733) [-883.422] -- 0:00:00
       6000 -- (-880.727) (-891.317) (-881.209) [-878.561] * (-879.597) [-880.308] (-887.903) (-881.510) -- 0:00:00
       6500 -- (-874.679) [-886.450] (-879.344) (-876.424) * [-879.494] (-887.571) (-881.688) (-881.059) -- 0:00:00
       7000 -- (-877.319) (-877.260) [-878.376] (-879.386) * (-882.236) (-884.548) (-872.509) [-877.959] -- 0:00:00
       7500 -- (-877.483) (-876.814) (-876.414) [-875.040] * (-875.254) [-877.485] (-881.789) (-887.128) -- 0:00:00
       8000 -- [-881.404] (-884.217) (-877.726) (-888.456) * [-873.135] (-873.960) (-877.817) (-874.867) -- 0:00:00
       8500 -- [-881.247] (-872.835) (-875.307) (-878.968) * (-880.520) (-892.235) (-887.602) [-878.511] -- 0:00:00
       9000 -- [-880.250] (-876.692) (-880.563) (-876.119) * (-888.995) [-882.290] (-874.806) (-881.440) -- 0:00:00
       9500 -- [-879.074] (-884.922) (-888.169) (-881.259) * (-879.936) (-879.560) (-881.364) [-876.606] -- 0:00:00
      10000 -- [-873.711] (-877.447) (-881.012) (-877.995) * (-883.275) (-879.220) (-882.211) [-877.202] -- 0:00:00

      Average standard deviation of split frequencies: 0.095754

      10500 -- (-878.284) (-877.879) [-882.518] (-883.713) * (-869.134) (-882.874) (-881.853) [-875.609] -- 0:00:00
      11000 -- (-882.578) (-887.302) [-879.555] (-880.935) * (-870.098) (-875.658) (-885.181) [-875.297] -- 0:00:00
      11500 -- (-877.818) (-882.096) (-884.408) [-879.154] * (-868.169) (-884.403) (-880.390) [-880.192] -- 0:00:00
      12000 -- (-876.632) (-884.817) (-881.874) [-875.011] * (-869.961) (-877.848) (-879.590) [-877.326] -- 0:00:00
      12500 -- (-877.075) (-875.589) (-891.934) [-879.768] * (-868.971) (-880.943) (-879.164) [-884.104] -- 0:00:00
      13000 -- [-875.039] (-878.621) (-880.561) (-877.255) * (-868.066) (-879.430) [-887.193] (-878.434) -- 0:00:00
      13500 -- (-881.739) (-878.787) [-871.965] (-881.236) * (-869.289) (-876.905) (-875.718) [-879.719] -- 0:00:00
      14000 -- [-877.131] (-879.543) (-872.215) (-875.224) * [-871.933] (-881.046) (-876.627) (-879.642) -- 0:01:10
      14500 -- (-880.574) (-884.731) (-870.729) [-877.234] * [-873.926] (-880.205) (-882.151) (-876.158) -- 0:01:07
      15000 -- (-877.991) (-879.710) [-868.423] (-876.989) * (-867.944) (-873.494) (-879.462) [-876.240] -- 0:01:05

      Average standard deviation of split frequencies: 0.065473

      15500 -- [-876.181] (-895.038) (-868.866) (-878.525) * (-870.616) (-881.537) [-882.197] (-882.698) -- 0:01:03
      16000 -- (-881.320) [-886.570] (-870.089) (-889.442) * (-871.259) (-885.372) (-877.697) [-875.595] -- 0:01:01
      16500 -- [-877.129] (-887.330) (-869.596) (-880.344) * (-868.224) (-875.286) (-879.530) [-875.271] -- 0:00:59
      17000 -- (-884.859) (-872.820) [-869.198] (-879.925) * (-870.068) (-878.227) (-884.151) [-878.437] -- 0:00:57
      17500 -- (-887.641) (-870.267) (-868.505) [-876.440] * (-870.709) (-880.371) (-884.302) [-875.466] -- 0:00:56
      18000 -- [-874.614] (-871.062) (-868.835) (-887.562) * (-870.572) (-881.612) [-875.786] (-878.061) -- 0:00:54
      18500 -- [-877.200] (-874.507) (-870.562) (-885.690) * (-871.016) (-879.161) (-876.267) [-881.906] -- 0:00:53
      19000 -- (-875.887) (-872.022) (-869.536) [-873.837] * [-870.699] (-893.418) (-879.295) (-881.702) -- 0:00:51
      19500 -- (-880.342) (-870.562) (-868.214) [-876.895] * (-872.152) (-876.371) [-872.285] (-885.495) -- 0:00:50
      20000 -- (-891.519) (-877.378) [-867.926] (-887.410) * (-871.170) (-879.323) (-871.991) [-878.928] -- 0:00:49

      Average standard deviation of split frequencies: 0.049897

      20500 -- (-879.747) (-873.255) (-869.828) [-871.001] * (-874.155) (-882.171) (-870.286) [-873.953] -- 0:00:47
      21000 -- (-884.174) [-868.148] (-870.003) (-871.630) * (-870.936) (-878.396) [-869.732] (-876.079) -- 0:00:46
      21500 -- (-879.147) (-869.727) (-869.061) [-868.608] * (-874.500) (-877.535) (-873.288) [-874.621] -- 0:00:45
      22000 -- (-885.386) (-869.804) (-868.345) [-868.416] * (-873.398) [-879.999] (-872.929) (-877.183) -- 0:00:44
      22500 -- [-876.092] (-869.725) (-869.845) (-869.190) * (-871.357) (-880.594) (-869.929) [-876.891] -- 0:00:43
      23000 -- (-883.626) [-869.955] (-877.141) (-870.205) * (-871.802) (-879.881) [-868.722] (-878.716) -- 0:00:42
      23500 -- (-884.527) [-867.919] (-880.008) (-871.042) * (-872.263) [-874.635] (-868.886) (-877.792) -- 0:00:41
      24000 -- [-879.946] (-868.447) (-874.402) (-870.256) * (-874.766) [-875.161] (-870.990) (-881.510) -- 0:00:40
      24500 -- [-881.885] (-868.621) (-869.979) (-869.306) * (-871.357) (-881.813) [-872.087] (-883.095) -- 0:00:39
      25000 -- (-882.703) (-871.214) [-872.465] (-868.558) * [-870.402] (-883.729) (-868.512) (-884.712) -- 0:00:39

      Average standard deviation of split frequencies: 0.038734

      25500 -- [-889.884] (-875.534) (-871.045) (-868.926) * (-869.908) (-887.513) (-871.074) [-874.129] -- 0:00:38
      26000 -- (-885.017) (-872.131) (-872.711) [-873.102] * [-869.325] (-882.558) (-868.267) (-881.980) -- 0:00:37
      26500 -- (-879.915) [-868.851] (-869.120) (-868.977) * (-870.412) (-879.585) (-869.358) [-880.904] -- 0:00:36
      27000 -- [-880.205] (-870.847) (-871.131) (-870.849) * [-869.714] (-881.962) (-868.171) (-880.068) -- 0:00:36
      27500 -- (-885.891) [-871.943] (-870.534) (-868.533) * (-868.375) [-876.482] (-868.775) (-883.608) -- 0:00:35
      28000 -- (-888.674) (-872.497) (-871.495) [-871.665] * (-868.971) (-882.014) [-868.895] (-881.519) -- 0:00:34
      28500 -- [-882.470] (-870.819) (-871.179) (-869.423) * (-868.489) [-881.267] (-873.488) (-883.078) -- 0:00:34
      29000 -- (-876.050) (-871.377) (-868.780) [-868.925] * (-868.300) (-884.246) [-869.559] (-879.240) -- 0:00:33
      29500 -- (-880.396) [-868.672] (-872.392) (-870.348) * [-868.226] (-884.744) (-869.208) (-876.115) -- 0:00:32
      30000 -- (-882.976) (-868.012) (-870.657) [-867.963] * (-870.373) [-880.929] (-868.772) (-880.083) -- 0:01:04

      Average standard deviation of split frequencies: 0.029975

      30500 -- [-876.207] (-868.309) (-871.698) (-868.001) * [-870.362] (-875.498) (-872.559) (-884.863) -- 0:01:03
      31000 -- (-877.271) (-868.258) (-871.794) [-871.128] * (-871.649) [-878.231] (-868.651) (-880.472) -- 0:01:02
      31500 -- (-880.199) (-868.350) (-873.157) [-870.943] * (-869.404) [-876.494] (-870.754) (-880.723) -- 0:01:01
      32000 -- (-882.295) (-870.034) [-871.435] (-868.103) * (-869.404) (-884.113) (-870.679) [-875.655] -- 0:01:00
      32500 -- (-878.710) [-868.825] (-868.382) (-870.360) * [-868.865] (-876.485) (-873.554) (-877.135) -- 0:00:59
      33000 -- (-879.133) (-868.718) (-868.240) [-868.773] * (-871.043) (-879.306) (-871.681) [-882.452] -- 0:00:58
      33500 -- (-881.657) (-869.620) [-873.228] (-868.813) * (-872.034) [-877.810] (-869.153) (-883.946) -- 0:00:57
      34000 -- [-878.928] (-869.636) (-869.607) (-869.355) * (-868.804) (-878.386) [-869.230] (-876.601) -- 0:00:56
      34500 -- (-875.790) (-872.335) (-868.771) [-869.011] * [-869.388] (-874.916) (-875.341) (-879.389) -- 0:00:55
      35000 -- [-882.352] (-870.739) (-870.490) (-868.905) * (-872.379) [-873.368] (-868.207) (-887.088) -- 0:00:55

      Average standard deviation of split frequencies: 0.034046

      35500 -- [-879.782] (-868.852) (-868.651) (-872.420) * (-869.826) (-878.570) (-868.201) [-873.899] -- 0:00:54
      36000 -- (-881.251) [-869.779] (-868.517) (-874.594) * (-868.769) (-883.462) (-870.627) [-879.455] -- 0:00:53
      36500 -- (-877.231) (-870.904) [-868.897] (-868.482) * (-871.339) (-884.425) (-868.817) [-878.773] -- 0:00:52
      37000 -- (-880.151) (-870.843) (-869.700) [-872.050] * (-868.452) (-878.194) [-868.975] (-883.239) -- 0:00:52
      37500 -- (-875.627) (-870.859) (-869.374) [-870.924] * [-869.570] (-880.894) (-871.360) (-878.444) -- 0:00:51
      38000 -- (-877.523) (-868.064) [-870.103] (-873.676) * (-870.721) (-891.660) (-873.345) [-876.743] -- 0:00:50
      38500 -- (-873.092) (-868.206) [-873.100] (-872.793) * (-869.736) [-877.710] (-870.755) (-871.754) -- 0:00:49
      39000 -- [-878.708] (-871.204) (-870.424) (-870.357) * [-870.720] (-882.920) (-868.917) (-883.095) -- 0:00:49
      39500 -- (-880.117) (-870.806) (-868.772) [-871.787] * (-871.402) (-880.975) [-868.467] (-880.804) -- 0:00:48
      40000 -- (-878.269) (-870.308) [-868.976] (-871.113) * (-868.171) (-883.912) [-869.279] (-875.271) -- 0:00:48

      Average standard deviation of split frequencies: 0.028152

      40500 -- (-875.555) [-871.277] (-868.194) (-870.053) * (-870.737) (-876.261) [-869.917] (-874.437) -- 0:00:47
      41000 -- (-885.735) (-870.345) (-867.883) [-870.119] * (-874.145) (-877.900) [-870.573] (-880.921) -- 0:00:46
      41500 -- (-880.366) (-875.612) [-871.603] (-871.679) * (-872.305) (-878.869) [-869.496] (-876.587) -- 0:00:46
      42000 -- (-874.880) [-870.243] (-869.517) (-870.859) * (-870.101) [-874.737] (-868.668) (-879.792) -- 0:00:45
      42500 -- (-876.686) [-870.683] (-873.497) (-869.963) * (-868.503) (-881.305) [-868.308] (-878.875) -- 0:00:45
      43000 -- [-883.140] (-869.997) (-871.618) (-868.064) * (-870.149) (-889.313) [-870.787] (-873.387) -- 0:00:44
      43500 -- (-891.200) (-868.786) (-871.898) [-868.377] * (-870.198) (-885.965) (-874.126) [-880.698] -- 0:00:43
      44000 -- (-883.868) (-870.536) (-872.902) [-868.944] * (-870.915) (-868.796) [-870.041] (-880.442) -- 0:00:43
      44500 -- (-869.834) (-869.723) [-871.944] (-869.888) * (-872.109) (-870.174) [-869.624] (-874.416) -- 0:00:42
      45000 -- (-871.039) (-869.724) (-870.658) [-868.981] * (-872.314) (-869.732) [-869.604] (-877.355) -- 0:00:42

      Average standard deviation of split frequencies: 0.034160

      45500 -- (-869.650) [-872.780] (-869.082) (-871.577) * (-876.696) [-869.692] (-868.708) (-887.801) -- 0:00:41
      46000 -- (-870.429) [-868.263] (-869.081) (-869.447) * (-870.307) (-868.474) (-870.917) [-880.772] -- 0:00:41
      46500 -- (-868.931) [-871.027] (-874.302) (-869.225) * (-871.427) (-869.376) (-869.625) [-882.061] -- 0:01:01
      47000 -- (-870.380) (-870.373) (-875.963) [-871.425] * (-868.714) (-870.999) (-869.595) [-876.284] -- 0:01:00
      47500 -- (-871.810) [-871.498] (-869.943) (-871.869) * (-869.194) (-869.158) [-869.990] (-879.850) -- 0:01:00
      48000 -- (-869.578) (-873.751) (-870.815) [-869.678] * (-869.551) (-869.091) (-869.409) [-875.669] -- 0:00:59
      48500 -- [-869.544] (-869.210) (-869.314) (-868.685) * (-870.248) (-869.505) [-870.168] (-882.268) -- 0:00:58
      49000 -- (-871.263) [-869.545] (-871.665) (-872.053) * [-868.861] (-870.005) (-870.351) (-885.173) -- 0:00:58
      49500 -- [-869.365] (-870.184) (-869.253) (-872.067) * (-870.495) [-869.183] (-870.715) (-879.842) -- 0:00:57
      50000 -- [-870.656] (-869.214) (-869.400) (-868.698) * (-879.008) (-871.799) [-869.731] (-876.050) -- 0:00:57

      Average standard deviation of split frequencies: 0.030127

      50500 -- (-867.736) (-868.890) [-867.981] (-868.605) * (-879.580) (-870.991) (-870.474) [-875.402] -- 0:00:56
      51000 -- [-868.107] (-870.118) (-874.362) (-868.112) * (-869.720) (-871.475) (-869.926) [-881.702] -- 0:00:55
      51500 -- (-868.125) [-871.003] (-869.677) (-868.974) * (-874.238) (-870.263) [-872.355] (-873.744) -- 0:00:55
      52000 -- (-869.858) (-869.908) (-872.537) [-868.664] * (-874.042) [-871.187] (-868.560) (-877.810) -- 0:00:54
      52500 -- (-867.688) (-871.213) (-872.440) [-870.191] * (-870.304) (-869.966) [-870.018] (-896.419) -- 0:00:54
      53000 -- (-868.095) (-870.057) (-870.718) [-868.966] * (-872.736) (-872.325) [-870.570] (-882.858) -- 0:00:53
      53500 -- (-869.251) (-871.479) (-871.376) [-868.863] * (-871.225) (-870.796) [-869.134] (-882.309) -- 0:00:53
      54000 -- [-870.460] (-871.698) (-869.149) (-867.970) * (-870.568) [-869.024] (-870.604) (-883.415) -- 0:00:52
      54500 -- (-869.516) (-870.735) [-871.049] (-868.031) * (-870.559) (-870.753) (-869.773) [-874.692] -- 0:00:52
      55000 -- [-868.897] (-872.143) (-873.043) (-869.126) * (-868.585) (-868.166) [-868.133] (-878.121) -- 0:00:51

      Average standard deviation of split frequencies: 0.023570

      55500 -- [-869.039] (-872.247) (-876.507) (-867.856) * (-869.437) (-869.547) [-870.092] (-881.362) -- 0:00:51
      56000 -- (-869.088) (-869.736) (-868.150) [-870.163] * (-870.471) (-869.050) [-872.177] (-881.670) -- 0:00:50
      56500 -- (-868.514) [-868.336] (-868.150) (-868.451) * (-869.945) (-868.073) [-871.082] (-878.054) -- 0:00:50
      57000 -- [-869.123] (-868.955) (-868.150) (-871.860) * (-868.248) (-869.122) [-870.597] (-885.582) -- 0:00:49
      57500 -- [-868.841] (-873.973) (-873.132) (-870.271) * (-871.335) (-868.125) (-869.830) [-880.736] -- 0:00:49
      58000 -- (-869.020) (-869.303) (-871.260) [-870.563] * (-869.225) (-875.514) (-868.762) [-886.219] -- 0:00:48
      58500 -- (-869.738) (-868.326) (-872.808) [-872.226] * (-871.677) [-874.883] (-872.119) (-876.446) -- 0:00:48
      59000 -- (-873.572) (-869.616) [-869.401] (-872.323) * (-869.369) [-875.053] (-869.196) (-876.811) -- 0:00:47
      59500 -- (-873.837) (-869.910) (-869.178) [-869.698] * [-868.276] (-868.811) (-869.364) (-878.931) -- 0:00:47
      60000 -- (-869.793) (-876.798) [-868.545] (-871.557) * [-869.417] (-869.174) (-870.079) (-880.721) -- 0:00:47

      Average standard deviation of split frequencies: 0.023700

      60500 -- (-869.812) (-873.518) [-868.555] (-869.104) * (-871.311) (-869.323) (-871.504) [-873.133] -- 0:00:46
      61000 -- (-870.005) (-871.906) (-868.069) [-868.328] * (-869.724) (-870.110) [-869.963] (-883.813) -- 0:00:46
      61500 -- (-870.180) (-871.399) [-870.830] (-869.530) * (-875.649) (-871.021) [-868.816] (-881.711) -- 0:00:45
      62000 -- (-870.742) (-870.802) [-868.350] (-870.365) * (-869.460) (-869.890) (-873.201) [-877.093] -- 0:00:45
      62500 -- [-870.525] (-870.392) (-868.749) (-871.939) * (-873.132) [-868.653] (-873.740) (-880.914) -- 0:01:00
      63000 -- [-868.570] (-869.298) (-868.842) (-876.143) * (-868.223) [-868.251] (-873.560) (-878.723) -- 0:00:59
      63500 -- [-874.971] (-870.034) (-868.570) (-875.041) * [-870.014] (-869.549) (-870.885) (-886.965) -- 0:00:58
      64000 -- (-868.986) (-870.354) [-869.680] (-876.176) * (-869.272) (-869.323) (-877.900) [-888.317] -- 0:00:58
      64500 -- (-869.061) (-870.004) (-869.332) [-870.592] * (-868.119) [-869.335] (-871.881) (-881.397) -- 0:00:58
      65000 -- (-869.557) (-868.207) (-868.886) [-870.095] * (-868.554) [-870.554] (-870.238) (-883.228) -- 0:00:57

      Average standard deviation of split frequencies: 0.017686

      65500 -- (-872.883) (-868.787) [-869.618] (-868.599) * [-869.431] (-871.198) (-869.435) (-881.435) -- 0:00:57
      66000 -- (-874.721) (-871.074) [-869.075] (-871.777) * (-871.277) (-872.026) (-869.365) [-877.421] -- 0:00:56
      66500 -- [-870.452] (-868.524) (-870.890) (-878.322) * (-868.016) (-870.904) [-868.767] (-883.562) -- 0:00:56
      67000 -- (-869.350) (-868.800) [-868.133] (-873.321) * (-868.313) [-868.900] (-868.620) (-881.514) -- 0:00:55
      67500 -- [-869.923] (-870.290) (-870.631) (-874.269) * (-869.466) (-870.226) [-869.964] (-874.079) -- 0:00:55
      68000 -- (-871.968) [-871.968] (-869.729) (-868.482) * (-873.578) [-869.430] (-870.639) (-881.119) -- 0:00:54
      68500 -- (-870.145) (-868.426) [-872.095] (-868.245) * (-875.834) [-870.371] (-871.573) (-878.815) -- 0:00:54
      69000 -- (-870.939) [-869.663] (-871.925) (-868.473) * (-878.307) (-871.143) [-867.809] (-875.239) -- 0:00:53
      69500 -- (-872.707) (-870.188) [-872.363] (-869.033) * (-876.515) (-873.159) (-868.332) [-881.292] -- 0:00:53
      70000 -- (-869.415) [-870.133] (-877.198) (-872.339) * (-868.933) (-870.489) (-868.477) [-882.652] -- 0:00:53

      Average standard deviation of split frequencies: 0.022014

      70500 -- [-870.071] (-868.876) (-873.184) (-869.036) * [-869.925] (-872.305) (-870.347) (-884.166) -- 0:00:52
      71000 -- [-869.531] (-870.375) (-869.581) (-871.439) * (-870.331) (-872.380) [-869.428] (-901.180) -- 0:00:52
      71500 -- (-868.342) (-869.341) (-869.324) [-868.870] * (-870.166) (-875.108) [-869.103] (-879.063) -- 0:00:51
      72000 -- (-868.950) (-869.435) (-873.467) [-868.055] * (-873.119) (-872.649) [-869.567] (-870.984) -- 0:00:51
      72500 -- [-869.683] (-869.902) (-874.442) (-870.313) * [-875.215] (-873.941) (-869.864) (-872.912) -- 0:00:51
      73000 -- (-873.365) (-870.374) (-870.256) [-869.046] * (-873.949) (-873.428) (-869.480) [-869.834] -- 0:00:50
      73500 -- (-869.182) (-870.972) (-868.320) [-870.005] * (-872.614) [-873.866] (-868.787) (-870.424) -- 0:00:50
      74000 -- [-870.995] (-869.749) (-867.985) (-868.498) * (-872.986) (-874.833) [-870.946] (-869.419) -- 0:00:50
      74500 -- (-870.136) (-868.707) (-869.567) [-870.886] * [-871.295] (-876.880) (-871.147) (-869.661) -- 0:00:49
      75000 -- (-869.456) (-871.273) [-871.631] (-869.117) * (-870.167) [-873.629] (-873.030) (-873.632) -- 0:00:49

      Average standard deviation of split frequencies: 0.020893

      75500 -- (-869.537) [-875.820] (-872.281) (-869.820) * (-871.081) (-870.731) (-869.332) [-869.672] -- 0:00:48
      76000 -- (-870.135) (-875.726) [-870.322] (-869.474) * [-871.141] (-869.121) (-869.831) (-869.684) -- 0:00:48
      76500 -- [-870.278] (-869.307) (-869.517) (-876.659) * [-869.663] (-868.858) (-870.115) (-871.116) -- 0:00:48
      77000 -- (-868.350) [-868.459] (-869.354) (-870.653) * [-868.937] (-870.047) (-872.118) (-871.434) -- 0:00:47
      77500 -- [-871.172] (-868.249) (-872.379) (-868.938) * (-868.634) (-874.110) [-870.108] (-869.999) -- 0:00:47
      78000 -- (-868.250) (-868.041) (-868.153) [-868.454] * [-870.260] (-870.732) (-869.470) (-870.967) -- 0:00:47
      78500 -- (-871.558) [-868.614] (-869.119) (-869.584) * (-870.745) (-871.125) [-870.028] (-872.535) -- 0:00:46
      79000 -- [-869.337] (-868.067) (-868.333) (-869.667) * [-870.049] (-876.713) (-869.101) (-869.755) -- 0:00:58
      79500 -- (-869.686) (-868.096) [-868.194] (-873.200) * (-869.859) [-869.896] (-868.265) (-872.649) -- 0:00:57
      80000 -- (-871.158) (-868.521) [-868.128] (-869.187) * (-869.399) [-870.834] (-869.013) (-873.999) -- 0:00:57

      Average standard deviation of split frequencies: 0.017856

      80500 -- (-871.582) (-870.054) (-868.888) [-872.839] * [-869.162] (-872.004) (-869.781) (-870.024) -- 0:00:57
      81000 -- [-869.217] (-869.003) (-868.842) (-868.936) * [-869.368] (-871.519) (-869.333) (-870.191) -- 0:00:56
      81500 -- (-868.338) (-870.925) (-868.282) [-868.357] * (-870.576) (-868.585) [-870.456] (-873.092) -- 0:00:56
      82000 -- (-870.893) (-873.888) [-868.871] (-869.048) * [-870.628] (-868.309) (-870.067) (-873.222) -- 0:00:55
      82500 -- (-869.090) (-869.406) [-869.409] (-873.724) * [-870.081] (-867.980) (-870.023) (-871.678) -- 0:00:55
      83000 -- (-871.984) (-870.900) (-869.747) [-870.332] * [-868.881] (-869.495) (-868.591) (-870.025) -- 0:00:55
      83500 -- (-870.736) (-872.589) [-868.948] (-869.246) * (-873.459) (-867.931) [-870.262] (-870.407) -- 0:00:54
      84000 -- (-869.673) (-869.809) (-868.936) [-868.738] * (-874.952) (-870.757) (-869.818) [-871.673] -- 0:00:54
      84500 -- (-871.248) (-871.388) [-869.578] (-871.709) * [-876.537] (-869.016) (-869.035) (-869.315) -- 0:00:54
      85000 -- (-869.033) [-870.286] (-870.664) (-868.915) * (-877.949) (-869.538) [-867.956] (-869.544) -- 0:00:53

      Average standard deviation of split frequencies: 0.015896

      85500 -- (-870.147) [-870.661] (-870.705) (-872.936) * (-871.860) [-868.734] (-871.116) (-868.271) -- 0:00:53
      86000 -- (-870.930) (-869.191) (-870.938) [-868.551] * (-870.618) [-870.652] (-870.159) (-868.290) -- 0:00:53
      86500 -- (-871.060) [-869.775] (-868.000) (-874.045) * (-871.902) (-873.886) [-873.794] (-872.506) -- 0:00:52
      87000 -- [-869.809] (-869.264) (-867.951) (-873.764) * (-871.401) (-868.884) [-868.557] (-871.486) -- 0:00:52
      87500 -- (-869.225) (-870.653) (-873.528) [-869.729] * (-871.511) (-868.820) [-870.235] (-871.123) -- 0:00:52
      88000 -- [-868.867] (-869.499) (-869.490) (-869.246) * (-871.737) [-870.384] (-871.311) (-870.153) -- 0:00:51
      88500 -- (-870.907) (-870.804) [-868.116] (-869.452) * [-868.756] (-871.099) (-871.670) (-868.795) -- 0:00:51
      89000 -- (-868.654) (-869.621) [-869.533] (-868.189) * (-875.434) [-869.352] (-868.721) (-870.125) -- 0:00:51
      89500 -- (-869.311) (-870.127) [-871.589] (-868.521) * (-869.039) [-871.493] (-867.931) (-868.474) -- 0:00:50
      90000 -- (-872.351) (-870.139) (-868.402) [-868.280] * [-869.519] (-869.709) (-869.825) (-869.890) -- 0:00:50

      Average standard deviation of split frequencies: 0.015051

      90500 -- (-873.715) (-871.229) (-869.488) [-869.532] * (-868.105) (-869.841) [-868.133] (-870.777) -- 0:00:50
      91000 -- (-874.566) (-872.257) [-870.053] (-869.206) * (-868.850) (-869.496) [-868.235] (-870.162) -- 0:00:49
      91500 -- (-870.435) (-870.662) [-868.187] (-868.210) * (-871.133) (-872.558) [-868.342] (-874.949) -- 0:00:49
      92000 -- (-868.201) (-869.828) (-870.641) [-871.155] * (-871.045) (-870.327) [-868.280] (-869.810) -- 0:00:49
      92500 -- (-871.221) (-872.834) [-870.024] (-870.014) * (-870.686) (-868.655) [-868.498] (-874.445) -- 0:00:49
      93000 -- (-869.258) [-869.600] (-869.678) (-869.269) * (-869.871) (-869.563) [-871.936] (-871.754) -- 0:00:48
      93500 -- (-868.695) (-871.725) (-868.148) [-869.359] * (-871.835) (-876.159) (-869.485) [-872.518] -- 0:00:48
      94000 -- [-867.868] (-869.073) (-869.346) (-868.725) * (-870.427) [-870.575] (-869.141) (-870.892) -- 0:00:48
      94500 -- (-867.797) (-869.766) [-868.351] (-869.920) * (-869.872) [-869.742] (-870.716) (-871.656) -- 0:00:47
      95000 -- [-868.446] (-873.327) (-868.133) (-874.266) * (-870.018) (-872.727) (-870.432) [-872.198] -- 0:00:47

      Average standard deviation of split frequencies: 0.015959

      95500 -- [-868.449] (-873.367) (-869.044) (-873.544) * (-870.116) [-872.624] (-869.676) (-872.724) -- 0:00:47
      96000 -- (-869.007) (-871.817) (-868.740) [-867.933] * (-870.338) [-869.782] (-868.877) (-871.291) -- 0:00:56
      96500 -- (-869.235) (-868.704) [-868.408] (-869.577) * [-868.608] (-870.132) (-868.602) (-870.361) -- 0:00:56
      97000 -- (-871.170) [-868.631] (-872.249) (-875.766) * (-869.040) (-868.969) [-867.871] (-871.614) -- 0:00:55
      97500 -- (-869.350) (-868.724) (-871.242) [-873.085] * (-869.732) [-869.331] (-868.727) (-870.469) -- 0:00:55
      98000 -- [-872.372] (-868.529) (-873.410) (-875.667) * (-871.881) [-868.453] (-871.173) (-869.668) -- 0:00:55
      98500 -- (-870.387) (-869.316) [-871.846] (-876.010) * (-869.199) (-870.311) (-871.656) [-873.477] -- 0:00:54
      99000 -- (-868.942) [-869.229] (-870.689) (-877.431) * (-869.273) [-870.018] (-869.234) (-868.808) -- 0:00:54
      99500 -- [-871.570] (-870.681) (-870.123) (-875.119) * (-870.102) (-872.739) [-868.646] (-869.804) -- 0:00:54
      100000 -- [-872.794] (-868.911) (-870.064) (-875.143) * (-869.978) (-869.995) [-867.917] (-870.328) -- 0:00:54

      Average standard deviation of split frequencies: 0.016910

      100500 -- (-871.265) (-870.290) (-869.220) [-872.268] * (-871.760) (-871.363) (-869.013) [-868.970] -- 0:00:53
      101000 -- (-876.486) [-869.390] (-870.586) (-870.680) * (-869.420) [-870.425] (-869.829) (-869.313) -- 0:00:53
      101500 -- (-873.882) [-869.235] (-870.009) (-874.914) * (-867.782) (-870.419) [-868.512] (-871.251) -- 0:00:53
      102000 -- (-876.512) [-873.116] (-872.115) (-869.508) * [-868.149] (-868.946) (-868.672) (-875.081) -- 0:00:52
      102500 -- (-876.030) [-870.453] (-868.144) (-871.659) * (-870.584) (-870.811) (-870.394) [-870.999] -- 0:00:52
      103000 -- (-877.517) [-868.766] (-871.546) (-869.640) * (-877.483) (-871.610) [-868.608] (-868.145) -- 0:00:52
      103500 -- (-875.029) (-870.364) [-871.194] (-870.790) * (-873.074) (-871.963) [-868.767] (-870.723) -- 0:00:51
      104000 -- (-873.475) [-868.411] (-870.290) (-869.407) * (-872.168) (-871.926) [-870.067] (-871.774) -- 0:00:51
      104500 -- (-868.986) [-870.100] (-874.328) (-870.636) * (-869.445) [-868.698] (-871.777) (-870.895) -- 0:00:51
      105000 -- (-871.307) [-870.877] (-869.340) (-869.191) * [-871.416] (-868.681) (-869.022) (-868.224) -- 0:00:51

      Average standard deviation of split frequencies: 0.016059

      105500 -- (-870.034) (-871.479) (-869.090) [-871.387] * (-870.546) (-871.676) [-869.023] (-868.966) -- 0:00:50
      106000 -- (-869.870) (-872.469) (-869.529) [-870.031] * (-868.694) (-872.631) (-873.123) [-869.111] -- 0:00:50
      106500 -- (-868.479) (-876.434) (-869.440) [-871.501] * (-869.793) (-871.693) (-869.549) [-868.523] -- 0:00:50
      107000 -- (-869.579) [-870.701] (-871.027) (-869.181) * (-869.420) (-874.716) [-868.834] (-869.657) -- 0:00:50
      107500 -- [-869.601] (-872.913) (-867.943) (-871.414) * (-868.749) (-874.254) (-869.837) [-869.328] -- 0:00:49
      108000 -- (-871.886) (-870.610) [-867.984] (-871.436) * (-869.408) [-871.352] (-868.779) (-868.038) -- 0:00:49
      108500 -- [-871.594] (-868.036) (-870.301) (-873.145) * (-868.959) (-874.492) [-868.757] (-870.694) -- 0:00:49
      109000 -- (-869.212) [-869.535] (-869.689) (-871.514) * [-868.802] (-872.390) (-868.781) (-873.452) -- 0:00:49
      109500 -- (-869.571) (-868.511) (-870.007) [-870.049] * (-870.623) [-869.394] (-869.652) (-871.945) -- 0:00:48
      110000 -- (-872.591) (-869.433) (-871.601) [-871.195] * [-871.647] (-869.538) (-869.917) (-869.107) -- 0:00:48

      Average standard deviation of split frequencies: 0.019642

      110500 -- (-871.400) [-869.582] (-874.197) (-868.943) * (-868.879) (-871.224) (-874.909) [-869.600] -- 0:00:48
      111000 -- (-870.163) (-875.683) [-870.664] (-869.380) * (-868.389) [-871.493] (-870.175) (-869.816) -- 0:00:48
      111500 -- (-869.114) (-868.093) [-870.901] (-870.415) * (-869.518) (-871.659) [-870.565] (-869.824) -- 0:00:47
      112000 -- [-868.700] (-867.918) (-868.913) (-870.239) * [-870.335] (-868.572) (-871.542) (-869.133) -- 0:00:55
      112500 -- (-871.306) [-868.681] (-869.959) (-869.741) * (-870.113) (-868.803) (-871.245) [-869.541] -- 0:00:55
      113000 -- [-869.803] (-868.712) (-868.347) (-868.125) * (-868.376) [-868.082] (-870.605) (-873.565) -- 0:00:54
      113500 -- (-870.180) [-868.447] (-869.237) (-867.998) * [-869.998] (-869.201) (-873.829) (-870.452) -- 0:00:54
      114000 -- (-870.865) (-870.024) (-869.929) [-868.735] * [-873.893] (-870.052) (-872.551) (-869.988) -- 0:00:54
      114500 -- (-871.745) [-871.324] (-869.933) (-868.243) * [-868.536] (-872.021) (-868.815) (-869.353) -- 0:00:54
      115000 -- (-869.127) (-868.599) [-871.493] (-868.695) * (-869.213) [-869.506] (-872.130) (-869.225) -- 0:00:53

      Average standard deviation of split frequencies: 0.016030

      115500 -- (-874.096) (-868.224) [-869.495] (-869.655) * (-871.919) [-871.295] (-869.994) (-870.178) -- 0:00:53
      116000 -- (-871.107) [-869.602] (-869.489) (-877.799) * (-874.665) (-871.110) (-868.799) [-868.850] -- 0:00:53
      116500 -- (-867.800) [-869.737] (-868.927) (-872.238) * [-872.300] (-870.754) (-869.030) (-868.567) -- 0:00:53
      117000 -- (-867.838) [-869.543] (-869.360) (-872.366) * [-871.511] (-869.611) (-871.057) (-868.588) -- 0:00:52
      117500 -- (-868.290) (-868.280) [-870.154] (-869.551) * (-870.009) (-871.311) [-872.615] (-869.277) -- 0:00:52
      118000 -- [-870.074] (-870.329) (-869.949) (-869.608) * (-874.450) [-870.812] (-873.609) (-869.360) -- 0:00:52
      118500 -- [-869.351] (-871.889) (-871.018) (-870.223) * (-870.968) [-871.295] (-873.869) (-868.119) -- 0:00:52
      119000 -- (-869.986) (-871.272) [-870.197] (-874.772) * (-872.679) (-869.006) (-871.456) [-869.407] -- 0:00:51
      119500 -- (-869.561) (-873.438) (-872.192) [-871.599] * (-869.131) (-868.747) (-870.229) [-867.884] -- 0:00:51
      120000 -- [-872.009] (-869.166) (-875.687) (-871.297) * (-869.214) [-868.777] (-868.730) (-870.802) -- 0:00:51

      Average standard deviation of split frequencies: 0.017066

      120500 -- [-869.285] (-869.304) (-870.560) (-870.812) * [-869.948] (-868.945) (-869.452) (-872.085) -- 0:00:51
      121000 -- (-868.993) (-869.000) (-870.120) [-872.540] * [-869.164] (-871.015) (-869.756) (-869.401) -- 0:00:50
      121500 -- (-868.459) (-868.690) (-872.525) [-870.657] * [-868.788] (-870.616) (-870.850) (-869.944) -- 0:00:50
      122000 -- (-870.732) [-868.312] (-870.679) (-871.297) * [-870.461] (-872.154) (-871.703) (-871.671) -- 0:00:50
      122500 -- [-871.051] (-868.893) (-873.519) (-869.273) * [-868.988] (-869.341) (-870.654) (-870.644) -- 0:00:50
      123000 -- (-869.552) (-868.272) (-868.199) [-869.457] * (-869.219) (-869.144) (-872.818) [-870.800] -- 0:00:49
      123500 -- (-868.534) [-868.549] (-868.788) (-869.971) * [-869.614] (-869.622) (-867.939) (-869.366) -- 0:00:49
      124000 -- (-871.096) (-869.832) [-870.074] (-869.351) * [-870.874] (-868.343) (-870.141) (-869.352) -- 0:00:49
      124500 -- (-874.118) (-870.491) (-870.697) [-869.351] * (-872.097) (-870.856) (-872.888) [-868.206] -- 0:00:49
      125000 -- (-868.825) [-870.677] (-869.630) (-868.634) * (-870.009) (-869.751) [-872.629] (-868.186) -- 0:00:49

      Average standard deviation of split frequencies: 0.014965

      125500 -- (-870.348) [-869.897] (-869.958) (-871.694) * [-869.364] (-868.417) (-870.849) (-870.147) -- 0:00:48
      126000 -- (-871.277) (-871.869) (-869.424) [-869.850] * (-870.733) (-868.417) [-869.956] (-870.919) -- 0:00:48
      126500 -- (-873.855) (-874.425) (-870.522) [-868.857] * (-870.799) (-868.480) [-871.274] (-870.736) -- 0:00:48
      127000 -- (-872.710) (-880.629) (-871.085) [-869.718] * (-870.054) (-868.898) (-870.502) [-869.475] -- 0:00:48
      127500 -- [-870.081] (-879.033) (-870.943) (-869.621) * (-870.097) [-870.681] (-869.459) (-870.858) -- 0:00:47
      128000 -- [-868.449] (-879.489) (-869.673) (-870.412) * (-870.761) (-870.527) [-868.952] (-870.436) -- 0:00:47
      128500 -- [-868.762] (-872.161) (-872.104) (-871.489) * (-871.862) [-870.165] (-868.885) (-868.577) -- 0:00:47
      129000 -- (-868.813) [-869.918] (-868.764) (-872.386) * (-870.943) [-869.111] (-869.618) (-870.693) -- 0:00:54
      129500 -- (-869.702) [-872.067] (-869.082) (-870.982) * (-871.871) (-871.585) [-868.568] (-870.169) -- 0:00:53
      130000 -- [-872.712] (-870.379) (-869.034) (-873.553) * (-871.824) (-869.113) (-868.568) [-869.341] -- 0:00:53

      Average standard deviation of split frequencies: 0.011424

      130500 -- (-869.571) (-871.364) [-869.750] (-870.836) * (-873.734) (-871.346) [-870.399] (-869.803) -- 0:00:53
      131000 -- (-869.496) (-869.776) [-871.402] (-870.125) * (-868.933) [-873.540] (-868.359) (-872.733) -- 0:00:53
      131500 -- [-869.260] (-871.108) (-869.664) (-869.466) * (-868.837) (-869.848) (-868.381) [-870.518] -- 0:00:52
      132000 -- (-868.028) (-870.478) (-869.112) [-868.723] * (-872.857) [-869.698] (-869.724) (-869.772) -- 0:00:52
      132500 -- [-872.405] (-872.109) (-869.397) (-869.326) * (-872.012) (-870.752) (-868.310) [-870.170] -- 0:00:52
      133000 -- (-868.575) [-869.802] (-869.584) (-869.599) * (-870.673) (-870.969) [-869.401] (-871.230) -- 0:00:52
      133500 -- [-869.416] (-869.502) (-868.416) (-871.235) * (-870.037) (-870.550) (-869.139) [-872.778] -- 0:00:51
      134000 -- [-868.268] (-868.360) (-870.150) (-870.447) * (-868.316) (-869.669) [-868.446] (-869.825) -- 0:00:51
      134500 -- [-870.941] (-868.316) (-871.020) (-869.267) * (-869.554) (-875.040) [-868.179] (-869.379) -- 0:00:51
      135000 -- (-870.243) [-871.050] (-870.811) (-868.281) * (-868.449) [-868.500] (-870.146) (-868.876) -- 0:00:51

      Average standard deviation of split frequencies: 0.011554

      135500 -- [-871.293] (-870.603) (-872.750) (-867.898) * (-868.590) (-868.866) [-868.321] (-870.174) -- 0:00:51
      136000 -- (-873.735) (-869.305) (-868.851) [-868.159] * (-868.977) (-876.397) [-870.022] (-872.802) -- 0:00:50
      136500 -- (-871.834) [-868.285] (-868.167) (-868.644) * (-873.490) (-871.349) [-871.851] (-871.152) -- 0:00:50
      137000 -- [-869.900] (-868.648) (-868.221) (-869.179) * (-871.048) [-869.497] (-878.785) (-868.503) -- 0:00:50
      137500 -- (-870.210) (-870.099) [-870.106] (-869.582) * (-875.655) (-868.736) (-869.613) [-869.232] -- 0:00:50
      138000 -- (-871.962) (-869.260) (-869.672) [-872.150] * [-870.488] (-868.401) (-873.692) (-868.210) -- 0:00:49
      138500 -- (-870.509) (-869.168) (-871.695) [-875.492] * (-870.004) (-870.536) [-873.619] (-877.366) -- 0:00:49
      139000 -- (-870.890) (-871.814) (-868.366) [-871.472] * (-870.105) (-869.154) [-871.431] (-876.861) -- 0:00:49
      139500 -- (-871.178) [-869.683] (-871.502) (-871.599) * (-869.742) (-869.186) (-871.023) [-871.172] -- 0:00:49
      140000 -- (-869.692) [-871.609] (-870.862) (-874.292) * (-870.503) (-870.844) [-868.335] (-871.108) -- 0:00:49

      Average standard deviation of split frequencies: 0.009172

      140500 -- (-871.400) (-869.380) (-871.233) [-869.238] * (-869.093) (-869.197) [-868.664] (-870.016) -- 0:00:48
      141000 -- (-872.594) (-868.774) (-868.659) [-868.977] * [-870.299] (-876.836) (-869.787) (-869.428) -- 0:00:48
      141500 -- [-870.005] (-869.009) (-869.259) (-872.098) * (-870.604) [-868.832] (-869.110) (-868.599) -- 0:00:48
      142000 -- (-868.379) (-871.319) (-881.346) [-870.979] * (-870.704) (-868.505) [-869.617] (-871.099) -- 0:00:48
      142500 -- [-868.393] (-870.457) (-873.999) (-869.694) * [-870.103] (-872.722) (-868.305) (-870.818) -- 0:00:48
      143000 -- [-868.072] (-871.790) (-873.587) (-869.753) * (-871.155) [-873.112] (-869.109) (-869.387) -- 0:00:47
      143500 -- (-868.697) (-872.314) (-870.765) [-869.465] * (-870.349) (-869.248) [-869.481] (-868.483) -- 0:00:47
      144000 -- [-868.068] (-871.894) (-870.208) (-868.994) * [-869.493] (-874.056) (-869.190) (-869.874) -- 0:00:47
      144500 -- (-868.056) (-870.437) (-870.682) [-872.716] * (-870.495) (-872.071) (-870.050) [-871.046] -- 0:00:47
      145000 -- (-869.486) (-869.224) [-868.813] (-875.080) * (-872.627) (-870.681) (-868.751) [-870.578] -- 0:00:47

      Average standard deviation of split frequencies: 0.008497

      145500 -- (-869.460) [-868.153] (-868.982) (-870.845) * (-873.217) (-868.991) (-869.731) [-869.053] -- 0:00:52
      146000 -- (-869.428) (-868.455) (-869.933) [-869.592] * (-873.884) (-868.379) (-876.468) [-869.116] -- 0:00:52
      146500 -- (-870.916) [-869.529] (-870.289) (-868.615) * (-873.741) [-869.168] (-874.497) (-872.877) -- 0:00:52
      147000 -- (-868.534) [-868.449] (-870.781) (-868.522) * (-869.290) (-868.984) [-874.684] (-869.257) -- 0:00:52
      147500 -- (-870.523) (-868.965) (-870.511) [-871.338] * [-871.248] (-868.166) (-873.309) (-874.167) -- 0:00:52
      148000 -- (-874.387) (-870.291) [-869.881] (-868.753) * (-870.641) [-868.735] (-869.991) (-874.691) -- 0:00:51
      148500 -- (-870.547) (-870.161) [-868.249] (-868.872) * [-867.932] (-869.033) (-868.295) (-868.396) -- 0:00:51
      149000 -- (-869.748) [-868.826] (-870.922) (-873.419) * (-868.363) (-869.543) (-868.310) [-870.074] -- 0:00:51
      149500 -- (-872.221) [-870.054] (-874.437) (-868.971) * (-868.866) [-870.167] (-867.881) (-870.074) -- 0:00:51
      150000 -- [-869.241] (-869.513) (-872.805) (-871.154) * (-871.426) (-870.559) (-874.545) [-868.034] -- 0:00:51

      Average standard deviation of split frequencies: 0.010539

      150500 -- [-871.113] (-870.539) (-873.214) (-873.601) * (-878.756) (-871.350) (-872.340) [-870.206] -- 0:00:50
      151000 -- (-868.722) [-870.559] (-870.377) (-871.055) * (-869.171) (-870.281) (-872.759) [-870.153] -- 0:00:50
      151500 -- [-872.761] (-871.576) (-871.214) (-869.714) * (-869.095) (-868.334) (-870.853) [-870.047] -- 0:00:50
      152000 -- (-872.175) (-872.621) [-869.631] (-867.988) * (-870.480) (-868.387) (-870.719) [-873.295] -- 0:00:50
      152500 -- (-869.886) (-870.257) (-871.262) [-867.967] * (-868.952) [-870.135] (-869.688) (-870.633) -- 0:00:50
      153000 -- (-869.987) [-869.290] (-869.025) (-869.070) * [-870.445] (-869.206) (-869.519) (-869.969) -- 0:00:49
      153500 -- (-870.118) [-869.372] (-872.710) (-869.628) * (-868.377) (-869.507) (-867.959) [-870.045] -- 0:00:49
      154000 -- (-869.785) (-874.580) (-875.703) [-867.901] * (-868.372) (-869.378) (-869.507) [-869.436] -- 0:00:49
      154500 -- (-871.869) (-869.949) (-870.506) [-868.594] * (-870.418) (-871.505) [-871.764] (-871.613) -- 0:00:49
      155000 -- (-871.014) (-870.947) [-868.901] (-869.743) * (-868.759) (-868.838) (-869.611) [-872.093] -- 0:00:49

      Average standard deviation of split frequencies: 0.012423

      155500 -- [-870.884] (-868.397) (-870.110) (-874.887) * (-874.192) [-869.210] (-869.039) (-873.144) -- 0:00:48
      156000 -- [-868.747] (-870.741) (-869.180) (-874.862) * (-873.180) [-869.655] (-871.191) (-870.741) -- 0:00:48
      156500 -- [-872.280] (-871.230) (-869.851) (-872.994) * (-872.746) (-869.154) (-869.599) [-872.642] -- 0:00:48
      157000 -- (-870.562) [-869.618] (-868.307) (-869.282) * (-874.326) [-871.479] (-871.559) (-868.106) -- 0:00:48
      157500 -- (-870.585) (-868.216) [-868.666] (-871.132) * (-871.060) (-868.544) (-871.761) [-871.116] -- 0:00:48
      158000 -- (-872.128) (-872.362) (-868.095) [-870.415] * [-872.236] (-869.498) (-871.944) (-872.019) -- 0:00:47
      158500 -- (-870.330) [-870.264] (-868.005) (-870.132) * (-869.431) [-874.001] (-871.617) (-871.236) -- 0:00:47
      159000 -- [-869.977] (-869.872) (-868.579) (-869.239) * (-870.966) (-869.933) (-869.521) [-869.965] -- 0:00:47
      159500 -- (-872.546) [-868.811] (-869.320) (-869.362) * (-869.771) [-868.226] (-870.791) (-873.535) -- 0:00:47
      160000 -- (-868.808) (-868.766) (-869.159) [-870.922] * (-870.780) [-871.194] (-872.532) (-870.018) -- 0:00:47

      Average standard deviation of split frequencies: 0.013203

      160500 -- [-870.444] (-872.096) (-869.887) (-869.392) * (-871.308) [-871.008] (-871.958) (-869.443) -- 0:00:47
      161000 -- (-869.429) [-868.677] (-868.634) (-868.812) * (-869.909) (-874.113) (-868.546) [-871.791] -- 0:00:46
      161500 -- [-873.157] (-868.278) (-869.266) (-869.258) * [-869.770] (-870.616) (-869.820) (-868.853) -- 0:00:46
      162000 -- (-871.252) (-870.511) [-869.837] (-868.093) * (-869.236) [-869.026] (-870.420) (-870.050) -- 0:00:46
      162500 -- (-869.555) [-868.624] (-869.102) (-868.279) * (-868.931) [-870.169] (-871.736) (-869.534) -- 0:00:51
      163000 -- (-868.271) [-868.444] (-871.808) (-868.646) * (-870.984) [-871.186] (-873.083) (-868.964) -- 0:00:51
      163500 -- [-875.745] (-868.803) (-873.718) (-870.420) * (-870.088) (-869.046) (-872.680) [-873.715] -- 0:00:51
      164000 -- [-872.840] (-870.457) (-872.395) (-871.146) * (-869.302) (-871.703) [-869.431] (-871.255) -- 0:00:50
      164500 -- [-871.203] (-869.070) (-869.783) (-868.911) * (-868.508) [-872.243] (-870.372) (-870.784) -- 0:00:50
      165000 -- (-869.427) (-875.739) [-869.884] (-870.156) * (-870.824) (-869.257) (-868.786) [-871.850] -- 0:00:50

      Average standard deviation of split frequencies: 0.013063

      165500 -- [-872.275] (-870.810) (-868.900) (-870.688) * (-869.641) [-871.037] (-869.663) (-871.884) -- 0:00:50
      166000 -- (-870.888) (-871.872) (-869.992) [-870.577] * (-869.813) (-871.779) [-869.067] (-871.285) -- 0:00:50
      166500 -- (-870.074) (-870.669) [-868.957] (-868.745) * [-875.385] (-872.991) (-868.885) (-872.297) -- 0:00:50
      167000 -- (-872.025) (-869.767) [-873.077] (-869.906) * (-872.400) [-871.646] (-870.895) (-871.836) -- 0:00:49
      167500 -- (-874.657) [-870.133] (-869.877) (-871.617) * (-872.638) (-869.536) [-873.961] (-871.319) -- 0:00:49
      168000 -- (-873.718) (-869.098) (-868.657) [-869.525] * (-878.027) [-873.325] (-869.791) (-871.151) -- 0:00:49
      168500 -- (-871.519) (-870.248) [-869.023] (-870.487) * [-873.285] (-872.056) (-869.117) (-868.668) -- 0:00:49
      169000 -- (-872.490) (-872.453) (-871.238) [-868.561] * (-871.490) [-872.596] (-871.153) (-868.147) -- 0:00:49
      169500 -- (-870.240) (-870.801) [-870.547] (-868.492) * (-871.260) (-872.268) [-871.351] (-869.725) -- 0:00:48
      170000 -- [-869.463] (-872.920) (-870.444) (-868.394) * (-873.086) [-869.219] (-871.640) (-869.119) -- 0:00:48

      Average standard deviation of split frequencies: 0.013396

      170500 -- [-871.465] (-868.950) (-871.668) (-870.740) * (-867.878) [-870.395] (-871.500) (-868.356) -- 0:00:48
      171000 -- (-872.158) (-870.362) (-871.392) [-874.308] * (-870.357) (-871.542) (-871.638) [-868.091] -- 0:00:48
      171500 -- [-873.667] (-872.436) (-870.933) (-870.095) * [-869.199] (-869.033) (-871.356) (-868.657) -- 0:00:48
      172000 -- (-869.329) (-868.883) (-868.653) [-869.105] * (-872.658) [-869.338] (-872.072) (-868.839) -- 0:00:48
      172500 -- (-869.641) [-868.449] (-872.296) (-870.034) * (-870.139) (-871.241) [-870.533] (-870.342) -- 0:00:47
      173000 -- (-870.956) (-868.284) [-870.784] (-871.173) * (-869.136) (-869.560) [-870.612] (-868.787) -- 0:00:47
      173500 -- (-871.021) [-872.290] (-870.442) (-868.949) * (-870.177) (-870.193) (-869.061) [-869.622] -- 0:00:47
      174000 -- (-870.584) (-869.053) [-868.774] (-868.861) * (-868.598) [-869.387] (-870.485) (-868.436) -- 0:00:47
      174500 -- (-871.578) (-873.300) (-871.369) [-869.676] * [-868.526] (-870.745) (-870.139) (-868.704) -- 0:00:47
      175000 -- [-868.718] (-870.266) (-870.322) (-872.511) * (-870.743) (-869.198) [-870.014] (-869.384) -- 0:00:47

      Average standard deviation of split frequencies: 0.014583

      175500 -- (-869.828) [-870.156] (-871.546) (-868.795) * (-870.343) [-871.522] (-874.108) (-870.053) -- 0:00:46
      176000 -- (-870.119) [-871.430] (-873.576) (-869.757) * [-869.200] (-872.158) (-871.103) (-871.382) -- 0:00:46
      176500 -- (-871.614) (-870.423) [-869.591] (-869.281) * (-873.069) (-870.602) (-870.514) [-869.070] -- 0:00:46
      177000 -- (-871.081) [-873.745] (-870.024) (-871.319) * (-872.490) (-868.849) (-871.486) [-868.849] -- 0:00:46
      177500 -- (-871.392) (-874.039) (-871.005) [-868.419] * [-873.325] (-869.576) (-872.886) (-869.583) -- 0:00:46
      178000 -- (-870.627) [-869.897] (-869.087) (-871.545) * [-868.884] (-869.836) (-873.203) (-870.017) -- 0:00:46
      178500 -- [-871.860] (-868.504) (-872.205) (-874.580) * (-869.300) (-870.934) [-872.550] (-870.056) -- 0:00:46
      179000 -- (-871.564) (-868.250) [-869.570] (-871.143) * (-873.852) (-868.769) [-869.526] (-869.777) -- 0:00:50
      179500 -- [-871.693] (-868.888) (-868.531) (-871.605) * (-871.118) (-877.226) [-871.749] (-870.421) -- 0:00:50
      180000 -- (-871.507) (-869.004) [-868.573] (-868.446) * (-870.239) [-871.393] (-869.144) (-870.441) -- 0:00:50

      Average standard deviation of split frequencies: 0.013191

      180500 -- (-870.126) [-874.918] (-870.223) (-867.916) * (-870.438) (-869.856) [-869.144] (-873.952) -- 0:00:49
      181000 -- (-868.500) (-871.176) [-868.565] (-868.511) * [-870.480] (-873.286) (-868.457) (-869.840) -- 0:00:49
      181500 -- (-870.694) [-870.900] (-868.386) (-875.457) * (-873.890) (-870.347) [-868.252] (-868.469) -- 0:00:49
      182000 -- (-872.910) (-873.385) [-870.490] (-870.292) * (-872.279) (-871.803) [-870.072] (-872.718) -- 0:00:49
      182500 -- (-871.720) [-869.333] (-870.533) (-868.437) * (-871.343) (-870.684) (-871.480) [-868.814] -- 0:00:49
      183000 -- (-871.653) (-871.339) (-873.491) [-868.624] * [-874.105] (-869.786) (-869.659) (-868.650) -- 0:00:49
      183500 -- (-872.175) [-870.219] (-868.653) (-870.042) * (-872.936) (-868.252) (-868.150) [-868.545] -- 0:00:48
      184000 -- (-869.997) (-869.432) (-870.511) [-868.861] * [-870.963] (-870.485) (-872.178) (-868.010) -- 0:00:48
      184500 -- (-868.623) [-868.711] (-882.026) (-869.307) * (-870.892) [-869.901] (-869.362) (-870.085) -- 0:00:48
      185000 -- (-872.660) [-868.903] (-868.710) (-869.200) * (-871.857) (-869.104) (-868.547) [-868.513] -- 0:00:48

      Average standard deviation of split frequencies: 0.013072

      185500 -- (-875.749) [-868.938] (-870.052) (-871.103) * (-869.022) (-871.247) (-870.831) [-868.187] -- 0:00:48
      186000 -- (-869.664) [-868.941] (-870.090) (-869.041) * (-873.954) (-870.676) [-868.619] (-868.265) -- 0:00:48
      186500 -- [-870.276] (-868.793) (-869.318) (-874.311) * (-874.071) (-870.217) [-870.682] (-873.897) -- 0:00:47
      187000 -- (-869.001) [-869.184] (-876.711) (-868.280) * (-874.161) [-868.950] (-871.532) (-871.745) -- 0:00:47
      187500 -- (-868.645) (-873.188) [-868.476] (-868.635) * (-873.448) [-867.941] (-875.409) (-873.367) -- 0:00:47
      188000 -- (-872.536) (-875.658) [-871.016] (-869.151) * [-868.398] (-867.870) (-869.279) (-871.693) -- 0:00:47
      188500 -- (-870.354) [-870.308] (-868.433) (-870.729) * (-869.336) [-869.742] (-871.133) (-869.939) -- 0:00:47
      189000 -- [-867.974] (-870.542) (-873.665) (-872.747) * (-868.417) [-871.611] (-868.376) (-868.900) -- 0:00:47
      189500 -- (-869.138) (-870.808) (-870.596) [-871.433] * (-872.327) (-873.833) (-869.880) [-870.994] -- 0:00:47
      190000 -- [-872.885] (-869.651) (-869.516) (-869.418) * [-873.283] (-871.699) (-868.846) (-868.291) -- 0:00:46

      Average standard deviation of split frequencies: 0.014054

      190500 -- (-869.438) (-868.045) (-871.464) [-868.565] * (-873.997) [-868.800] (-867.898) (-871.200) -- 0:00:46
      191000 -- [-870.348] (-868.324) (-869.654) (-869.420) * (-871.585) (-870.029) (-874.934) [-870.219] -- 0:00:46
      191500 -- [-868.402] (-870.699) (-869.429) (-868.092) * (-871.400) (-868.701) (-870.755) [-870.669] -- 0:00:46
      192000 -- (-870.233) [-868.950] (-869.043) (-869.654) * (-869.519) (-873.708) (-873.116) [-870.933] -- 0:00:46
      192500 -- (-873.439) [-869.615] (-870.498) (-868.334) * [-869.024] (-872.583) (-869.814) (-869.546) -- 0:00:46
      193000 -- (-869.139) [-868.602] (-870.063) (-871.270) * [-869.684] (-870.868) (-868.647) (-870.245) -- 0:00:45
      193500 -- (-868.155) [-869.148] (-870.535) (-870.298) * (-868.748) (-870.205) (-868.369) [-870.208] -- 0:00:45
      194000 -- (-868.847) (-868.309) (-871.661) [-871.743] * (-869.252) [-868.722] (-871.215) (-869.445) -- 0:00:45
      194500 -- (-870.730) (-871.999) (-871.281) [-869.872] * (-870.102) (-869.177) [-868.181] (-869.917) -- 0:00:45
      195000 -- [-868.221] (-871.813) (-869.843) (-870.012) * (-871.468) [-869.394] (-874.273) (-869.721) -- 0:00:45

      Average standard deviation of split frequencies: 0.013418

      195500 -- (-868.729) (-871.881) (-869.064) [-868.747] * [-869.035] (-868.553) (-875.249) (-870.104) -- 0:00:49
      196000 -- (-869.177) (-869.061) (-870.187) [-870.316] * [-870.097] (-869.684) (-867.944) (-869.245) -- 0:00:49
      196500 -- [-867.850] (-871.651) (-871.954) (-869.478) * (-869.340) (-871.127) (-868.411) [-870.009] -- 0:00:49
      197000 -- [-870.432] (-874.229) (-868.831) (-869.725) * (-868.651) (-870.289) (-868.494) [-869.620] -- 0:00:48
      197500 -- [-868.717] (-873.352) (-868.664) (-872.274) * [-870.063] (-871.500) (-870.304) (-870.307) -- 0:00:48
      198000 -- (-869.114) (-870.708) (-868.662) [-869.344] * (-869.878) (-869.218) [-870.752] (-870.773) -- 0:00:48
      198500 -- (-869.050) (-869.851) [-870.921] (-869.152) * (-870.246) (-871.212) (-868.776) [-870.608] -- 0:00:48
      199000 -- [-869.011] (-868.731) (-871.109) (-869.399) * (-869.446) [-871.737] (-869.592) (-873.437) -- 0:00:48
      199500 -- (-869.156) (-868.914) [-868.749] (-872.402) * (-871.979) [-870.725] (-875.003) (-872.309) -- 0:00:48
      200000 -- (-868.617) [-869.134] (-868.534) (-870.665) * (-868.107) [-868.620] (-869.648) (-873.316) -- 0:00:48

      Average standard deviation of split frequencies: 0.013601

      200500 -- (-868.834) (-868.744) [-872.034] (-872.603) * (-868.274) (-869.124) (-869.757) [-870.545] -- 0:00:47
      201000 -- (-870.286) (-868.717) [-871.838] (-869.192) * (-871.855) [-869.916] (-868.974) (-868.830) -- 0:00:47
      201500 -- (-869.411) (-868.297) (-868.825) [-871.230] * (-874.490) (-871.057) [-868.160] (-869.945) -- 0:00:47
      202000 -- [-868.559] (-868.752) (-870.130) (-872.715) * [-868.932] (-869.165) (-868.310) (-870.235) -- 0:00:47
      202500 -- (-871.433) (-868.871) (-868.690) [-868.847] * [-868.403] (-874.268) (-870.398) (-873.064) -- 0:00:47
      203000 -- (-869.009) (-870.035) (-869.021) [-871.129] * (-869.270) (-872.521) [-870.480] (-871.791) -- 0:00:47
      203500 -- (-869.805) [-868.825] (-868.479) (-872.472) * [-869.944] (-873.568) (-873.725) (-869.130) -- 0:00:46
      204000 -- [-870.405] (-869.660) (-872.188) (-869.004) * (-871.051) (-873.028) [-870.924] (-869.521) -- 0:00:46
      204500 -- (-871.258) (-869.002) (-869.354) [-869.561] * (-869.649) (-869.531) (-870.635) [-868.164] -- 0:00:46
      205000 -- (-870.401) (-871.991) (-868.567) [-869.344] * (-868.703) (-868.776) [-869.724] (-869.355) -- 0:00:46

      Average standard deviation of split frequencies: 0.014646

      205500 -- (-871.343) (-870.660) [-868.284] (-873.570) * (-871.746) (-869.514) [-869.986] (-869.347) -- 0:00:46
      206000 -- (-869.750) (-874.255) [-869.631] (-874.397) * (-873.320) (-869.208) (-869.391) [-868.860] -- 0:00:46
      206500 -- (-868.783) (-870.232) (-872.444) [-872.314] * (-869.827) [-868.145] (-872.477) (-869.051) -- 0:00:46
      207000 -- (-870.718) [-869.164] (-876.295) (-870.280) * (-869.050) (-868.417) [-869.140] (-869.203) -- 0:00:45
      207500 -- (-870.986) (-869.179) (-870.197) [-870.044] * (-868.068) [-870.280] (-869.398) (-868.984) -- 0:00:45
      208000 -- [-869.442] (-869.649) (-868.764) (-872.734) * (-876.332) (-870.909) [-869.139] (-870.686) -- 0:00:45
      208500 -- (-869.080) (-871.783) [-868.745] (-869.279) * (-872.799) (-867.916) (-869.515) [-869.572] -- 0:00:45
      209000 -- (-870.993) [-873.681] (-871.421) (-868.264) * (-868.729) (-868.706) [-868.533] (-868.701) -- 0:00:45
      209500 -- (-868.731) (-870.129) [-870.259] (-871.854) * (-870.272) (-876.271) (-869.414) [-870.388] -- 0:00:45
      210000 -- (-869.165) (-872.769) (-868.138) [-870.018] * (-869.573) (-876.805) [-871.087] (-868.017) -- 0:00:45

      Average standard deviation of split frequencies: 0.013302

      210500 -- [-869.323] (-870.219) (-868.449) (-868.551) * (-870.874) (-869.745) (-870.203) [-871.026] -- 0:00:45
      211000 -- (-869.089) (-870.444) (-868.988) [-868.746] * (-873.767) [-870.652] (-872.202) (-870.496) -- 0:00:44
      211500 -- (-869.889) [-868.173] (-869.939) (-870.744) * (-868.902) [-873.262] (-868.749) (-870.905) -- 0:00:44
      212000 -- (-870.657) [-869.437] (-873.930) (-869.594) * (-868.398) (-872.195) (-868.888) [-872.873] -- 0:00:44
      212500 -- [-873.735] (-869.403) (-869.135) (-868.567) * [-869.215] (-870.820) (-868.508) (-870.496) -- 0:00:48
      213000 -- (-871.331) (-869.877) [-868.566] (-869.458) * [-872.677] (-869.751) (-870.682) (-869.449) -- 0:00:48
      213500 -- (-870.618) [-869.928] (-870.115) (-868.707) * (-869.571) (-870.967) (-870.496) [-869.579] -- 0:00:47
      214000 -- (-873.039) (-869.088) (-868.389) [-868.554] * (-869.675) (-873.465) [-872.801] (-869.246) -- 0:00:47
      214500 -- [-869.929] (-874.387) (-870.438) (-868.415) * (-868.846) (-874.645) [-871.439] (-871.070) -- 0:00:47
      215000 -- (-870.225) [-870.376] (-869.036) (-868.885) * (-868.575) [-872.756] (-877.556) (-875.288) -- 0:00:47

      Average standard deviation of split frequencies: 0.013458

      215500 -- (-869.885) (-873.986) (-869.036) [-869.106] * (-868.723) (-870.891) (-870.134) [-874.657] -- 0:00:47
      216000 -- (-868.931) [-871.028] (-869.217) (-868.947) * (-869.716) [-870.882] (-869.973) (-870.812) -- 0:00:47
      216500 -- [-869.041] (-869.892) (-868.792) (-871.194) * (-871.921) (-872.329) (-869.092) [-870.087] -- 0:00:47
      217000 -- (-868.792) (-871.395) [-868.418] (-868.621) * (-872.099) (-870.517) (-868.909) [-869.550] -- 0:00:46
      217500 -- (-869.559) (-870.055) [-870.354] (-870.590) * (-873.964) (-870.069) [-869.836] (-872.115) -- 0:00:46
      218000 -- [-868.758] (-869.412) (-872.885) (-868.153) * [-869.865] (-868.923) (-871.234) (-871.249) -- 0:00:46
      218500 -- (-870.225) [-869.319] (-871.312) (-870.710) * [-867.869] (-872.992) (-868.423) (-871.460) -- 0:00:46
      219000 -- [-868.800] (-868.183) (-870.051) (-871.699) * (-869.765) (-871.446) [-869.024] (-874.915) -- 0:00:46
      219500 -- (-868.711) [-867.951] (-873.526) (-868.947) * (-873.677) (-871.330) [-869.500] (-871.573) -- 0:00:46
      220000 -- [-869.374] (-870.254) (-870.140) (-870.827) * (-876.127) [-871.674] (-868.664) (-870.701) -- 0:00:46

      Average standard deviation of split frequencies: 0.015834

      220500 -- (-871.707) [-869.765] (-868.842) (-873.323) * (-871.122) [-869.286] (-868.520) (-870.429) -- 0:00:45
      221000 -- (-869.501) (-869.620) [-868.937] (-869.636) * (-870.673) (-870.380) [-868.350] (-871.006) -- 0:00:45
      221500 -- [-868.256] (-868.568) (-870.533) (-872.621) * (-873.597) (-869.062) (-868.765) [-869.750] -- 0:00:45
      222000 -- (-871.161) (-870.472) [-868.328] (-869.154) * (-870.158) (-868.986) (-869.364) [-872.343] -- 0:00:45
      222500 -- (-873.060) (-872.025) (-869.071) [-868.548] * (-870.087) (-867.646) [-869.407] (-871.349) -- 0:00:45
      223000 -- (-873.072) [-870.183] (-869.718) (-870.061) * [-872.415] (-870.171) (-872.613) (-871.218) -- 0:00:45
      223500 -- (-869.212) (-868.334) [-868.144] (-868.931) * (-868.748) (-871.711) [-868.231] (-869.531) -- 0:00:45
      224000 -- (-871.991) [-869.417] (-868.065) (-870.459) * (-870.839) (-869.726) [-870.215] (-872.428) -- 0:00:45
      224500 -- (-870.931) (-870.075) (-871.920) [-870.044] * (-869.918) [-870.284] (-869.165) (-870.235) -- 0:00:44
      225000 -- (-872.831) [-869.363] (-868.488) (-871.633) * [-869.772] (-869.268) (-868.640) (-869.514) -- 0:00:44

      Average standard deviation of split frequencies: 0.014914

      225500 -- [-871.820] (-870.569) (-869.549) (-869.913) * [-870.443] (-875.934) (-869.401) (-869.538) -- 0:00:44
      226000 -- [-868.887] (-868.794) (-873.082) (-871.782) * (-869.116) [-869.918] (-870.647) (-869.701) -- 0:00:44
      226500 -- (-868.220) (-869.991) (-873.446) [-871.373] * (-869.410) (-869.795) (-869.109) [-872.637] -- 0:00:44
      227000 -- [-869.764] (-874.088) (-869.311) (-871.535) * (-869.296) [-869.709] (-868.977) (-869.815) -- 0:00:44
      227500 -- [-868.458] (-868.107) (-874.484) (-872.624) * [-869.279] (-869.987) (-872.240) (-868.027) -- 0:00:44
      228000 -- [-870.338] (-872.403) (-868.315) (-869.116) * (-868.302) (-875.926) [-870.427] (-869.467) -- 0:00:44
      228500 -- (-870.048) (-877.732) [-868.988] (-868.780) * (-870.554) (-868.232) [-869.443] (-870.154) -- 0:00:43
      229000 -- (-870.538) (-870.349) [-870.627] (-871.233) * (-870.680) [-868.232] (-869.904) (-870.023) -- 0:00:47
      229500 -- (-873.158) (-869.555) (-869.974) [-871.675] * (-871.213) [-870.245] (-870.640) (-869.212) -- 0:00:47
      230000 -- (-873.686) (-870.040) (-871.622) [-870.043] * (-872.086) [-871.511] (-872.171) (-869.712) -- 0:00:46

      Average standard deviation of split frequencies: 0.015919

      230500 -- (-870.500) (-870.302) [-873.597] (-871.322) * (-869.038) [-869.176] (-871.911) (-870.680) -- 0:00:46
      231000 -- (-870.698) (-873.087) (-869.556) [-867.787] * (-868.427) (-869.759) (-869.915) [-872.683] -- 0:00:46
      231500 -- (-869.267) (-869.410) (-870.187) [-867.758] * (-868.431) (-869.854) (-869.945) [-870.162] -- 0:00:46
      232000 -- [-874.446] (-871.515) (-873.687) (-873.672) * [-868.433] (-870.592) (-870.140) (-870.791) -- 0:00:46
      232500 -- (-872.139) (-873.493) [-869.714] (-871.141) * (-869.458) (-869.894) [-868.912] (-868.823) -- 0:00:46
      233000 -- (-871.288) (-873.155) (-871.271) [-868.397] * (-868.758) (-868.630) (-869.107) [-868.144] -- 0:00:46
      233500 -- (-872.716) (-872.034) (-870.788) [-868.279] * (-868.750) (-873.207) [-869.315] (-868.363) -- 0:00:45
      234000 -- (-872.107) [-868.499] (-876.369) (-868.279) * (-870.327) (-878.894) [-870.294] (-868.303) -- 0:00:45
      234500 -- [-868.990] (-868.370) (-873.629) (-869.991) * (-871.383) [-870.835] (-868.725) (-868.458) -- 0:00:45
      235000 -- (-868.644) (-868.788) (-874.615) [-869.577] * [-870.219] (-872.909) (-870.570) (-869.622) -- 0:00:45

      Average standard deviation of split frequencies: 0.016085

      235500 -- (-873.131) [-868.576] (-870.526) (-871.575) * (-867.720) (-869.731) [-868.854] (-874.260) -- 0:00:45
      236000 -- [-869.557] (-868.393) (-872.224) (-872.468) * (-867.948) (-869.938) (-869.458) [-869.960] -- 0:00:45
      236500 -- [-868.379] (-868.767) (-870.246) (-869.032) * (-868.813) [-871.872] (-868.100) (-869.595) -- 0:00:45
      237000 -- [-868.597] (-869.998) (-868.264) (-870.607) * [-870.719] (-870.704) (-868.564) (-869.495) -- 0:00:45
      237500 -- (-868.382) (-869.277) [-869.284] (-869.060) * (-870.416) (-871.197) (-868.571) [-870.062] -- 0:00:44
      238000 -- (-868.143) [-869.140] (-869.317) (-867.965) * (-870.814) (-869.717) [-870.798] (-870.202) -- 0:00:44
      238500 -- [-868.420] (-870.026) (-870.951) (-868.106) * [-872.861] (-870.025) (-870.390) (-870.083) -- 0:00:44
      239000 -- (-869.232) [-868.936] (-872.458) (-869.425) * (-868.959) (-870.256) [-870.465] (-869.216) -- 0:00:44
      239500 -- (-868.445) (-869.677) (-871.889) [-870.480] * (-868.135) (-871.479) [-868.434] (-871.734) -- 0:00:44
      240000 -- [-868.504] (-875.895) (-870.836) (-869.349) * (-870.115) (-873.279) (-871.956) [-871.083] -- 0:00:44

      Average standard deviation of split frequencies: 0.016361

      240500 -- [-869.936] (-871.319) (-871.877) (-870.113) * (-869.410) (-868.677) [-869.851] (-868.466) -- 0:00:44
      241000 -- (-871.569) (-868.918) (-870.810) [-872.908] * (-868.486) [-868.600] (-869.528) (-870.602) -- 0:00:44
      241500 -- (-877.754) (-868.845) (-868.499) [-871.048] * (-869.234) (-868.571) [-869.853] (-868.765) -- 0:00:43
      242000 -- (-869.050) [-869.240] (-870.666) (-871.414) * (-869.271) [-871.395] (-871.369) (-870.119) -- 0:00:43
      242500 -- (-870.404) (-871.713) (-874.382) [-870.875] * (-870.820) [-874.188] (-868.701) (-869.849) -- 0:00:43
      243000 -- (-869.534) (-870.789) (-869.190) [-870.956] * [-871.438] (-870.517) (-868.931) (-869.521) -- 0:00:43
      243500 -- (-871.338) (-871.585) [-867.783] (-868.384) * (-872.468) [-870.746] (-872.357) (-869.262) -- 0:00:43
      244000 -- (-869.974) (-870.691) [-868.630] (-869.356) * (-869.401) [-870.668] (-870.430) (-869.437) -- 0:00:43
      244500 -- (-870.040) (-870.396) (-867.633) [-870.696] * (-869.040) (-870.784) [-870.067] (-872.031) -- 0:00:43
      245000 -- [-869.341] (-874.801) (-870.417) (-869.709) * (-871.755) (-871.167) (-869.845) [-868.769] -- 0:00:46

      Average standard deviation of split frequencies: 0.015756

      245500 -- (-870.174) [-874.094] (-868.406) (-872.618) * (-871.790) [-868.340] (-871.231) (-868.456) -- 0:00:46
      246000 -- (-873.556) (-869.989) (-870.815) [-869.801] * (-871.309) [-869.319] (-875.537) (-868.198) -- 0:00:45
      246500 -- (-871.646) [-870.467] (-869.742) (-871.042) * (-869.615) [-870.033] (-872.315) (-869.534) -- 0:00:45
      247000 -- (-871.113) [-868.629] (-871.678) (-869.936) * [-869.393] (-870.641) (-870.893) (-873.077) -- 0:00:45
      247500 -- (-870.212) [-868.132] (-876.264) (-870.776) * (-868.515) [-870.829] (-869.702) (-869.584) -- 0:00:45
      248000 -- (-868.920) [-869.012] (-873.964) (-873.364) * (-870.217) [-869.628] (-868.716) (-869.228) -- 0:00:45
      248500 -- (-872.004) (-869.128) (-872.033) [-871.674] * (-870.445) (-871.362) (-872.786) [-868.394] -- 0:00:45
      249000 -- (-876.268) (-870.216) [-869.998] (-869.188) * (-872.266) (-869.032) (-871.914) [-867.765] -- 0:00:45
      249500 -- [-868.731] (-872.241) (-871.890) (-869.042) * [-868.578] (-868.225) (-870.084) (-867.804) -- 0:00:45
      250000 -- [-868.558] (-873.347) (-869.872) (-870.687) * (-871.864) [-869.799] (-871.200) (-869.978) -- 0:00:45

      Average standard deviation of split frequencies: 0.016925

      250500 -- [-870.684] (-870.085) (-872.114) (-870.677) * (-874.618) (-868.907) [-872.075] (-869.781) -- 0:00:44
      251000 -- (-871.092) (-871.132) (-870.250) [-869.435] * (-871.807) [-869.770] (-872.866) (-870.769) -- 0:00:44
      251500 -- (-868.826) (-870.452) [-868.278] (-870.624) * (-875.037) (-869.475) [-867.804] (-872.801) -- 0:00:44
      252000 -- (-868.817) [-871.200] (-868.019) (-870.434) * (-873.620) (-871.280) (-873.508) [-869.737] -- 0:00:44
      252500 -- (-869.189) (-874.947) [-868.935] (-869.202) * (-872.678) (-868.934) (-868.787) [-868.569] -- 0:00:44
      253000 -- (-870.439) (-871.071) (-869.642) [-871.312] * (-872.187) [-876.408] (-868.617) (-870.330) -- 0:00:44
      253500 -- (-872.099) (-871.803) (-870.124) [-871.472] * (-869.506) (-870.222) [-868.544] (-869.670) -- 0:00:44
      254000 -- (-871.081) (-872.247) [-870.058] (-875.126) * [-868.058] (-868.336) (-868.075) (-869.918) -- 0:00:44
      254500 -- [-870.833] (-873.724) (-868.215) (-871.839) * [-867.827] (-870.155) (-871.075) (-872.861) -- 0:00:43
      255000 -- (-870.194) [-869.548] (-869.434) (-870.048) * (-871.582) (-870.350) [-871.467] (-868.503) -- 0:00:43

      Average standard deviation of split frequencies: 0.016789

      255500 -- (-868.776) (-872.357) [-871.453] (-871.375) * (-871.049) (-870.203) [-870.632] (-869.472) -- 0:00:43
      256000 -- (-869.312) [-873.551] (-872.040) (-871.726) * (-871.008) (-870.511) [-869.756] (-869.626) -- 0:00:43
      256500 -- (-870.089) (-873.599) (-872.450) [-869.743] * (-869.492) [-875.867] (-869.801) (-873.786) -- 0:00:43
      257000 -- (-869.179) (-870.534) [-869.676] (-869.882) * (-872.318) [-870.441] (-870.280) (-871.143) -- 0:00:43
      257500 -- (-869.696) (-870.326) [-868.238] (-868.988) * (-873.122) (-870.657) (-871.191) [-870.142] -- 0:00:43
      258000 -- (-869.117) [-870.446] (-869.798) (-874.034) * (-870.251) (-869.888) (-871.454) [-869.379] -- 0:00:43
      258500 -- (-870.173) [-876.512] (-869.558) (-877.085) * (-869.125) (-871.288) (-880.440) [-870.750] -- 0:00:43
      259000 -- (-872.894) (-871.815) [-870.025] (-875.959) * [-869.330] (-868.968) (-870.586) (-869.753) -- 0:00:42
      259500 -- (-870.571) (-869.384) [-869.065] (-872.222) * (-870.661) (-868.793) (-870.914) [-868.639] -- 0:00:42
      260000 -- (-868.893) (-873.734) (-870.153) [-869.761] * (-873.488) (-868.201) (-871.834) [-870.033] -- 0:00:42

      Average standard deviation of split frequencies: 0.015851

      260500 -- (-874.843) [-873.380] (-869.437) (-875.469) * (-870.960) (-868.886) [-871.798] (-868.923) -- 0:00:45
      261000 -- (-869.504) (-869.845) [-872.561] (-869.304) * [-870.027] (-870.135) (-870.769) (-869.527) -- 0:00:45
      261500 -- (-869.169) [-869.653] (-872.600) (-871.798) * (-870.334) [-869.759] (-869.328) (-871.104) -- 0:00:45
      262000 -- (-869.086) [-869.530] (-868.146) (-868.897) * (-872.868) (-870.453) [-869.777] (-870.365) -- 0:00:45
      262500 -- (-869.109) (-868.521) [-872.765] (-870.097) * (-874.305) (-869.318) (-869.713) [-869.333] -- 0:00:44
      263000 -- (-870.177) [-868.148] (-869.199) (-872.899) * (-872.226) (-872.097) (-868.454) [-868.559] -- 0:00:44
      263500 -- (-871.105) (-870.167) [-868.586] (-869.004) * (-868.809) (-869.561) [-867.962] (-874.383) -- 0:00:44
      264000 -- (-869.746) [-873.822] (-871.801) (-869.360) * (-868.332) (-871.037) [-869.009] (-870.795) -- 0:00:44
      264500 -- (-871.204) (-871.128) (-869.946) [-870.862] * (-870.235) (-871.307) (-869.754) [-871.595] -- 0:00:44
      265000 -- (-871.435) [-871.756] (-869.011) (-871.737) * (-869.384) (-871.985) (-871.451) [-871.248] -- 0:00:44

      Average standard deviation of split frequencies: 0.016789

      265500 -- [-870.348] (-874.240) (-870.379) (-874.172) * (-869.063) (-873.160) (-869.634) [-868.060] -- 0:00:44
      266000 -- (-871.769) (-875.184) (-869.387) [-870.793] * (-872.854) [-874.929] (-869.120) (-869.820) -- 0:00:44
      266500 -- (-873.172) (-871.381) [-868.380] (-870.158) * (-869.918) [-870.489] (-868.690) (-868.564) -- 0:00:44
      267000 -- (-871.369) (-870.772) [-870.082] (-870.484) * [-868.522] (-869.769) (-870.772) (-870.089) -- 0:00:43
      267500 -- (-870.481) [-868.448] (-871.688) (-869.404) * (-872.791) [-873.435] (-872.176) (-870.765) -- 0:00:43
      268000 -- (-868.236) (-870.635) (-869.379) [-868.245] * (-868.343) (-870.036) [-870.890] (-870.459) -- 0:00:43
      268500 -- (-868.476) [-869.624] (-874.502) (-870.089) * [-870.813] (-869.092) (-869.501) (-869.891) -- 0:00:43
      269000 -- (-869.002) (-869.713) (-869.066) [-869.749] * (-869.332) [-868.182] (-869.931) (-874.441) -- 0:00:43
      269500 -- (-874.100) (-869.731) [-868.800] (-869.161) * (-869.092) (-867.900) (-869.676) [-871.678] -- 0:00:43
      270000 -- [-870.366] (-873.548) (-872.042) (-869.959) * (-870.717) (-868.748) [-868.363] (-869.703) -- 0:00:43

      Average standard deviation of split frequencies: 0.017141

      270500 -- (-869.688) (-870.900) [-868.907] (-869.317) * (-874.145) (-869.529) [-868.304] (-870.752) -- 0:00:43
      271000 -- (-870.265) [-868.182] (-870.200) (-873.986) * (-868.685) (-870.659) (-868.478) [-870.110] -- 0:00:43
      271500 -- [-872.173] (-870.898) (-870.845) (-872.074) * (-870.644) (-871.391) (-870.371) [-868.408] -- 0:00:42
      272000 -- [-873.317] (-870.889) (-868.275) (-873.431) * (-868.157) (-873.348) (-869.883) [-870.852] -- 0:00:42
      272500 -- [-869.247] (-868.928) (-869.239) (-869.381) * (-869.063) (-873.550) [-869.934] (-869.283) -- 0:00:42
      273000 -- [-868.713] (-870.860) (-869.217) (-869.537) * (-869.088) (-870.308) [-868.733] (-870.957) -- 0:00:42
      273500 -- (-868.198) [-870.581] (-874.024) (-870.316) * (-869.238) (-872.636) [-869.174] (-873.814) -- 0:00:42
      274000 -- (-870.023) (-869.748) (-872.497) [-870.235] * [-870.552] (-876.114) (-869.187) (-871.504) -- 0:00:42
      274500 -- (-871.554) (-868.709) (-869.720) [-870.801] * [-870.095] (-871.059) (-869.977) (-873.143) -- 0:00:42
      275000 -- [-872.831] (-868.200) (-870.693) (-870.651) * [-869.602] (-871.064) (-868.439) (-872.500) -- 0:00:42

      Average standard deviation of split frequencies: 0.016890

      275500 -- [-868.669] (-867.719) (-872.762) (-869.059) * (-874.974) (-873.117) (-869.513) [-870.190] -- 0:00:42
      276000 -- (-870.912) (-868.164) (-873.843) [-868.004] * (-876.006) (-870.774) (-869.688) [-869.371] -- 0:00:41
      276500 -- (-870.390) [-868.188] (-869.407) (-868.029) * (-873.682) (-871.230) [-869.258] (-868.630) -- 0:00:41
      277000 -- (-870.795) (-868.297) (-870.197) [-870.817] * (-872.203) [-871.712] (-869.541) (-868.443) -- 0:00:41
      277500 -- (-867.933) [-868.135] (-872.996) (-871.666) * [-871.794] (-871.977) (-868.378) (-872.102) -- 0:00:44
      278000 -- [-867.964] (-869.828) (-874.513) (-870.379) * (-871.704) [-871.534] (-868.877) (-873.047) -- 0:00:44
      278500 -- [-867.941] (-870.225) (-868.632) (-873.337) * (-869.127) (-870.642) [-869.258] (-870.968) -- 0:00:44
      279000 -- (-870.924) [-871.233] (-871.055) (-869.931) * [-870.282] (-869.421) (-869.799) (-869.390) -- 0:00:43
      279500 -- (-869.899) (-869.056) [-869.909] (-868.758) * [-869.780] (-869.180) (-868.855) (-875.383) -- 0:00:43
      280000 -- (-869.917) (-872.538) [-868.971] (-870.356) * (-869.529) (-870.987) (-868.419) [-870.752] -- 0:00:43

      Average standard deviation of split frequencies: 0.017169

      280500 -- (-868.736) (-871.702) (-869.507) [-872.197] * (-871.758) [-868.406] (-872.090) (-869.246) -- 0:00:43
      281000 -- (-868.130) (-872.486) [-869.987] (-871.812) * [-870.022] (-872.698) (-868.368) (-871.800) -- 0:00:43
      281500 -- (-870.525) [-868.628] (-872.613) (-869.796) * (-869.215) (-874.295) [-870.533] (-868.420) -- 0:00:43
      282000 -- (-868.513) [-869.697] (-874.048) (-870.090) * (-872.025) (-870.896) (-869.962) [-869.878] -- 0:00:43
      282500 -- (-868.566) [-868.836] (-873.602) (-870.752) * (-872.877) (-868.040) [-867.957] (-874.969) -- 0:00:43
      283000 -- (-871.647) [-871.224] (-874.026) (-869.387) * (-870.032) (-870.757) (-870.728) [-871.646] -- 0:00:43
      283500 -- (-869.530) (-873.038) [-872.460] (-870.222) * (-870.335) (-867.875) [-870.522] (-869.097) -- 0:00:42
      284000 -- (-870.036) (-875.762) (-869.291) [-869.793] * (-868.235) (-867.968) [-870.308] (-869.120) -- 0:00:42
      284500 -- [-870.146] (-873.228) (-871.727) (-874.134) * (-869.955) (-868.870) [-869.169] (-872.636) -- 0:00:42
      285000 -- [-868.658] (-871.946) (-871.974) (-871.095) * [-868.496] (-871.449) (-873.226) (-869.938) -- 0:00:42

      Average standard deviation of split frequencies: 0.015615

      285500 -- (-870.108) (-874.883) [-870.887] (-870.170) * (-869.380) (-872.525) (-868.935) [-870.425] -- 0:00:42
      286000 -- (-870.072) (-873.084) (-870.454) [-870.360] * [-872.893] (-871.051) (-870.693) (-868.943) -- 0:00:42
      286500 -- (-873.629) (-867.910) (-868.622) [-868.885] * (-870.357) (-869.002) (-870.293) [-869.307] -- 0:00:42
      287000 -- (-868.960) [-868.642] (-871.385) (-870.137) * (-870.011) (-868.987) [-868.733] (-872.117) -- 0:00:42
      287500 -- (-868.732) (-869.165) (-868.303) [-874.160] * (-873.109) (-868.333) (-870.412) [-869.797] -- 0:00:42
      288000 -- (-868.164) [-868.941] (-870.071) (-869.907) * (-870.878) [-868.952] (-870.062) (-870.738) -- 0:00:42
      288500 -- [-872.186] (-869.325) (-870.335) (-869.740) * [-870.009] (-869.833) (-873.162) (-869.184) -- 0:00:41
      289000 -- [-871.387] (-868.660) (-868.359) (-869.204) * [-870.378] (-869.075) (-869.724) (-869.267) -- 0:00:41
      289500 -- (-874.860) (-869.048) [-870.835] (-870.557) * (-869.837) (-868.706) (-868.798) [-871.570] -- 0:00:41
      290000 -- (-873.613) (-868.624) [-870.308] (-871.052) * (-870.553) (-871.385) [-869.655] (-871.319) -- 0:00:41

      Average standard deviation of split frequencies: 0.015858

      290500 -- (-873.564) [-868.882] (-872.361) (-868.992) * (-871.130) [-869.005] (-869.409) (-869.180) -- 0:00:41
      291000 -- (-868.810) (-870.252) [-870.749] (-872.767) * [-873.312] (-870.527) (-868.432) (-870.047) -- 0:00:41
      291500 -- [-870.249] (-874.207) (-868.583) (-871.078) * (-873.351) (-869.700) (-869.022) [-871.246] -- 0:00:41
      292000 -- (-869.087) (-876.503) (-870.275) [-871.382] * (-870.534) [-873.216] (-868.641) (-869.562) -- 0:00:41
      292500 -- (-871.099) (-868.820) (-870.420) [-871.429] * (-870.562) [-871.141] (-869.831) (-869.951) -- 0:00:41
      293000 -- (-868.763) (-869.612) (-870.215) [-869.055] * [-869.780] (-872.028) (-868.266) (-874.920) -- 0:00:41
      293500 -- (-869.403) (-875.033) [-874.878] (-869.264) * (-870.055) [-870.109] (-868.545) (-870.594) -- 0:00:40
      294000 -- (-870.511) (-872.208) [-874.951] (-874.682) * (-871.340) [-869.828] (-873.348) (-870.057) -- 0:00:43
      294500 -- [-869.035] (-878.406) (-870.548) (-871.477) * (-869.794) (-872.098) (-871.577) [-871.792] -- 0:00:43
      295000 -- [-870.673] (-873.668) (-872.231) (-871.117) * (-870.667) (-869.806) [-873.948] (-870.929) -- 0:00:43

      Average standard deviation of split frequencies: 0.016113

      295500 -- (-869.958) (-872.112) [-873.443] (-873.581) * [-869.444] (-870.842) (-868.867) (-871.782) -- 0:00:42
      296000 -- (-873.613) (-869.203) [-869.052] (-869.240) * (-869.411) (-869.903) (-868.874) [-868.711] -- 0:00:42
      296500 -- (-871.227) [-868.921] (-871.317) (-868.620) * (-869.975) (-869.323) (-869.751) [-869.250] -- 0:00:42
      297000 -- (-869.245) (-870.382) (-870.294) [-868.823] * [-869.101] (-872.463) (-868.985) (-869.210) -- 0:00:42
      297500 -- (-869.552) (-868.933) [-870.077] (-870.305) * (-868.832) (-869.091) (-868.821) [-874.218] -- 0:00:42
      298000 -- [-868.346] (-868.770) (-870.821) (-872.013) * (-870.060) [-870.522] (-869.202) (-869.129) -- 0:00:42
      298500 -- (-868.015) [-868.112] (-869.962) (-870.963) * [-868.930] (-869.273) (-869.179) (-871.155) -- 0:00:42
      299000 -- (-868.415) (-868.883) [-869.812] (-869.663) * [-868.496] (-868.318) (-871.063) (-872.219) -- 0:00:42
      299500 -- (-867.838) [-872.170] (-868.688) (-868.524) * (-870.976) (-872.102) [-869.660] (-873.167) -- 0:00:42
      300000 -- (-869.965) (-873.998) [-869.212] (-870.055) * [-867.986] (-868.940) (-868.173) (-871.707) -- 0:00:42

      Average standard deviation of split frequencies: 0.015863

      300500 -- (-870.366) (-872.256) (-870.056) [-869.175] * (-870.291) [-870.487] (-870.946) (-872.341) -- 0:00:41
      301000 -- (-868.480) (-870.334) (-873.797) [-867.858] * (-874.623) (-872.336) [-868.118] (-868.962) -- 0:00:41
      301500 -- (-870.064) (-871.646) [-874.795] (-868.760) * (-875.688) [-872.450] (-871.106) (-868.694) -- 0:00:41
      302000 -- (-872.187) (-870.948) (-869.039) [-868.265] * [-870.785] (-871.156) (-869.531) (-869.359) -- 0:00:41
      302500 -- (-871.748) (-870.081) [-870.740] (-870.824) * (-870.371) (-870.607) [-870.660] (-869.044) -- 0:00:41
      303000 -- (-868.262) (-868.677) (-870.644) [-869.823] * [-869.279] (-870.637) (-870.808) (-869.350) -- 0:00:41
      303500 -- (-870.847) (-868.691) (-871.197) [-869.723] * [-869.386] (-869.526) (-871.642) (-869.732) -- 0:00:41
      304000 -- [-868.584] (-872.796) (-868.990) (-870.208) * (-869.912) [-869.382] (-869.639) (-873.150) -- 0:00:41
      304500 -- (-869.393) (-873.135) (-869.827) [-869.443] * (-870.100) (-872.100) [-868.715] (-868.684) -- 0:00:41
      305000 -- (-871.420) (-869.382) (-870.728) [-871.214] * (-869.595) (-871.338) (-869.237) [-869.283] -- 0:00:41

      Average standard deviation of split frequencies: 0.015649

      305500 -- (-872.443) [-868.402] (-869.046) (-869.824) * (-870.473) (-873.138) (-872.191) [-869.315] -- 0:00:40
      306000 -- (-868.808) [-867.929] (-870.261) (-876.956) * (-871.278) [-872.943] (-871.360) (-868.540) -- 0:00:40
      306500 -- [-870.920] (-869.209) (-869.358) (-875.264) * [-871.555] (-871.474) (-871.546) (-875.762) -- 0:00:40
      307000 -- (-869.248) (-870.190) (-869.162) [-870.687] * (-868.801) [-871.656] (-868.538) (-879.330) -- 0:00:40
      307500 -- [-870.089] (-874.522) (-870.525) (-870.202) * [-868.370] (-870.879) (-868.350) (-870.895) -- 0:00:40
      308000 -- [-870.727] (-872.415) (-869.803) (-868.927) * (-869.567) (-870.078) [-868.436] (-870.921) -- 0:00:40
      308500 -- (-867.980) [-872.126] (-868.119) (-869.947) * (-869.567) (-870.116) [-868.214] (-869.643) -- 0:00:40
      309000 -- [-868.007] (-874.648) (-868.163) (-875.416) * (-869.667) [-871.086] (-871.504) (-871.643) -- 0:00:40
      309500 -- (-868.938) (-872.871) [-868.339] (-872.970) * [-868.446] (-873.526) (-870.332) (-868.946) -- 0:00:40
      310000 -- (-867.902) (-870.681) [-871.413] (-872.411) * (-869.614) (-874.585) (-870.656) [-868.651] -- 0:00:40

      Average standard deviation of split frequencies: 0.015493

      310500 -- (-867.806) (-872.152) [-871.340] (-871.965) * (-869.878) [-873.602] (-871.272) (-870.443) -- 0:00:42
      311000 -- (-868.235) (-869.969) (-869.537) [-870.142] * (-868.537) [-869.415] (-873.703) (-870.001) -- 0:00:42
      311500 -- [-868.428] (-871.312) (-869.350) (-868.873) * [-870.301] (-868.579) (-871.667) (-870.189) -- 0:00:41
      312000 -- [-869.310] (-868.325) (-869.422) (-869.578) * (-869.370) [-869.761] (-873.644) (-870.031) -- 0:00:41
      312500 -- (-874.078) [-870.578] (-868.883) (-871.290) * (-873.634) [-872.525] (-868.920) (-868.313) -- 0:00:41
      313000 -- (-871.666) (-871.983) [-868.921] (-868.633) * (-869.892) (-871.968) [-870.851] (-868.363) -- 0:00:41
      313500 -- [-871.444] (-871.228) (-868.586) (-869.664) * (-871.334) (-868.648) (-870.459) [-867.753] -- 0:00:41
      314000 -- (-869.713) (-868.856) [-868.191] (-869.456) * (-868.450) (-870.079) (-870.171) [-869.366] -- 0:00:41
      314500 -- (-872.990) [-869.399] (-869.196) (-870.937) * (-869.041) [-869.125] (-868.970) (-869.779) -- 0:00:41
      315000 -- (-869.943) [-869.569] (-872.081) (-870.065) * (-868.368) (-872.543) [-871.359] (-868.867) -- 0:00:41

      Average standard deviation of split frequencies: 0.015249

      315500 -- (-871.055) (-871.689) [-869.658] (-870.938) * [-868.115] (-868.333) (-869.136) (-871.763) -- 0:00:41
      316000 -- (-871.403) [-869.355] (-870.980) (-870.708) * (-869.299) (-870.937) (-873.609) [-870.160] -- 0:00:41
      316500 -- (-869.952) (-869.905) [-869.495] (-870.927) * [-870.677] (-873.170) (-871.408) (-869.241) -- 0:00:41
      317000 -- (-869.021) [-870.629] (-869.909) (-868.143) * (-870.477) (-870.691) (-874.460) [-868.481] -- 0:00:40
      317500 -- (-871.962) (-869.311) (-869.852) [-870.388] * (-869.308) [-871.378] (-872.665) (-868.009) -- 0:00:40
      318000 -- (-869.172) (-869.164) [-867.987] (-869.818) * [-871.084] (-869.569) (-872.281) (-869.735) -- 0:00:40
      318500 -- (-869.288) [-870.618] (-868.653) (-871.654) * [-867.809] (-868.440) (-872.248) (-869.301) -- 0:00:40
      319000 -- [-868.328] (-868.305) (-869.985) (-869.375) * (-870.822) (-868.443) [-870.367] (-869.354) -- 0:00:40
      319500 -- (-868.273) (-869.550) (-871.057) [-870.359] * (-872.216) (-871.756) [-868.753] (-870.172) -- 0:00:40
      320000 -- (-869.353) [-870.490] (-869.321) (-869.804) * (-871.070) (-874.137) [-868.629] (-868.621) -- 0:00:40

      Average standard deviation of split frequencies: 0.016007

      320500 -- [-868.980] (-870.282) (-869.421) (-869.502) * (-869.542) (-869.337) (-868.176) [-868.727] -- 0:00:40
      321000 -- (-872.276) (-870.599) (-870.498) [-869.054] * (-868.932) (-869.698) (-870.507) [-868.591] -- 0:00:40
      321500 -- (-872.735) (-875.885) [-870.848] (-870.686) * (-870.952) (-869.735) (-871.278) [-869.773] -- 0:00:40
      322000 -- (-871.793) (-872.243) (-875.606) [-868.468] * (-871.435) (-867.862) (-873.154) [-871.845] -- 0:00:40
      322500 -- [-872.042] (-871.619) (-872.115) (-870.345) * (-869.778) (-867.862) (-869.834) [-871.852] -- 0:00:39
      323000 -- (-870.779) [-868.627] (-870.937) (-868.745) * (-869.201) [-868.350] (-873.136) (-872.212) -- 0:00:39
      323500 -- (-868.977) (-870.983) (-868.989) [-870.386] * (-869.128) [-870.693] (-869.717) (-867.657) -- 0:00:39
      324000 -- (-869.892) (-870.331) (-868.428) [-871.410] * (-871.906) (-870.219) (-869.411) [-869.366] -- 0:00:39
      324500 -- [-871.203] (-868.203) (-871.634) (-868.854) * [-869.696] (-869.982) (-871.589) (-871.010) -- 0:00:39
      325000 -- (-871.255) (-868.939) [-869.128] (-874.405) * (-874.453) (-869.251) (-875.128) [-869.837] -- 0:00:39

      Average standard deviation of split frequencies: 0.016287

      325500 -- (-870.855) [-868.939] (-869.511) (-871.602) * [-869.051] (-869.312) (-869.769) (-873.123) -- 0:00:39
      326000 -- (-874.183) (-871.283) [-868.491] (-872.604) * (-871.508) (-872.164) (-868.167) [-868.157] -- 0:00:39
      326500 -- (-872.138) [-873.286] (-869.214) (-868.693) * [-869.297] (-871.824) (-870.876) (-869.146) -- 0:00:39
      327000 -- [-869.690] (-875.551) (-868.928) (-869.975) * (-869.255) (-869.417) (-868.205) [-868.389] -- 0:00:39
      327500 -- [-868.614] (-872.519) (-870.071) (-869.739) * (-873.043) [-872.404] (-868.243) (-871.440) -- 0:00:41
      328000 -- (-871.059) (-871.976) [-870.510] (-871.365) * (-871.502) (-868.916) [-868.330] (-873.961) -- 0:00:40
      328500 -- (-868.441) [-869.665] (-873.420) (-870.135) * (-869.334) (-869.343) (-870.630) [-873.610] -- 0:00:40
      329000 -- (-868.073) (-873.325) [-868.457] (-869.657) * (-874.139) [-868.515] (-869.466) (-872.914) -- 0:00:40
      329500 -- [-868.048] (-872.846) (-868.372) (-870.761) * [-869.221] (-868.347) (-870.505) (-868.487) -- 0:00:40
      330000 -- (-871.665) (-868.926) (-870.358) [-874.862] * [-871.942] (-870.198) (-873.213) (-869.845) -- 0:00:40

      Average standard deviation of split frequencies: 0.015757

      330500 -- (-870.170) (-869.606) (-871.519) [-868.987] * (-872.302) (-869.409) (-874.335) [-868.785] -- 0:00:40
      331000 -- (-870.360) (-871.540) [-870.283] (-868.717) * (-869.531) (-868.431) (-872.547) [-869.714] -- 0:00:40
      331500 -- (-868.695) [-873.103] (-870.716) (-869.322) * (-868.061) [-868.642] (-869.929) (-870.812) -- 0:00:40
      332000 -- (-868.638) (-869.056) (-870.352) [-870.184] * (-868.073) [-868.763] (-870.338) (-874.035) -- 0:00:40
      332500 -- (-873.408) (-871.287) (-870.012) [-870.920] * (-868.690) [-869.339] (-871.531) (-870.302) -- 0:00:40
      333000 -- (-870.318) [-869.437] (-870.007) (-868.644) * [-869.689] (-872.905) (-869.852) (-869.324) -- 0:00:40
      333500 -- (-869.716) (-868.790) (-870.719) [-868.703] * [-869.231] (-870.508) (-873.204) (-870.783) -- 0:00:39
      334000 -- [-872.958] (-868.522) (-873.534) (-870.446) * (-872.133) (-871.692) [-875.427] (-871.089) -- 0:00:39
      334500 -- (-878.400) [-869.234] (-869.912) (-868.162) * [-869.693] (-870.312) (-872.396) (-873.601) -- 0:00:39
      335000 -- [-869.207] (-868.907) (-870.064) (-872.853) * (-868.345) [-870.851] (-870.089) (-871.473) -- 0:00:39

      Average standard deviation of split frequencies: 0.015268

      335500 -- (-871.827) (-871.749) [-867.691] (-875.088) * [-870.090] (-871.244) (-870.629) (-870.133) -- 0:00:39
      336000 -- (-872.034) (-871.490) (-871.154) [-870.550] * (-868.795) [-874.637] (-869.724) (-869.003) -- 0:00:39
      336500 -- [-869.366] (-869.760) (-869.447) (-869.364) * [-871.921] (-870.345) (-869.471) (-869.210) -- 0:00:39
      337000 -- [-869.630] (-871.022) (-874.866) (-872.808) * (-868.113) (-868.236) (-869.046) [-868.668] -- 0:00:39
      337500 -- (-868.171) [-872.575] (-871.604) (-870.154) * [-868.846] (-870.825) (-868.190) (-871.485) -- 0:00:39
      338000 -- (-868.222) (-872.230) (-872.756) [-869.272] * (-869.003) (-872.806) [-868.543] (-870.868) -- 0:00:39
      338500 -- [-872.987] (-868.300) (-871.851) (-869.258) * (-868.303) (-871.517) [-871.588] (-868.655) -- 0:00:39
      339000 -- (-871.144) (-868.307) [-869.514] (-869.506) * (-867.829) (-868.704) [-869.914] (-870.646) -- 0:00:38
      339500 -- (-870.352) (-869.889) (-868.863) [-870.120] * [-869.629] (-871.702) (-872.942) (-868.663) -- 0:00:38
      340000 -- (-871.478) (-870.306) [-868.491] (-868.425) * (-869.803) [-876.537] (-871.509) (-868.019) -- 0:00:38

      Average standard deviation of split frequencies: 0.015827

      340500 -- (-869.036) [-868.768] (-869.331) (-868.577) * (-868.482) (-872.172) [-874.729] (-868.700) -- 0:00:38
      341000 -- (-872.299) (-868.710) (-870.990) [-868.665] * [-868.681] (-870.834) (-873.378) (-871.076) -- 0:00:38
      341500 -- (-869.384) (-871.037) [-869.387] (-868.240) * (-869.217) (-869.838) [-872.809] (-871.984) -- 0:00:38
      342000 -- [-870.833] (-870.460) (-868.036) (-868.883) * (-872.231) (-869.018) (-871.497) [-870.147] -- 0:00:38
      342500 -- (-869.311) (-871.599) (-868.370) [-869.402] * (-870.806) (-872.332) (-872.356) [-869.101] -- 0:00:38
      343000 -- (-874.610) (-874.243) (-869.338) [-872.063] * (-874.446) (-875.608) [-869.218] (-871.745) -- 0:00:38
      343500 -- [-870.691] (-871.267) (-869.960) (-871.100) * (-871.832) [-873.656] (-870.126) (-871.159) -- 0:00:38
      344000 -- [-868.755] (-873.452) (-873.837) (-868.504) * (-868.478) [-870.355] (-869.496) (-869.121) -- 0:00:40
      344500 -- (-870.261) [-870.074] (-870.458) (-870.259) * (-868.480) [-871.239] (-870.098) (-869.238) -- 0:00:39
      345000 -- (-870.604) (-869.381) (-872.281) [-870.726] * (-871.287) [-869.134] (-868.853) (-869.198) -- 0:00:39

      Average standard deviation of split frequencies: 0.014346

      345500 -- (-872.203) (-870.048) [-875.253] (-868.825) * [-868.995] (-871.072) (-869.821) (-869.997) -- 0:00:39
      346000 -- (-870.735) (-869.539) [-868.191] (-873.432) * (-870.484) (-867.858) [-869.381] (-870.003) -- 0:00:39
      346500 -- (-869.981) [-868.476] (-868.560) (-873.562) * (-870.124) (-868.239) (-868.383) [-868.022] -- 0:00:39
      347000 -- (-870.496) [-868.218] (-870.473) (-871.570) * (-869.601) (-870.967) (-869.318) [-869.901] -- 0:00:39
      347500 -- (-870.158) [-868.232] (-868.666) (-870.132) * [-871.007] (-873.590) (-869.801) (-868.787) -- 0:00:39
      348000 -- (-869.211) (-871.547) [-869.278] (-870.838) * (-869.819) (-869.941) [-869.925] (-872.546) -- 0:00:39
      348500 -- (-870.985) (-868.857) [-869.953] (-870.032) * (-869.634) (-870.561) (-869.571) [-869.736] -- 0:00:39
      349000 -- [-871.559] (-874.243) (-870.930) (-869.513) * (-873.045) (-872.890) [-873.674] (-870.087) -- 0:00:39
      349500 -- (-873.337) [-870.143] (-870.455) (-871.581) * (-868.446) [-870.334] (-869.321) (-871.065) -- 0:00:39
      350000 -- (-871.863) [-868.686] (-868.193) (-868.966) * (-871.745) (-873.839) (-868.577) [-872.478] -- 0:00:39

      Average standard deviation of split frequencies: 0.012731

      350500 -- (-870.434) [-868.375] (-870.404) (-869.191) * (-872.247) (-873.443) [-869.023] (-871.937) -- 0:00:38
      351000 -- (-869.351) (-869.124) (-871.484) [-868.252] * (-869.821) (-877.156) [-870.194] (-871.139) -- 0:00:38
      351500 -- (-872.438) (-870.506) (-871.899) [-872.116] * [-869.972] (-872.066) (-870.819) (-874.396) -- 0:00:38
      352000 -- (-869.417) (-871.533) [-870.658] (-873.166) * (-870.532) (-869.616) [-870.318] (-870.736) -- 0:00:38
      352500 -- [-869.488] (-870.552) (-871.012) (-870.868) * [-875.533] (-869.683) (-872.758) (-873.482) -- 0:00:38
      353000 -- [-869.859] (-870.570) (-869.428) (-873.751) * (-873.078) (-869.096) [-869.520] (-872.165) -- 0:00:38
      353500 -- [-869.745] (-868.320) (-869.236) (-871.256) * (-870.122) (-868.650) [-870.838] (-869.254) -- 0:00:38
      354000 -- (-871.609) (-868.665) [-872.063] (-871.015) * (-869.143) (-868.561) (-870.078) [-871.736] -- 0:00:38
      354500 -- [-869.273] (-870.586) (-869.073) (-870.340) * [-869.067] (-868.483) (-869.424) (-872.827) -- 0:00:38
      355000 -- (-870.070) (-869.040) [-872.474] (-869.451) * (-869.164) (-869.940) [-871.469] (-870.266) -- 0:00:38

      Average standard deviation of split frequencies: 0.012385

      355500 -- (-870.071) (-870.144) (-867.888) [-870.436] * [-868.999] (-868.299) (-873.836) (-868.101) -- 0:00:38
      356000 -- (-871.438) (-870.817) (-870.069) [-868.444] * [-871.398] (-869.934) (-870.324) (-870.150) -- 0:00:37
      356500 -- (-870.130) (-868.752) [-869.386] (-871.608) * (-874.295) (-869.053) (-870.551) [-870.730] -- 0:00:37
      357000 -- [-869.370] (-869.085) (-869.067) (-873.852) * (-870.979) (-868.496) (-869.526) [-870.217] -- 0:00:37
      357500 -- (-872.666) [-871.972] (-870.415) (-871.483) * [-870.898] (-869.495) (-871.281) (-871.424) -- 0:00:37
      358000 -- (-873.050) (-868.121) (-870.899) [-872.214] * [-870.489] (-870.315) (-868.078) (-871.186) -- 0:00:37
      358500 -- (-874.096) [-869.774] (-869.024) (-871.609) * (-870.124) (-869.070) (-869.587) [-869.679] -- 0:00:37
      359000 -- (-868.823) [-870.838] (-869.283) (-868.322) * (-868.960) (-870.086) (-872.230) [-869.515] -- 0:00:37
      359500 -- (-868.811) (-868.495) [-873.185] (-871.966) * (-869.222) (-870.553) [-872.433] (-874.333) -- 0:00:37
      360000 -- [-868.672] (-868.091) (-874.193) (-872.263) * [-869.588] (-870.736) (-872.707) (-875.556) -- 0:00:37

      Average standard deviation of split frequencies: 0.010865

      360500 -- (-869.682) (-870.705) [-869.774] (-871.173) * (-870.394) (-869.618) [-870.454] (-869.601) -- 0:00:37
      361000 -- (-868.150) (-870.022) [-871.692] (-868.103) * (-869.566) [-871.842] (-871.003) (-868.935) -- 0:00:38
      361500 -- (-870.418) (-873.640) [-870.046] (-869.464) * (-869.999) (-869.533) [-868.656] (-868.603) -- 0:00:38
      362000 -- (-870.098) (-874.517) (-869.556) [-869.598] * [-870.450] (-868.157) (-868.325) (-869.317) -- 0:00:38
      362500 -- (-869.748) (-872.156) [-871.210] (-869.384) * (-871.322) (-869.321) (-870.268) [-871.321] -- 0:00:38
      363000 -- [-869.352] (-868.640) (-870.590) (-871.892) * (-870.282) (-880.126) (-870.499) [-868.486] -- 0:00:38
      363500 -- (-871.389) [-870.693] (-870.020) (-869.745) * (-870.364) (-868.891) (-870.768) [-868.494] -- 0:00:38
      364000 -- (-879.133) (-869.770) [-869.247] (-869.220) * [-869.302] (-868.069) (-868.285) (-870.051) -- 0:00:38
      364500 -- (-874.154) (-870.367) [-868.457] (-869.413) * [-873.731] (-873.568) (-870.291) (-872.443) -- 0:00:38
      365000 -- [-874.627] (-872.380) (-868.414) (-869.021) * (-873.718) (-868.452) [-868.437] (-870.404) -- 0:00:38

      Average standard deviation of split frequencies: 0.011062

      365500 -- (-869.612) (-872.723) [-868.325] (-870.414) * (-874.302) [-870.501] (-868.857) (-872.703) -- 0:00:38
      366000 -- (-872.945) [-872.120] (-868.876) (-870.907) * (-871.457) (-872.562) [-868.529] (-871.154) -- 0:00:38
      366500 -- (-872.964) [-869.324] (-868.575) (-870.968) * (-869.171) (-870.511) (-869.827) [-868.591] -- 0:00:38
      367000 -- [-872.825] (-870.316) (-870.087) (-870.757) * (-869.284) (-869.186) [-870.137] (-868.490) -- 0:00:37
      367500 -- [-876.905] (-873.081) (-871.776) (-869.513) * (-871.600) (-874.039) (-868.842) [-868.691] -- 0:00:37
      368000 -- (-868.830) (-869.026) [-872.506] (-873.348) * [-870.406] (-871.983) (-868.698) (-869.488) -- 0:00:37
      368500 -- (-870.777) [-869.607] (-870.719) (-871.520) * (-873.797) (-868.646) (-876.166) [-869.762] -- 0:00:37
      369000 -- (-868.912) (-869.278) (-871.215) [-871.737] * (-875.783) [-869.145] (-879.916) (-870.466) -- 0:00:37
      369500 -- (-868.714) (-870.435) (-868.789) [-868.588] * (-869.522) (-868.958) (-873.645) [-870.579] -- 0:00:37
      370000 -- (-869.914) (-870.284) [-868.015] (-871.455) * (-869.873) (-868.839) (-868.176) [-869.555] -- 0:00:37

      Average standard deviation of split frequencies: 0.009950

      370500 -- (-872.927) (-875.535) (-867.862) [-868.325] * [-869.192] (-870.711) (-870.281) (-868.764) -- 0:00:37
      371000 -- (-871.470) (-869.718) [-869.332] (-869.297) * (-871.125) [-868.401] (-869.534) (-869.724) -- 0:00:37
      371500 -- (-869.100) (-868.585) (-869.324) [-869.450] * (-869.968) (-868.733) (-869.916) [-869.550] -- 0:00:37
      372000 -- [-871.177] (-868.277) (-873.646) (-871.814) * (-872.293) [-869.017] (-873.154) (-870.491) -- 0:00:37
      372500 -- [-873.219] (-868.431) (-872.343) (-870.843) * (-872.083) [-869.365] (-869.240) (-870.048) -- 0:00:37
      373000 -- [-871.917] (-868.901) (-869.320) (-870.446) * (-870.280) [-870.808] (-871.740) (-871.667) -- 0:00:36
      373500 -- (-871.764) [-870.487] (-872.589) (-871.519) * (-871.448) [-868.789] (-869.826) (-868.455) -- 0:00:36
      374000 -- (-875.109) [-869.828] (-868.054) (-869.119) * (-868.485) (-873.096) (-870.299) [-868.338] -- 0:00:36
      374500 -- (-869.514) (-873.298) (-868.101) [-872.426] * (-870.136) (-874.586) [-871.259] (-870.296) -- 0:00:36
      375000 -- (-868.725) [-869.514] (-867.972) (-869.804) * [-869.179] (-870.028) (-872.486) (-874.234) -- 0:00:36

      Average standard deviation of split frequencies: 0.009809

      375500 -- (-869.890) (-869.729) [-868.983] (-870.071) * (-870.916) (-870.989) (-869.605) [-871.691] -- 0:00:36
      376000 -- [-869.993] (-869.521) (-870.590) (-873.869) * [-869.584] (-871.204) (-871.143) (-867.780) -- 0:00:36
      376500 -- (-868.973) (-869.266) (-871.912) [-869.266] * [-868.572] (-870.434) (-870.453) (-869.797) -- 0:00:36
      377000 -- [-870.064] (-873.102) (-870.884) (-870.622) * (-869.520) (-870.318) (-876.697) [-871.803] -- 0:00:36
      377500 -- (-867.919) [-868.769] (-870.690) (-870.237) * (-869.523) [-869.362] (-876.973) (-871.162) -- 0:00:37
      378000 -- (-869.434) (-870.035) (-873.355) [-871.534] * (-872.667) [-873.610] (-869.619) (-873.056) -- 0:00:37
      378500 -- (-871.987) [-870.269] (-870.405) (-870.500) * [-868.634] (-876.488) (-870.088) (-871.200) -- 0:00:37
      379000 -- (-870.368) (-869.227) (-869.473) [-871.756] * (-872.443) (-871.811) (-869.764) [-872.191] -- 0:00:37
      379500 -- (-868.492) (-869.031) [-870.563] (-870.823) * (-871.814) [-870.574] (-869.883) (-872.059) -- 0:00:37
      380000 -- (-870.240) (-868.675) [-868.609] (-874.490) * [-870.435] (-868.698) (-868.972) (-870.470) -- 0:00:37

      Average standard deviation of split frequencies: 0.009688

      380500 -- [-872.738] (-868.329) (-869.101) (-872.856) * (-877.735) [-869.663] (-868.990) (-872.630) -- 0:00:37
      381000 -- (-873.603) (-870.015) (-872.353) [-868.021] * (-873.650) (-869.291) (-870.802) [-868.210] -- 0:00:37
      381500 -- [-873.496] (-873.136) (-874.860) (-868.986) * [-869.710] (-871.162) (-869.725) (-870.647) -- 0:00:37
      382000 -- (-870.253) (-870.963) [-870.924] (-868.628) * (-868.121) (-872.408) [-870.443] (-870.149) -- 0:00:37
      382500 -- [-870.312] (-870.009) (-869.922) (-870.594) * [-870.154] (-870.963) (-868.533) (-871.152) -- 0:00:37
      383000 -- (-870.383) (-869.645) [-869.669] (-869.172) * (-868.829) (-870.233) [-870.116] (-869.007) -- 0:00:37
      383500 -- (-872.534) (-871.165) [-872.045] (-869.802) * (-870.484) (-868.527) [-868.799] (-872.601) -- 0:00:36
      384000 -- (-870.942) (-873.217) [-869.227] (-868.058) * (-872.505) [-869.284] (-868.690) (-869.760) -- 0:00:36
      384500 -- (-868.068) (-869.190) (-868.506) [-868.125] * (-869.385) (-869.261) (-869.689) [-869.632] -- 0:00:36
      385000 -- (-867.792) [-870.777] (-872.508) (-871.671) * (-870.435) (-869.539) [-870.250] (-872.409) -- 0:00:36

      Average standard deviation of split frequencies: 0.009052

      385500 -- (-868.796) (-868.419) (-871.176) [-872.473] * (-868.738) (-870.320) [-870.524] (-876.063) -- 0:00:36
      386000 -- (-870.635) [-868.370] (-871.543) (-872.308) * (-868.542) (-869.112) (-873.408) [-869.596] -- 0:00:36
      386500 -- (-868.605) (-869.061) (-874.822) [-868.764] * (-869.991) (-871.966) [-868.041] (-871.138) -- 0:00:36
      387000 -- (-869.171) (-871.085) [-872.625] (-868.954) * (-871.800) [-870.611] (-868.815) (-870.350) -- 0:00:36
      387500 -- (-871.382) (-870.660) [-871.263] (-872.389) * [-868.583] (-869.609) (-869.935) (-868.242) -- 0:00:36
      388000 -- (-874.799) (-870.034) [-871.000] (-870.911) * [-868.371] (-868.528) (-869.736) (-870.781) -- 0:00:36
      388500 -- [-868.984] (-876.200) (-870.616) (-868.504) * (-868.552) (-874.783) (-869.917) [-868.867] -- 0:00:36
      389000 -- (-871.589) [-871.760] (-870.673) (-869.438) * (-869.379) (-871.832) (-871.122) [-869.576] -- 0:00:36
      389500 -- (-868.573) (-872.190) [-867.932] (-872.544) * (-870.554) [-872.263] (-875.872) (-872.462) -- 0:00:36
      390000 -- (-867.998) (-874.908) [-870.480] (-868.424) * (-874.874) (-871.130) (-869.597) [-872.344] -- 0:00:35

      Average standard deviation of split frequencies: 0.009298

      390500 -- (-871.327) (-870.758) [-868.013] (-869.144) * (-869.150) (-871.052) [-870.639] (-869.029) -- 0:00:35
      391000 -- [-871.338] (-871.135) (-869.742) (-870.211) * [-868.019] (-872.470) (-870.491) (-869.621) -- 0:00:35
      391500 -- (-872.291) [-869.178] (-869.307) (-868.916) * [-868.897] (-871.008) (-873.555) (-869.215) -- 0:00:35
      392000 -- [-869.405] (-870.001) (-875.435) (-869.038) * (-869.008) [-869.612] (-873.943) (-870.715) -- 0:00:35
      392500 -- (-870.316) (-871.897) [-872.256] (-869.975) * (-869.034) (-867.960) [-870.347] (-871.883) -- 0:00:35
      393000 -- (-871.183) (-872.939) (-871.287) [-870.292] * [-870.117] (-868.529) (-869.569) (-871.094) -- 0:00:35
      393500 -- (-868.471) (-871.266) (-870.325) [-868.264] * [-871.336] (-871.053) (-872.119) (-868.889) -- 0:00:35
      394000 -- [-868.471] (-869.214) (-877.130) (-868.626) * (-869.035) (-872.194) (-872.684) [-868.530] -- 0:00:36
      394500 -- (-868.609) (-869.623) [-869.178] (-869.749) * [-869.424] (-869.352) (-871.387) (-872.188) -- 0:00:36
      395000 -- (-868.168) (-873.255) (-870.827) [-870.226] * (-871.923) (-871.285) (-872.722) [-868.146] -- 0:00:36

      Average standard deviation of split frequencies: 0.008482

      395500 -- (-868.727) [-870.596] (-874.434) (-872.623) * (-870.332) (-873.773) (-871.762) [-868.604] -- 0:00:36
      396000 -- (-870.128) (-871.795) [-869.022] (-870.693) * (-868.623) (-873.378) [-869.184] (-869.670) -- 0:00:36
      396500 -- [-872.048] (-872.577) (-872.605) (-872.645) * (-873.887) (-874.811) (-872.139) [-868.242] -- 0:00:36
      397000 -- (-873.351) [-870.537] (-869.805) (-872.733) * [-873.632] (-868.992) (-870.429) (-871.940) -- 0:00:36
      397500 -- (-870.543) (-872.522) (-871.669) [-868.936] * (-867.951) (-870.082) [-870.298] (-871.160) -- 0:00:36
      398000 -- (-868.944) (-872.331) (-870.549) [-870.983] * (-869.720) (-869.119) (-870.819) [-868.709] -- 0:00:36
      398500 -- (-871.339) (-870.912) [-870.547] (-871.012) * (-869.628) [-869.391] (-875.349) (-873.696) -- 0:00:36
      399000 -- (-873.701) [-871.138] (-868.469) (-870.559) * (-869.234) (-874.416) (-868.156) [-870.146] -- 0:00:36
      399500 -- (-868.987) [-871.762] (-869.966) (-869.511) * [-869.380] (-872.237) (-868.997) (-869.828) -- 0:00:36
      400000 -- (-869.945) [-868.311] (-868.140) (-872.616) * (-871.477) (-870.333) (-868.584) [-869.760] -- 0:00:36

      Average standard deviation of split frequencies: 0.008604

      400500 -- (-869.506) (-869.399) [-869.738] (-871.089) * (-871.036) (-871.979) (-870.230) [-869.889] -- 0:00:35
      401000 -- (-870.151) (-869.418) [-868.982] (-869.704) * (-869.959) [-870.308] (-870.195) (-871.473) -- 0:00:35
      401500 -- [-868.982] (-868.817) (-871.946) (-869.588) * (-872.115) (-870.324) [-870.745] (-874.977) -- 0:00:35
      402000 -- (-869.693) (-869.310) (-871.864) [-869.622] * (-871.615) (-868.911) (-869.423) [-872.557] -- 0:00:35
      402500 -- [-868.861] (-868.980) (-870.717) (-868.904) * (-869.103) (-869.069) (-875.509) [-874.246] -- 0:00:35
      403000 -- [-869.592] (-869.343) (-881.074) (-868.825) * (-873.079) (-873.526) (-871.770) [-871.230] -- 0:00:35
      403500 -- (-869.133) [-871.766] (-869.484) (-868.363) * (-872.424) (-871.643) (-870.458) [-871.435] -- 0:00:35
      404000 -- (-871.083) (-868.933) (-869.781) [-869.520] * [-870.476] (-870.387) (-868.645) (-875.677) -- 0:00:35
      404500 -- (-874.751) (-869.964) [-869.272] (-870.061) * (-870.646) (-873.568) (-869.052) [-872.346] -- 0:00:35
      405000 -- (-870.544) (-868.273) [-869.069] (-868.724) * (-870.090) (-868.451) (-870.119) [-869.235] -- 0:00:35

      Average standard deviation of split frequencies: 0.007586

      405500 -- (-872.151) (-869.448) [-869.392] (-870.623) * (-869.810) (-869.601) [-868.774] (-869.170) -- 0:00:35
      406000 -- (-868.004) (-868.990) [-869.949] (-868.708) * (-868.817) (-870.643) [-868.632] (-873.093) -- 0:00:35
      406500 -- (-868.986) (-867.998) [-869.359] (-869.103) * (-870.233) [-870.225] (-872.752) (-873.277) -- 0:00:35
      407000 -- (-868.391) [-868.113] (-870.130) (-868.876) * (-869.939) (-869.616) [-873.467] (-870.268) -- 0:00:34
      407500 -- [-869.520] (-869.235) (-870.404) (-869.150) * [-869.621] (-868.356) (-869.811) (-869.792) -- 0:00:34
      408000 -- (-872.445) (-876.671) [-870.397] (-872.304) * (-869.603) (-868.594) [-870.061] (-870.013) -- 0:00:34
      408500 -- (-869.625) (-869.830) [-868.712] (-870.092) * [-868.893] (-870.552) (-869.739) (-870.025) -- 0:00:34
      409000 -- (-868.326) (-869.490) [-869.604] (-869.031) * (-870.898) (-870.497) [-870.513] (-872.027) -- 0:00:34
      409500 -- (-869.781) (-872.685) [-869.980] (-868.592) * (-868.401) (-870.335) (-874.035) [-870.966] -- 0:00:34
      410000 -- (-872.087) (-873.530) (-869.339) [-869.209] * [-868.508] (-870.887) (-873.793) (-870.257) -- 0:00:34

      Average standard deviation of split frequencies: 0.007959

      410500 -- (-868.494) (-869.772) (-868.522) [-869.379] * (-868.757) [-869.645] (-869.370) (-872.815) -- 0:00:35
      411000 -- (-868.261) [-870.651] (-869.792) (-871.088) * (-874.976) (-870.568) (-874.077) [-870.051] -- 0:00:35
      411500 -- [-868.244] (-871.239) (-869.316) (-868.406) * [-873.222] (-868.044) (-872.941) (-871.477) -- 0:00:35
      412000 -- (-873.242) (-872.573) (-870.016) [-869.289] * (-875.157) (-869.910) [-871.947] (-870.624) -- 0:00:35
      412500 -- (-868.777) (-869.858) (-872.349) [-869.359] * [-869.647] (-870.481) (-872.929) (-870.436) -- 0:00:35
      413000 -- [-874.365] (-871.959) (-872.762) (-869.208) * [-870.291] (-868.442) (-871.668) (-869.003) -- 0:00:35
      413500 -- (-869.553) [-870.834] (-872.071) (-868.650) * (-869.907) (-868.749) [-868.301] (-872.757) -- 0:00:35
      414000 -- (-868.586) (-872.149) (-868.083) [-869.020] * (-868.588) [-869.863] (-872.082) (-869.876) -- 0:00:35
      414500 -- (-870.652) (-872.762) [-870.476] (-869.942) * (-868.628) (-870.114) [-868.544] (-871.963) -- 0:00:35
      415000 -- [-869.068] (-870.454) (-871.034) (-872.292) * (-869.348) (-869.145) (-869.077) [-870.057] -- 0:00:35

      Average standard deviation of split frequencies: 0.008083

      415500 -- (-868.809) (-870.042) (-873.303) [-871.614] * [-868.432] (-868.356) (-870.695) (-871.444) -- 0:00:35
      416000 -- (-871.506) (-869.799) (-868.784) [-870.063] * (-867.993) (-869.086) (-869.300) [-870.414] -- 0:00:35
      416500 -- (-873.334) (-870.505) [-872.796] (-871.012) * (-867.983) (-870.277) [-870.190] (-870.969) -- 0:00:35
      417000 -- (-871.648) (-874.314) (-870.040) [-873.856] * (-867.958) (-873.287) (-869.032) [-869.485] -- 0:00:34
      417500 -- (-870.274) [-873.235] (-870.257) (-875.089) * [-870.786] (-871.448) (-868.779) (-872.268) -- 0:00:34
      418000 -- [-867.968] (-876.977) (-869.413) (-869.147) * (-868.249) (-870.802) (-868.697) [-869.901] -- 0:00:34
      418500 -- [-869.232] (-874.028) (-870.000) (-869.157) * (-868.347) [-869.341] (-868.827) (-871.111) -- 0:00:34
      419000 -- (-870.652) (-872.121) (-871.875) [-871.684] * (-869.301) (-870.420) (-869.240) [-871.061] -- 0:00:34
      419500 -- (-874.902) (-870.258) (-871.984) [-871.314] * (-869.809) (-869.948) [-869.201] (-868.670) -- 0:00:34
      420000 -- (-871.731) (-873.857) (-874.746) [-874.875] * [-874.355] (-867.975) (-869.090) (-871.925) -- 0:00:34

      Average standard deviation of split frequencies: 0.008442

      420500 -- (-868.629) [-878.398] (-870.170) (-870.038) * (-871.394) (-867.795) [-870.863] (-869.299) -- 0:00:34
      421000 -- (-868.910) (-873.476) (-871.659) [-868.439] * [-869.069] (-869.482) (-868.775) (-869.776) -- 0:00:34
      421500 -- [-869.506] (-871.196) (-870.044) (-868.757) * [-868.272] (-870.849) (-871.347) (-868.491) -- 0:00:34
      422000 -- (-869.544) [-870.570] (-869.958) (-870.811) * (-869.321) [-871.181] (-870.722) (-869.671) -- 0:00:34
      422500 -- [-874.665] (-872.532) (-869.518) (-871.979) * [-869.023] (-870.197) (-868.193) (-868.836) -- 0:00:34
      423000 -- (-870.267) [-869.176] (-869.975) (-869.078) * (-870.386) (-869.821) (-873.171) [-869.302] -- 0:00:34
      423500 -- [-869.245] (-873.335) (-873.511) (-871.394) * (-870.378) (-869.829) (-872.717) [-871.126] -- 0:00:34
      424000 -- (-868.889) [-868.758] (-869.067) (-873.525) * (-870.303) (-871.978) (-869.897) [-870.681] -- 0:00:33
      424500 -- [-868.752] (-871.326) (-868.886) (-872.138) * (-869.242) (-870.974) [-867.931] (-868.691) -- 0:00:33
      425000 -- (-870.856) (-871.202) [-870.920] (-872.722) * (-872.882) (-871.909) [-867.931] (-868.962) -- 0:00:33

      Average standard deviation of split frequencies: 0.009738

      425500 -- (-871.546) [-869.792] (-869.754) (-871.880) * [-873.769] (-868.967) (-868.644) (-876.153) -- 0:00:33
      426000 -- [-873.491] (-872.076) (-871.432) (-869.247) * (-869.860) [-869.909] (-868.481) (-872.816) -- 0:00:33
      426500 -- (-870.962) [-869.935] (-868.209) (-868.964) * (-868.974) [-873.870] (-869.865) (-869.443) -- 0:00:33
      427000 -- (-874.381) (-874.803) [-868.572] (-868.220) * [-869.152] (-870.606) (-869.066) (-870.272) -- 0:00:33
      427500 -- (-870.356) (-869.165) (-873.047) [-869.408] * (-870.070) [-867.836] (-868.687) (-869.276) -- 0:00:34
      428000 -- (-869.090) [-870.395] (-872.354) (-869.470) * (-868.996) (-869.489) (-868.783) [-868.016] -- 0:00:34
      428500 -- [-870.700] (-871.446) (-873.776) (-870.599) * (-869.315) (-869.711) (-868.746) [-868.710] -- 0:00:34
      429000 -- [-870.533] (-870.779) (-873.674) (-874.085) * (-868.568) (-870.210) [-869.479] (-875.060) -- 0:00:34
      429500 -- (-869.519) (-874.449) (-871.544) [-868.538] * (-868.449) [-868.530] (-872.243) (-872.293) -- 0:00:34
      430000 -- (-873.280) (-873.308) [-869.309] (-870.180) * (-869.271) [-868.547] (-875.736) (-873.281) -- 0:00:34

      Average standard deviation of split frequencies: 0.008538

      430500 -- (-869.208) (-869.051) [-869.305] (-869.321) * (-873.059) (-869.787) (-870.812) [-872.189] -- 0:00:34
      431000 -- (-871.437) (-871.716) [-868.574] (-868.525) * (-871.980) (-869.452) (-868.774) [-873.281] -- 0:00:34
      431500 -- (-869.724) (-869.821) (-868.400) [-869.706] * [-869.078] (-871.638) (-869.450) (-874.449) -- 0:00:34
      432000 -- (-867.857) (-868.579) (-869.267) [-870.291] * (-872.357) (-871.989) (-871.316) [-868.925] -- 0:00:34
      432500 -- (-871.253) (-869.561) (-869.822) [-872.679] * (-870.141) (-870.899) (-871.147) [-869.384] -- 0:00:34
      433000 -- (-873.825) (-873.180) (-870.740) [-868.237] * (-870.992) (-872.432) (-869.753) [-871.726] -- 0:00:34
      433500 -- (-872.060) [-874.351] (-870.660) (-870.990) * (-871.951) [-870.820] (-870.755) (-873.936) -- 0:00:33
      434000 -- [-868.539] (-870.844) (-869.221) (-870.004) * (-868.763) (-869.810) (-871.640) [-869.346] -- 0:00:33
      434500 -- (-868.667) (-875.804) (-869.901) [-873.232] * (-869.850) [-868.950] (-871.018) (-870.156) -- 0:00:33
      435000 -- (-868.695) [-873.249] (-869.917) (-873.489) * (-869.227) [-870.861] (-872.119) (-868.444) -- 0:00:33

      Average standard deviation of split frequencies: 0.008578

      435500 -- [-870.658] (-870.293) (-870.606) (-872.484) * (-868.740) [-869.930] (-869.788) (-868.994) -- 0:00:33
      436000 -- (-872.446) [-868.906] (-868.415) (-870.923) * [-869.075] (-872.034) (-869.821) (-870.532) -- 0:00:33
      436500 -- (-869.331) [-876.160] (-868.828) (-873.986) * (-867.930) [-868.903] (-868.179) (-871.802) -- 0:00:33
      437000 -- (-869.839) [-869.507] (-871.583) (-873.907) * [-868.324] (-870.278) (-871.093) (-868.372) -- 0:00:33
      437500 -- (-871.909) (-874.176) [-873.018] (-869.912) * (-869.107) [-868.349] (-870.087) (-873.160) -- 0:00:33
      438000 -- [-869.919] (-871.581) (-872.277) (-869.684) * [-869.307] (-871.771) (-869.354) (-870.712) -- 0:00:33
      438500 -- [-868.814] (-868.438) (-872.229) (-869.510) * (-872.635) (-871.263) [-869.401] (-869.188) -- 0:00:33
      439000 -- (-868.345) [-869.354] (-869.639) (-869.553) * (-869.721) [-868.951] (-869.939) (-869.467) -- 0:00:33
      439500 -- [-870.813] (-869.231) (-868.265) (-870.041) * (-869.883) (-869.106) (-868.373) [-869.519] -- 0:00:33
      440000 -- (-869.618) [-867.864] (-868.381) (-867.957) * [-868.087] (-871.516) (-872.034) (-871.726) -- 0:00:33

      Average standard deviation of split frequencies: 0.008629

      440500 -- (-874.740) (-868.680) [-869.454] (-871.858) * (-869.626) (-868.854) (-869.133) [-871.770] -- 0:00:33
      441000 -- (-868.781) [-867.967] (-871.655) (-871.765) * [-869.283] (-869.143) (-869.615) (-869.468) -- 0:00:32
      441500 -- [-868.655] (-868.097) (-869.484) (-869.653) * (-868.075) (-871.360) (-873.932) [-868.601] -- 0:00:32
      442000 -- (-868.426) (-871.245) (-870.681) [-868.456] * (-870.366) (-870.615) [-871.723] (-871.201) -- 0:00:32
      442500 -- (-869.978) (-871.041) [-870.519] (-868.733) * (-869.210) [-869.478] (-872.462) (-868.556) -- 0:00:32
      443000 -- (-870.540) [-867.774] (-870.772) (-869.805) * (-869.342) (-869.745) (-871.651) [-871.617] -- 0:00:32
      443500 -- (-872.012) [-869.031] (-868.925) (-870.158) * [-870.039] (-868.263) (-869.382) (-868.953) -- 0:00:32
      444000 -- [-868.476] (-869.783) (-870.156) (-869.225) * (-868.981) (-872.202) [-870.455] (-870.547) -- 0:00:33
      444500 -- (-872.039) (-872.057) (-870.977) [-868.786] * (-873.123) (-872.250) [-870.690] (-869.014) -- 0:00:33
      445000 -- (-868.048) [-869.193] (-872.535) (-868.604) * [-869.095] (-871.233) (-873.714) (-870.682) -- 0:00:33

      Average standard deviation of split frequencies: 0.009019

      445500 -- [-869.019] (-871.894) (-872.183) (-868.797) * (-870.410) (-870.209) (-871.112) [-870.894] -- 0:00:33
      446000 -- (-868.413) (-870.934) [-869.309] (-870.766) * (-872.587) (-869.132) (-870.024) [-869.686] -- 0:00:33
      446500 -- (-869.177) (-870.026) (-869.912) [-873.428] * [-869.917] (-873.290) (-870.372) (-867.762) -- 0:00:33
      447000 -- [-869.104] (-870.233) (-869.426) (-872.848) * (-870.263) (-872.985) (-872.956) [-868.674] -- 0:00:33
      447500 -- (-871.453) (-874.874) [-869.046] (-869.229) * (-869.622) (-873.547) (-868.791) [-869.787] -- 0:00:33
      448000 -- [-869.460] (-868.894) (-875.450) (-869.704) * [-868.162] (-871.866) (-869.495) (-870.352) -- 0:00:33
      448500 -- (-873.167) (-870.905) [-871.157] (-869.860) * (-872.501) (-870.795) [-868.828] (-869.639) -- 0:00:33
      449000 -- (-871.154) (-872.297) [-870.779] (-869.315) * (-870.220) [-872.593] (-868.692) (-870.089) -- 0:00:33
      449500 -- (-872.171) (-868.941) [-868.726] (-868.224) * (-870.380) [-871.296] (-873.031) (-869.999) -- 0:00:33
      450000 -- (-871.288) (-868.901) [-869.048] (-868.300) * (-869.957) (-872.800) (-870.916) [-871.353] -- 0:00:33

      Average standard deviation of split frequencies: 0.009763

      450500 -- (-869.035) (-869.243) (-869.205) [-870.361] * (-868.239) (-874.812) (-868.907) [-870.784] -- 0:00:32
      451000 -- (-869.696) (-869.117) (-871.577) [-870.326] * (-868.426) [-870.721] (-870.856) (-870.787) -- 0:00:32
      451500 -- (-869.552) (-871.987) (-869.662) [-871.555] * (-868.179) (-869.749) [-870.595] (-870.160) -- 0:00:32
      452000 -- [-869.584] (-875.135) (-870.432) (-871.920) * [-867.870] (-869.313) (-868.032) (-871.658) -- 0:00:32
      452500 -- (-868.299) (-870.957) (-871.607) [-869.934] * (-870.135) [-868.632] (-873.473) (-871.194) -- 0:00:32
      453000 -- (-869.750) (-868.657) [-869.788] (-871.222) * (-871.822) (-868.014) (-869.469) [-869.181] -- 0:00:32
      453500 -- (-870.075) (-868.982) (-872.597) [-867.815] * (-867.794) (-868.644) (-870.624) [-868.368] -- 0:00:32
      454000 -- (-869.371) [-869.057] (-870.063) (-871.823) * (-872.629) [-868.643] (-872.927) (-868.432) -- 0:00:32
      454500 -- (-873.148) [-867.896] (-869.131) (-877.406) * [-868.848] (-869.141) (-871.201) (-868.655) -- 0:00:32
      455000 -- (-870.498) (-869.005) (-869.375) [-870.176] * (-870.250) [-869.405] (-869.115) (-873.349) -- 0:00:32

      Average standard deviation of split frequencies: 0.009993

      455500 -- [-870.918] (-868.170) (-868.962) (-868.086) * [-867.883] (-869.138) (-869.239) (-869.245) -- 0:00:32
      456000 -- (-869.236) (-870.644) [-868.190] (-868.959) * (-872.408) (-872.289) [-868.492] (-868.334) -- 0:00:32
      456500 -- [-869.996] (-872.179) (-871.256) (-872.764) * [-870.893] (-869.014) (-873.280) (-869.123) -- 0:00:32
      457000 -- [-870.636] (-869.452) (-870.116) (-871.421) * (-874.685) (-869.633) [-877.371] (-868.276) -- 0:00:32
      457500 -- (-871.492) (-870.428) [-870.164] (-868.417) * [-868.015] (-870.503) (-873.208) (-870.924) -- 0:00:32
      458000 -- [-868.779] (-868.621) (-871.747) (-868.249) * [-869.749] (-869.802) (-871.087) (-874.270) -- 0:00:31
      458500 -- [-869.814] (-868.164) (-870.049) (-869.962) * [-872.985] (-870.501) (-868.802) (-876.098) -- 0:00:31
      459000 -- (-869.274) (-869.654) [-873.901] (-869.618) * [-873.011] (-874.064) (-869.674) (-873.439) -- 0:00:31
      459500 -- [-870.335] (-872.519) (-875.119) (-872.767) * [-869.898] (-872.837) (-869.125) (-871.412) -- 0:00:31
      460000 -- (-869.617) (-870.157) [-870.834] (-873.277) * (-871.774) (-870.707) [-868.142] (-871.381) -- 0:00:31

      Average standard deviation of split frequencies: 0.010233

      460500 -- (-873.262) [-868.961] (-869.855) (-869.739) * (-870.867) [-868.483] (-869.073) (-869.284) -- 0:00:31
      461000 -- (-868.698) (-868.644) (-869.687) [-871.495] * (-868.915) (-871.256) (-870.771) [-869.019] -- 0:00:32
      461500 -- (-872.852) (-868.658) [-868.415] (-873.680) * [-868.979] (-871.857) (-872.119) (-872.227) -- 0:00:32
      462000 -- [-869.280] (-868.045) (-870.503) (-872.134) * (-869.356) [-874.024] (-875.246) (-870.539) -- 0:00:32
      462500 -- (-869.626) (-868.796) (-872.266) [-869.755] * (-868.669) (-870.887) (-874.380) [-871.709] -- 0:00:32
      463000 -- (-870.470) [-869.654] (-870.543) (-870.413) * (-869.047) (-871.519) (-868.321) [-869.487] -- 0:00:32
      463500 -- (-870.228) (-871.670) (-872.589) [-869.857] * (-869.047) (-872.377) (-869.322) [-872.731] -- 0:00:32
      464000 -- [-869.564] (-869.750) (-869.395) (-870.136) * (-873.567) (-870.820) [-867.985] (-871.925) -- 0:00:32
      464500 -- (-870.504) (-872.376) (-872.782) [-868.559] * (-871.621) (-868.821) (-869.249) [-874.637] -- 0:00:32
      465000 -- [-870.335] (-870.297) (-869.915) (-870.106) * [-869.449] (-868.963) (-871.268) (-874.557) -- 0:00:32

      Average standard deviation of split frequencies: 0.010588

      465500 -- (-869.173) (-873.118) (-869.926) [-868.890] * (-871.190) [-869.431] (-870.623) (-871.108) -- 0:00:32
      466000 -- (-871.806) (-868.501) (-871.088) [-871.629] * (-871.496) (-873.163) (-870.921) [-869.755] -- 0:00:32
      466500 -- [-870.095] (-868.458) (-871.077) (-872.648) * [-869.734] (-873.590) (-870.491) (-869.778) -- 0:00:32
      467000 -- [-873.477] (-868.698) (-871.377) (-870.386) * (-869.142) [-871.604] (-871.053) (-873.817) -- 0:00:31
      467500 -- (-871.327) [-870.769] (-871.023) (-868.347) * (-868.119) (-870.062) (-869.059) [-868.790] -- 0:00:31
      468000 -- (-869.424) (-874.872) (-869.353) [-869.415] * [-868.809] (-869.716) (-868.597) (-868.931) -- 0:00:31
      468500 -- (-869.224) [-868.440] (-869.353) (-870.762) * (-869.310) (-872.814) (-870.637) [-869.214] -- 0:00:31
      469000 -- (-869.606) [-869.006] (-868.425) (-871.061) * (-869.171) (-872.804) (-869.913) [-870.977] -- 0:00:31
      469500 -- [-872.000] (-870.876) (-868.710) (-868.328) * (-871.317) (-872.050) [-869.183] (-869.164) -- 0:00:31
      470000 -- (-870.552) (-870.457) [-868.874] (-870.122) * (-869.704) [-870.764] (-869.344) (-869.475) -- 0:00:31

      Average standard deviation of split frequencies: 0.010950

      470500 -- [-869.450] (-869.807) (-876.384) (-871.931) * (-870.103) [-874.393] (-870.113) (-869.695) -- 0:00:31
      471000 -- (-870.202) (-871.889) (-873.519) [-868.608] * (-870.135) (-868.953) (-872.898) [-868.609] -- 0:00:31
      471500 -- (-875.418) (-872.343) [-870.211] (-869.957) * (-871.465) (-869.509) (-871.688) [-869.220] -- 0:00:31
      472000 -- (-873.168) (-867.978) [-869.779] (-869.965) * (-871.475) (-870.378) (-871.039) [-870.354] -- 0:00:31
      472500 -- (-875.174) (-870.485) (-871.971) [-868.355] * [-869.187] (-872.395) (-871.816) (-868.427) -- 0:00:31
      473000 -- (-872.399) [-870.386] (-873.188) (-869.229) * (-869.900) (-869.381) (-867.774) [-869.095] -- 0:00:31
      473500 -- (-877.583) [-871.145] (-869.246) (-868.047) * (-869.232) (-868.677) [-869.676] (-871.310) -- 0:00:31
      474000 -- (-875.516) (-868.737) [-869.364] (-868.255) * (-869.090) (-870.798) (-870.994) [-870.206] -- 0:00:31
      474500 -- (-873.317) (-871.470) [-871.185] (-871.082) * (-870.426) [-871.662] (-871.444) (-868.797) -- 0:00:31
      475000 -- (-871.186) (-874.191) [-869.028] (-869.064) * (-869.724) (-868.540) (-870.182) [-870.090] -- 0:00:30

      Average standard deviation of split frequencies: 0.011224

      475500 -- (-870.394) (-870.304) (-868.702) [-868.442] * (-870.476) (-868.584) (-868.429) [-872.918] -- 0:00:30
      476000 -- [-868.273] (-872.496) (-868.743) (-869.462) * (-868.033) [-870.824] (-869.369) (-873.058) -- 0:00:30
      476500 -- (-869.023) [-869.798] (-868.587) (-871.662) * [-868.464] (-871.026) (-871.173) (-869.224) -- 0:00:30
      477000 -- (-874.692) [-868.980] (-870.066) (-873.189) * (-868.001) [-872.217] (-868.599) (-868.916) -- 0:00:30
      477500 -- (-868.996) (-871.554) [-869.490] (-873.694) * (-869.241) (-869.014) (-869.372) [-870.006] -- 0:00:30
      478000 -- (-871.383) (-870.717) (-871.637) [-872.132] * (-871.840) [-869.794] (-868.603) (-868.485) -- 0:00:31
      478500 -- (-871.195) (-869.484) (-869.954) [-869.483] * (-871.054) [-872.004] (-870.404) (-868.865) -- 0:00:31
      479000 -- (-870.741) (-871.021) [-868.408] (-871.293) * (-874.524) (-868.548) [-870.427] (-869.011) -- 0:00:31
      479500 -- [-872.850] (-874.842) (-868.586) (-869.928) * (-869.191) [-868.594] (-869.301) (-869.003) -- 0:00:31
      480000 -- (-869.273) (-874.823) (-870.094) [-868.410] * [-868.617] (-868.281) (-870.461) (-872.389) -- 0:00:31

      Average standard deviation of split frequencies: 0.010592

      480500 -- (-869.772) [-868.431] (-873.033) (-870.786) * [-869.219] (-873.034) (-869.220) (-873.882) -- 0:00:31
      481000 -- [-870.682] (-868.593) (-868.670) (-870.204) * (-869.488) (-870.214) (-868.925) [-873.441] -- 0:00:31
      481500 -- (-872.352) (-878.006) [-868.437] (-874.014) * (-868.883) (-870.730) [-868.171] (-869.021) -- 0:00:31
      482000 -- (-869.367) (-870.095) (-868.997) [-868.689] * (-870.772) (-870.620) (-868.466) [-868.215] -- 0:00:31
      482500 -- (-872.516) [-870.182] (-870.003) (-868.652) * [-874.701] (-870.050) (-871.087) (-872.752) -- 0:00:31
      483000 -- (-873.500) [-868.907] (-869.461) (-868.332) * [-869.800] (-873.388) (-871.484) (-874.077) -- 0:00:31
      483500 -- [-872.853] (-868.959) (-870.808) (-870.980) * (-872.171) (-878.207) (-871.339) [-869.805] -- 0:00:30
      484000 -- (-869.302) [-869.768] (-869.512) (-871.516) * (-871.158) [-873.008] (-870.812) (-868.129) -- 0:00:30
      484500 -- (-868.166) (-870.662) (-871.124) [-869.503] * (-870.582) (-867.825) [-869.365] (-869.128) -- 0:00:30
      485000 -- [-870.472] (-871.494) (-873.131) (-872.997) * [-868.812] (-869.304) (-868.182) (-872.590) -- 0:00:30

      Average standard deviation of split frequencies: 0.010217

      485500 -- (-871.504) [-871.184] (-870.856) (-871.200) * (-868.404) (-870.933) (-868.890) [-872.690] -- 0:00:30
      486000 -- (-868.598) (-869.309) (-871.583) [-869.511] * [-868.459] (-870.589) (-868.415) (-870.321) -- 0:00:30
      486500 -- (-868.260) [-869.375] (-873.449) (-872.786) * (-872.077) [-869.007] (-870.038) (-868.595) -- 0:00:30
      487000 -- [-868.543] (-869.692) (-872.195) (-868.377) * (-870.732) [-869.237] (-870.324) (-870.281) -- 0:00:30
      487500 -- (-869.072) (-868.819) (-876.534) [-871.796] * (-869.000) (-874.806) [-871.178] (-874.401) -- 0:00:30
      488000 -- (-870.351) (-871.369) (-869.164) [-870.035] * (-869.541) (-868.655) [-868.646] (-872.976) -- 0:00:30
      488500 -- (-871.045) (-869.322) [-868.913] (-870.952) * (-868.502) (-871.097) [-868.137] (-872.364) -- 0:00:30
      489000 -- (-873.154) (-871.489) [-869.056] (-871.296) * [-869.861] (-868.214) (-869.168) (-868.657) -- 0:00:30
      489500 -- (-873.632) (-872.236) [-870.143] (-872.594) * [-874.217] (-875.194) (-871.157) (-868.144) -- 0:00:30
      490000 -- [-870.159] (-869.399) (-871.150) (-873.714) * (-869.038) (-872.013) [-870.159] (-868.070) -- 0:00:30

      Average standard deviation of split frequencies: 0.010120

      490500 -- [-869.011] (-869.383) (-871.115) (-868.310) * (-869.218) (-873.244) [-869.116] (-868.970) -- 0:00:30
      491000 -- [-869.947] (-870.630) (-868.993) (-870.571) * (-869.994) [-870.341] (-870.355) (-869.519) -- 0:00:30
      491500 -- (-869.750) [-870.426] (-869.551) (-871.569) * (-868.621) [-871.467] (-868.953) (-870.792) -- 0:00:30
      492000 -- (-870.114) (-871.549) [-868.992] (-868.456) * (-871.317) (-868.589) [-871.359] (-871.234) -- 0:00:29
      492500 -- (-867.906) (-872.456) (-868.334) [-868.413] * (-870.002) [-869.543] (-877.335) (-869.614) -- 0:00:29
      493000 -- (-868.349) (-873.066) (-870.369) [-869.383] * [-871.859] (-871.074) (-872.481) (-869.480) -- 0:00:29
      493500 -- (-869.008) (-870.492) [-871.432] (-871.707) * (-870.734) (-873.500) [-872.887] (-869.295) -- 0:00:29
      494000 -- (-870.111) (-868.088) (-867.884) [-868.450] * (-870.303) (-871.714) (-876.731) [-869.369] -- 0:00:29
      494500 -- (-869.081) (-867.939) (-868.002) [-868.439] * [-872.429] (-870.062) (-874.634) (-868.894) -- 0:00:30
      495000 -- (-870.099) [-868.889] (-870.063) (-869.619) * (-872.163) (-871.066) [-869.588] (-873.355) -- 0:00:30

      Average standard deviation of split frequencies: 0.010391

      495500 -- [-868.640] (-872.580) (-869.580) (-869.878) * (-872.023) (-872.087) [-868.406] (-871.145) -- 0:00:30
      496000 -- (-870.431) (-869.943) [-868.718] (-868.713) * (-871.216) (-869.548) [-871.115] (-868.528) -- 0:00:30
      496500 -- (-869.610) (-868.015) (-870.763) [-868.336] * (-868.362) [-868.547] (-870.407) (-870.837) -- 0:00:30
      497000 -- [-868.595] (-871.212) (-873.094) (-873.296) * (-868.969) (-869.059) [-872.334] (-870.908) -- 0:00:30
      497500 -- (-870.435) (-867.941) (-870.774) [-868.313] * (-868.080) [-872.159] (-869.043) (-869.093) -- 0:00:30
      498000 -- (-868.390) [-869.679] (-870.215) (-868.938) * (-873.549) (-868.050) (-868.585) [-870.561] -- 0:00:30
      498500 -- (-868.781) (-873.634) [-869.736] (-871.014) * (-872.423) (-868.435) [-869.452] (-870.040) -- 0:00:30
      499000 -- (-871.053) (-879.412) (-869.833) [-869.791] * (-876.086) (-869.176) [-868.561] (-869.187) -- 0:00:30
      499500 -- (-871.634) (-870.826) (-870.231) [-869.221] * (-870.362) (-870.332) [-871.136] (-869.624) -- 0:00:30
      500000 -- (-869.168) (-870.338) (-872.785) [-868.519] * (-869.022) (-871.145) [-874.010] (-869.540) -- 0:00:30

      Average standard deviation of split frequencies: 0.010106

      500500 -- [-870.388] (-870.272) (-871.210) (-870.868) * (-869.714) [-868.359] (-869.666) (-868.192) -- 0:00:29
      501000 -- (-873.120) [-870.509] (-872.366) (-870.371) * (-871.000) (-870.899) [-869.542] (-868.679) -- 0:00:29
      501500 -- (-869.145) [-869.831] (-871.625) (-872.226) * (-871.609) [-871.276] (-875.542) (-868.317) -- 0:00:29
      502000 -- (-869.644) [-872.088] (-870.972) (-868.755) * [-868.261] (-870.700) (-872.506) (-869.511) -- 0:00:29
      502500 -- (-870.705) (-870.717) (-871.048) [-869.375] * (-870.372) (-868.219) [-870.499] (-871.332) -- 0:00:29
      503000 -- [-869.312] (-870.319) (-870.301) (-875.621) * (-870.921) [-869.688] (-868.563) (-869.215) -- 0:00:29
      503500 -- (-870.823) (-870.752) (-875.917) [-868.789] * (-869.936) (-868.618) (-868.573) [-870.194] -- 0:00:29
      504000 -- [-869.987] (-871.080) (-869.951) (-868.422) * (-867.931) (-872.002) [-869.653] (-871.239) -- 0:00:29
      504500 -- (-869.987) [-872.458] (-869.460) (-868.447) * (-869.658) (-870.134) [-868.937] (-869.595) -- 0:00:29
      505000 -- [-869.534] (-869.784) (-872.168) (-869.424) * [-869.252] (-871.096) (-871.670) (-870.242) -- 0:00:29

      Average standard deviation of split frequencies: 0.010364

      505500 -- (-870.366) [-867.667] (-871.568) (-869.404) * [-869.561] (-871.303) (-874.904) (-870.707) -- 0:00:29
      506000 -- (-870.529) [-872.771] (-869.992) (-869.265) * (-870.033) (-869.301) (-869.439) [-868.405] -- 0:00:29
      506500 -- [-873.021] (-871.753) (-869.883) (-872.481) * (-870.698) [-868.750] (-869.063) (-868.944) -- 0:00:29
      507000 -- (-871.159) [-870.926] (-873.135) (-870.166) * (-871.234) [-869.559] (-870.329) (-869.928) -- 0:00:29
      507500 -- (-876.684) (-870.203) (-870.525) [-872.713] * [-868.323] (-874.326) (-872.049) (-869.554) -- 0:00:29
      508000 -- (-870.077) (-871.888) [-870.934] (-870.155) * [-868.334] (-871.565) (-868.097) (-870.482) -- 0:00:29
      508500 -- (-871.331) (-872.842) (-869.701) [-871.501] * (-870.649) [-870.778] (-872.082) (-868.903) -- 0:00:28
      509000 -- (-869.040) (-876.977) (-868.907) [-870.656] * (-872.801) [-872.462] (-869.057) (-874.636) -- 0:00:28
      509500 -- (-871.156) (-869.040) (-871.025) [-868.882] * [-869.841] (-869.353) (-870.675) (-873.483) -- 0:00:28
      510000 -- (-870.342) [-870.619] (-872.498) (-868.816) * (-868.367) (-873.847) [-873.226] (-869.555) -- 0:00:28

      Average standard deviation of split frequencies: 0.010647

      510500 -- (-869.919) (-875.279) (-875.255) [-870.270] * [-868.792] (-869.874) (-870.593) (-876.126) -- 0:00:28
      511000 -- [-870.395] (-872.673) (-873.817) (-873.658) * [-870.922] (-869.964) (-873.677) (-869.254) -- 0:00:29
      511500 -- [-869.521] (-871.029) (-870.975) (-869.430) * (-870.563) (-873.693) (-873.941) [-872.129] -- 0:00:29
      512000 -- (-870.515) (-874.235) [-871.806] (-872.207) * [-871.707] (-874.549) (-869.533) (-869.514) -- 0:00:29
      512500 -- [-870.528] (-872.562) (-870.370) (-871.755) * [-869.680] (-871.273) (-871.582) (-870.837) -- 0:00:29
      513000 -- (-869.801) (-867.888) [-870.192] (-869.627) * (-867.933) (-868.188) (-871.727) [-869.828] -- 0:00:29
      513500 -- (-870.112) (-869.961) (-869.301) [-869.713] * (-868.375) (-868.197) [-869.088] (-872.596) -- 0:00:29
      514000 -- (-868.406) (-869.628) (-869.772) [-869.773] * [-868.886] (-869.409) (-871.151) (-874.752) -- 0:00:29
      514500 -- (-869.554) [-869.762] (-869.843) (-870.272) * (-869.764) [-870.520] (-870.530) (-877.458) -- 0:00:29
      515000 -- [-869.770] (-870.677) (-869.182) (-875.807) * (-871.825) [-872.435] (-869.712) (-872.774) -- 0:00:29

      Average standard deviation of split frequencies: 0.009867

      515500 -- [-868.597] (-869.115) (-870.242) (-870.081) * (-869.492) (-872.691) (-871.043) [-871.067] -- 0:00:29
      516000 -- (-870.383) (-869.619) (-870.529) [-871.164] * (-868.829) (-878.397) (-872.266) [-871.580] -- 0:00:29
      516500 -- [-870.288] (-870.035) (-868.647) (-870.831) * (-869.797) [-868.228] (-872.755) (-868.217) -- 0:00:29
      517000 -- [-871.003] (-873.949) (-868.565) (-872.880) * (-870.288) (-869.153) [-869.858] (-868.072) -- 0:00:28
      517500 -- (-872.088) (-871.453) [-869.125] (-870.350) * (-874.086) [-871.250] (-870.096) (-870.376) -- 0:00:28
      518000 -- (-869.753) (-869.119) [-868.871] (-870.857) * [-868.456] (-868.390) (-869.646) (-868.374) -- 0:00:28
      518500 -- (-868.384) (-870.018) (-870.248) [-868.988] * (-871.636) (-868.729) [-869.661] (-869.508) -- 0:00:28
      519000 -- (-870.536) (-869.929) (-871.400) [-873.245] * (-872.599) [-869.203] (-870.729) (-872.618) -- 0:00:28
      519500 -- (-869.211) [-869.633] (-868.384) (-870.633) * (-869.062) [-868.783] (-872.061) (-872.241) -- 0:00:28
      520000 -- [-870.234] (-868.656) (-869.454) (-868.158) * (-868.678) (-869.516) [-872.049] (-871.873) -- 0:00:28

      Average standard deviation of split frequencies: 0.010080

      520500 -- [-868.511] (-868.720) (-868.545) (-870.300) * [-870.592] (-869.470) (-870.418) (-868.867) -- 0:00:28
      521000 -- (-872.429) (-871.669) [-868.475] (-869.913) * (-872.123) [-869.383] (-870.381) (-871.430) -- 0:00:28
      521500 -- (-871.616) (-868.593) (-872.510) [-870.010] * (-876.291) (-870.918) [-875.139] (-868.836) -- 0:00:28
      522000 -- (-870.046) [-869.870] (-869.595) (-871.317) * (-870.496) [-868.808] (-872.328) (-872.499) -- 0:00:28
      522500 -- (-870.320) (-869.878) (-870.199) [-868.874] * [-872.417] (-868.220) (-872.089) (-871.983) -- 0:00:28
      523000 -- (-872.291) [-870.126] (-873.925) (-869.258) * (-867.806) (-870.734) (-868.488) [-869.125] -- 0:00:28
      523500 -- (-868.038) [-869.264] (-871.740) (-867.877) * (-868.499) (-868.425) [-869.447] (-869.620) -- 0:00:28
      524000 -- (-868.622) (-869.493) (-869.699) [-870.152] * [-869.589] (-868.262) (-869.436) (-870.610) -- 0:00:28
      524500 -- (-871.048) (-870.718) (-871.147) [-868.248] * (-869.781) [-871.875] (-873.273) (-870.956) -- 0:00:28
      525000 -- [-873.600] (-871.240) (-872.978) (-869.012) * (-869.129) (-873.142) [-871.744] (-870.621) -- 0:00:28

      Average standard deviation of split frequencies: 0.009679

      525500 -- [-873.400] (-868.600) (-876.082) (-869.713) * [-869.006] (-870.028) (-870.593) (-872.173) -- 0:00:27
      526000 -- [-872.452] (-870.497) (-871.337) (-868.979) * (-869.604) (-874.313) (-870.515) [-870.505] -- 0:00:27
      526500 -- (-872.174) (-868.336) [-872.327] (-871.444) * (-869.952) (-871.872) [-870.302] (-868.797) -- 0:00:27
      527000 -- [-874.906] (-870.963) (-869.627) (-869.880) * (-870.357) [-872.292] (-872.858) (-874.063) -- 0:00:27
      527500 -- [-868.554] (-871.391) (-869.408) (-868.332) * (-870.457) (-868.130) [-868.195] (-875.082) -- 0:00:27
      528000 -- [-868.349] (-870.148) (-871.173) (-870.430) * (-872.865) [-871.746] (-868.432) (-871.837) -- 0:00:28
      528500 -- (-871.240) (-868.873) (-873.154) [-868.290] * (-870.951) [-868.890] (-868.631) (-871.270) -- 0:00:28
      529000 -- (-869.250) (-870.366) (-869.753) [-868.430] * (-868.034) [-870.425] (-874.331) (-871.201) -- 0:00:28
      529500 -- [-871.348] (-870.090) (-868.237) (-869.088) * (-869.580) (-872.125) [-870.542] (-869.842) -- 0:00:28
      530000 -- [-870.433] (-872.223) (-870.678) (-868.300) * (-869.957) (-868.647) [-870.123] (-870.492) -- 0:00:28

      Average standard deviation of split frequencies: 0.009831

      530500 -- (-869.943) [-870.672] (-871.262) (-868.709) * (-869.623) [-872.889] (-869.153) (-870.156) -- 0:00:28
      531000 -- (-870.957) (-868.953) (-869.315) [-871.341] * (-872.516) [-868.874] (-871.511) (-869.817) -- 0:00:28
      531500 -- (-870.596) [-869.651] (-868.577) (-868.140) * (-870.027) [-870.328] (-870.973) (-868.808) -- 0:00:28
      532000 -- [-869.183] (-871.204) (-868.466) (-870.474) * [-868.698] (-869.964) (-869.350) (-870.179) -- 0:00:28
      532500 -- (-872.157) (-873.903) (-871.208) [-868.893] * (-871.635) (-869.696) [-869.154] (-868.507) -- 0:00:28
      533000 -- [-871.595] (-869.937) (-868.723) (-868.766) * (-874.733) (-868.338) (-869.032) [-870.145] -- 0:00:28
      533500 -- [-871.030] (-872.031) (-868.106) (-868.473) * (-871.049) [-868.794] (-869.838) (-868.536) -- 0:00:27
      534000 -- [-869.769] (-870.150) (-870.230) (-873.660) * (-869.857) (-869.019) [-871.753] (-870.406) -- 0:00:27
      534500 -- (-868.940) (-869.348) [-868.876] (-869.625) * [-868.578] (-869.093) (-869.942) (-870.035) -- 0:00:27
      535000 -- [-868.047] (-871.066) (-868.375) (-867.998) * (-868.490) (-870.192) (-869.281) [-869.502] -- 0:00:27

      Average standard deviation of split frequencies: 0.009909

      535500 -- [-870.632] (-870.926) (-869.349) (-871.102) * (-869.394) (-870.279) [-867.843] (-869.024) -- 0:00:27
      536000 -- (-871.075) (-870.459) [-873.846] (-870.096) * (-869.807) (-870.732) [-868.865] (-867.920) -- 0:00:27
      536500 -- (-871.810) (-869.579) (-873.054) [-868.284] * (-868.730) (-869.438) (-870.224) [-868.332] -- 0:00:27
      537000 -- (-870.885) [-871.305] (-868.902) (-869.705) * (-868.810) (-871.812) (-868.236) [-871.508] -- 0:00:27
      537500 -- (-869.602) (-869.516) [-870.247] (-869.800) * (-869.338) (-870.907) (-869.098) [-871.037] -- 0:00:27
      538000 -- [-869.540] (-872.961) (-868.671) (-869.241) * [-869.528] (-873.510) (-869.749) (-870.514) -- 0:00:27
      538500 -- (-872.412) [-871.129] (-869.473) (-869.882) * (-869.839) (-870.813) (-868.953) [-870.015] -- 0:00:27
      539000 -- [-875.042] (-869.765) (-871.330) (-868.885) * (-869.303) (-874.290) [-871.284] (-871.698) -- 0:00:27
      539500 -- (-870.738) (-873.574) [-870.717] (-870.696) * (-868.211) (-872.108) [-871.028] (-874.654) -- 0:00:27
      540000 -- [-869.731] (-868.832) (-872.960) (-871.895) * [-868.193] (-869.295) (-869.867) (-874.672) -- 0:00:27

      Average standard deviation of split frequencies: 0.009707

      540500 -- (-869.486) (-870.177) [-870.805] (-870.427) * (-872.162) (-870.031) [-871.688] (-869.051) -- 0:00:27
      541000 -- (-869.834) [-875.663] (-873.661) (-869.298) * (-871.509) [-869.238] (-868.075) (-870.006) -- 0:00:27
      541500 -- (-869.875) (-875.641) (-869.903) [-870.284] * [-869.001] (-869.689) (-872.348) (-871.333) -- 0:00:27
      542000 -- (-871.099) (-870.138) (-871.368) [-870.611] * (-872.667) [-870.694] (-876.422) (-872.895) -- 0:00:27
      542500 -- (-870.065) [-872.066] (-868.748) (-868.253) * (-869.681) [-874.056] (-868.500) (-876.525) -- 0:00:26
      543000 -- (-871.809) (-874.718) [-870.265] (-873.177) * [-869.048] (-868.988) (-869.903) (-879.358) -- 0:00:26
      543500 -- (-871.982) (-872.002) [-870.069] (-869.988) * (-881.084) (-869.214) (-869.402) [-870.101] -- 0:00:26
      544000 -- (-871.030) (-869.399) (-869.858) [-868.275] * (-872.687) [-870.547] (-870.186) (-871.291) -- 0:00:26
      544500 -- (-870.629) (-869.008) (-869.889) [-869.204] * [-871.205] (-871.152) (-868.796) (-872.833) -- 0:00:27
      545000 -- (-875.606) [-869.057] (-870.369) (-869.406) * (-872.736) (-871.633) (-871.651) [-870.153] -- 0:00:27

      Average standard deviation of split frequencies: 0.009785

      545500 -- (-872.347) (-868.301) (-869.972) [-869.298] * (-872.041) (-871.123) [-869.333] (-869.249) -- 0:00:27
      546000 -- (-871.325) (-869.915) [-869.708] (-870.305) * (-874.649) (-872.963) (-869.449) [-869.452] -- 0:00:27
      546500 -- [-868.552] (-870.974) (-870.345) (-871.195) * (-872.758) [-869.984] (-869.026) (-868.244) -- 0:00:27
      547000 -- (-869.099) [-868.108] (-871.846) (-872.519) * [-869.816] (-870.116) (-869.826) (-870.042) -- 0:00:27
      547500 -- [-871.561] (-870.421) (-870.001) (-871.198) * (-869.023) (-872.932) [-871.408] (-869.964) -- 0:00:27
      548000 -- (-870.644) (-869.629) (-868.192) [-871.801] * (-868.630) (-870.472) (-868.951) [-869.360] -- 0:00:27
      548500 -- (-868.922) [-868.555] (-869.713) (-869.541) * (-870.249) [-869.732] (-869.097) (-870.866) -- 0:00:27
      549000 -- [-869.650] (-871.266) (-869.017) (-872.547) * (-870.952) (-871.916) (-868.960) [-868.837] -- 0:00:27
      549500 -- (-869.561) (-870.026) [-868.650] (-869.404) * [-871.381] (-868.717) (-870.057) (-868.718) -- 0:00:27
      550000 -- [-868.472] (-871.560) (-870.699) (-869.566) * (-870.907) (-868.831) (-873.373) [-869.260] -- 0:00:27

      Average standard deviation of split frequencies: 0.009873

      550500 -- (-868.110) (-871.119) [-868.770] (-871.882) * [-868.737] (-870.886) (-868.868) (-870.020) -- 0:00:26
      551000 -- [-869.347] (-870.722) (-868.798) (-873.014) * [-868.723] (-869.110) (-871.781) (-869.036) -- 0:00:26
      551500 -- (-873.930) (-869.870) [-870.402] (-869.612) * (-871.711) (-869.362) [-868.526] (-871.953) -- 0:00:26
      552000 -- (-875.165) (-869.253) (-873.402) [-868.864] * [-873.667] (-876.088) (-869.436) (-870.588) -- 0:00:26
      552500 -- (-872.881) [-868.167] (-870.527) (-869.728) * (-872.750) (-874.844) [-871.755] (-868.564) -- 0:00:26
      553000 -- (-870.593) (-871.024) (-868.345) [-868.138] * (-871.318) [-869.747] (-869.708) (-869.171) -- 0:00:26
      553500 -- [-871.078] (-870.976) (-868.802) (-870.056) * (-872.608) (-869.900) [-868.957] (-872.830) -- 0:00:26
      554000 -- [-872.308] (-871.234) (-870.934) (-869.074) * (-868.953) (-868.853) (-869.968) [-872.941] -- 0:00:26
      554500 -- (-869.768) (-874.148) (-868.644) [-869.247] * (-869.182) (-869.617) [-872.050] (-870.934) -- 0:00:26
      555000 -- (-870.527) [-874.441] (-871.580) (-871.353) * (-871.273) (-870.203) [-869.592] (-870.396) -- 0:00:26

      Average standard deviation of split frequencies: 0.009779

      555500 -- (-872.570) [-868.005] (-872.205) (-872.047) * (-872.229) (-871.684) (-869.407) [-868.607] -- 0:00:26
      556000 -- [-870.024] (-871.298) (-871.162) (-871.085) * (-870.212) [-870.700] (-870.470) (-870.890) -- 0:00:26
      556500 -- (-869.623) (-872.773) [-870.277] (-868.796) * (-868.662) (-868.473) (-874.513) [-870.817] -- 0:00:26
      557000 -- [-869.586] (-872.187) (-871.303) (-868.907) * (-868.565) [-870.413] (-872.613) (-874.542) -- 0:00:26
      557500 -- [-868.843] (-868.968) (-871.622) (-869.502) * (-869.000) (-873.095) (-871.461) [-868.605] -- 0:00:26
      558000 -- (-870.081) [-869.227] (-868.372) (-870.083) * [-869.105] (-879.950) (-868.890) (-873.564) -- 0:00:26
      558500 -- (-869.385) (-869.270) (-872.037) [-868.961] * [-869.482] (-871.147) (-868.191) (-870.522) -- 0:00:26
      559000 -- (-869.375) (-869.215) [-872.098] (-871.003) * (-870.524) (-869.756) (-869.182) [-869.797] -- 0:00:26
      559500 -- (-869.466) (-872.436) (-871.071) [-871.055] * [-869.568] (-869.629) (-868.748) (-870.209) -- 0:00:25
      560000 -- [-867.952] (-869.141) (-874.979) (-874.961) * (-869.142) [-868.417] (-868.619) (-869.727) -- 0:00:25

      Average standard deviation of split frequencies: 0.009249

      560500 -- (-868.012) (-868.787) (-870.434) [-876.087] * [-869.732] (-872.259) (-871.908) (-871.266) -- 0:00:25
      561000 -- (-868.022) (-868.661) [-868.625] (-871.042) * (-870.535) [-871.021] (-873.446) (-871.219) -- 0:00:26
      561500 -- (-868.677) (-870.880) (-868.301) [-870.523] * (-876.323) (-869.728) [-868.532] (-869.295) -- 0:00:26
      562000 -- [-869.843] (-869.553) (-872.593) (-872.872) * (-872.002) (-869.440) (-868.467) [-870.335] -- 0:00:26
      562500 -- [-871.577] (-871.316) (-873.897) (-870.313) * [-869.150] (-869.164) (-868.833) (-870.136) -- 0:00:26
      563000 -- (-872.741) (-870.262) (-870.224) [-871.340] * [-868.453] (-871.347) (-869.812) (-871.600) -- 0:00:26
      563500 -- [-871.582] (-876.546) (-871.699) (-871.303) * (-868.937) (-869.919) [-868.509] (-869.922) -- 0:00:26
      564000 -- [-869.581] (-871.532) (-870.689) (-869.736) * (-868.891) (-868.953) [-869.561] (-874.548) -- 0:00:26
      564500 -- [-869.225] (-868.333) (-869.084) (-869.689) * (-870.662) (-869.424) [-868.640] (-869.042) -- 0:00:26
      565000 -- [-872.573] (-869.786) (-869.924) (-869.056) * [-868.667] (-870.028) (-871.094) (-870.314) -- 0:00:26

      Average standard deviation of split frequencies: 0.008901

      565500 -- [-871.603] (-870.395) (-870.625) (-872.436) * (-869.183) (-868.065) (-870.368) [-872.831] -- 0:00:26
      566000 -- (-871.999) (-872.023) (-868.604) [-869.014] * (-876.648) [-868.818] (-874.107) (-868.744) -- 0:00:26
      566500 -- (-868.871) (-869.043) [-868.733] (-874.884) * (-870.098) (-869.692) [-868.918] (-869.897) -- 0:00:26
      567000 -- (-873.767) [-869.451] (-867.787) (-871.161) * (-871.413) (-869.156) [-868.504] (-868.782) -- 0:00:25
      567500 -- (-870.700) [-869.790] (-869.908) (-869.249) * (-870.999) (-868.855) [-871.897] (-868.016) -- 0:00:25
      568000 -- (-871.512) (-869.160) (-870.619) [-868.921] * (-871.222) (-869.722) [-872.341] (-868.158) -- 0:00:25
      568500 -- (-867.757) [-869.456] (-872.520) (-868.993) * [-870.018] (-868.663) (-871.357) (-869.111) -- 0:00:25
      569000 -- [-868.832] (-869.130) (-871.568) (-869.639) * (-875.398) (-869.493) [-868.740] (-868.690) -- 0:00:25
      569500 -- (-869.220) (-870.997) (-869.518) [-870.333] * (-875.827) [-870.100] (-869.899) (-869.398) -- 0:00:25
      570000 -- (-871.754) [-868.838] (-869.282) (-868.346) * (-875.261) (-873.584) (-871.022) [-868.922] -- 0:00:25

      Average standard deviation of split frequencies: 0.008880

      570500 -- (-870.334) (-869.993) [-869.370] (-870.439) * (-870.208) [-869.212] (-868.510) (-869.319) -- 0:00:25
      571000 -- (-871.425) (-867.870) (-867.765) [-868.425] * (-870.000) (-868.968) (-870.227) [-868.026] -- 0:00:25
      571500 -- (-871.549) (-870.999) (-869.439) [-870.799] * [-871.907] (-870.181) (-873.566) (-868.692) -- 0:00:25
      572000 -- (-870.129) (-871.186) (-873.886) [-869.022] * (-874.161) (-870.451) [-869.528] (-869.528) -- 0:00:25
      572500 -- (-872.503) [-870.240] (-871.278) (-871.042) * (-868.846) (-870.853) (-868.622) [-871.508] -- 0:00:25
      573000 -- [-874.659] (-871.954) (-872.442) (-869.236) * [-871.317] (-871.537) (-871.422) (-877.759) -- 0:00:25
      573500 -- (-874.234) [-869.628] (-874.790) (-870.722) * [-872.561] (-869.824) (-868.450) (-872.966) -- 0:00:25
      574000 -- (-869.631) [-870.012] (-872.689) (-867.836) * (-871.103) [-869.638] (-869.616) (-872.077) -- 0:00:25
      574500 -- [-868.974] (-869.235) (-870.497) (-869.954) * (-870.426) (-873.164) (-871.266) [-868.465] -- 0:00:25
      575000 -- (-868.236) (-868.000) [-872.904] (-870.598) * (-869.874) (-872.432) (-870.764) [-869.278] -- 0:00:25

      Average standard deviation of split frequencies: 0.008696

      575500 -- [-870.902] (-869.851) (-869.810) (-867.986) * [-869.793] (-874.428) (-871.202) (-869.348) -- 0:00:25
      576000 -- (-870.493) (-869.858) (-869.111) [-868.050] * (-869.839) (-870.844) (-870.542) [-870.994] -- 0:00:25
      576500 -- (-871.514) (-868.901) [-868.471] (-870.044) * (-870.297) [-870.990] (-870.452) (-872.910) -- 0:00:24
      577000 -- (-868.813) (-869.903) (-870.677) [-869.080] * [-869.823] (-871.132) (-869.331) (-869.258) -- 0:00:24
      577500 -- (-871.009) (-871.351) (-870.105) [-869.058] * (-869.571) (-874.733) [-868.746] (-874.617) -- 0:00:25
      578000 -- (-868.549) (-873.988) [-870.296] (-870.085) * [-869.379] (-869.189) (-869.057) (-868.289) -- 0:00:25
      578500 -- [-868.888] (-870.285) (-869.202) (-868.404) * (-869.442) [-869.589] (-870.965) (-870.188) -- 0:00:25
      579000 -- (-872.617) (-871.906) (-870.938) [-875.275] * (-867.788) [-868.147] (-870.698) (-871.211) -- 0:00:25
      579500 -- (-871.260) (-872.365) [-872.313] (-869.994) * (-867.985) (-869.770) [-868.721] (-868.897) -- 0:00:25
      580000 -- (-868.821) (-869.508) (-868.616) [-868.147] * (-867.986) [-870.966] (-869.172) (-871.271) -- 0:00:25

      Average standard deviation of split frequencies: 0.008676

      580500 -- (-870.656) (-868.625) (-871.284) [-868.615] * (-871.130) (-871.257) [-867.670] (-872.620) -- 0:00:25
      581000 -- (-869.658) (-869.635) (-868.753) [-868.756] * [-870.609] (-873.073) (-867.670) (-869.711) -- 0:00:25
      581500 -- [-869.967] (-868.906) (-870.141) (-869.501) * [-871.002] (-868.553) (-870.206) (-868.334) -- 0:00:25
      582000 -- (-870.826) [-868.133] (-870.362) (-869.490) * (-871.587) [-868.372] (-869.313) (-870.934) -- 0:00:25
      582500 -- (-870.973) (-868.757) (-874.748) [-868.234] * [-870.843] (-870.625) (-871.917) (-870.526) -- 0:00:25
      583000 -- (-871.758) (-872.430) [-871.519] (-868.266) * [-870.490] (-870.663) (-869.945) (-870.391) -- 0:00:25
      583500 -- (-872.925) (-871.212) [-876.414] (-868.182) * [-873.029] (-868.159) (-869.052) (-869.288) -- 0:00:24
      584000 -- [-874.754] (-874.103) (-870.066) (-868.703) * (-871.617) (-869.592) [-870.760] (-870.243) -- 0:00:24
      584500 -- [-869.890] (-869.160) (-868.744) (-870.267) * (-869.793) (-871.639) (-870.053) [-869.914] -- 0:00:24
      585000 -- [-873.548] (-869.679) (-869.088) (-868.415) * [-868.959] (-868.853) (-868.918) (-874.035) -- 0:00:24

      Average standard deviation of split frequencies: 0.008598

      585500 -- (-870.535) (-869.478) (-869.576) [-871.619] * (-869.768) [-870.463] (-868.995) (-868.705) -- 0:00:24
      586000 -- (-870.414) (-869.623) [-870.059] (-870.202) * [-868.778] (-870.348) (-870.044) (-869.469) -- 0:00:24
      586500 -- (-869.829) [-868.633] (-868.278) (-870.044) * [-869.125] (-870.205) (-872.279) (-869.914) -- 0:00:24
      587000 -- (-875.745) (-871.268) (-871.378) [-868.240] * (-872.275) (-873.298) (-873.279) [-868.499] -- 0:00:24
      587500 -- (-868.798) (-869.852) [-868.612] (-869.305) * (-869.675) [-873.341] (-871.888) (-870.500) -- 0:00:24
      588000 -- (-868.854) [-870.865] (-870.236) (-871.082) * [-868.484] (-873.055) (-869.877) (-867.977) -- 0:00:24
      588500 -- [-869.655] (-868.398) (-871.276) (-870.816) * (-869.878) (-871.519) [-869.073] (-872.645) -- 0:00:24
      589000 -- (-868.436) (-869.920) (-868.191) [-871.306] * (-877.646) (-872.905) [-869.531] (-869.931) -- 0:00:24
      589500 -- (-871.051) (-868.931) (-870.570) [-869.120] * [-871.351] (-870.872) (-869.574) (-871.045) -- 0:00:24
      590000 -- (-875.010) (-869.976) [-869.707] (-868.849) * (-872.547) [-870.174] (-870.853) (-870.778) -- 0:00:24

      Average standard deviation of split frequencies: 0.008779

      590500 -- [-870.429] (-876.030) (-868.491) (-869.998) * (-872.611) [-869.179] (-870.997) (-870.108) -- 0:00:24
      591000 -- (-871.804) (-871.561) (-868.498) [-870.678] * (-869.493) (-873.650) [-869.072] (-871.412) -- 0:00:24
      591500 -- (-869.310) (-869.341) (-868.609) [-873.332] * [-868.124] (-869.385) (-870.164) (-869.790) -- 0:00:24
      592000 -- [-869.123] (-869.558) (-870.813) (-871.212) * [-868.311] (-869.782) (-871.399) (-870.025) -- 0:00:24
      592500 -- [-868.979] (-869.748) (-869.152) (-870.567) * (-868.286) [-868.764] (-869.387) (-869.476) -- 0:00:24
      593000 -- [-869.739] (-868.801) (-872.471) (-875.686) * [-869.681] (-870.623) (-869.998) (-868.458) -- 0:00:24
      593500 -- [-872.394] (-872.509) (-870.573) (-871.906) * (-871.880) [-870.696] (-868.979) (-868.719) -- 0:00:23
      594000 -- [-869.797] (-870.500) (-870.822) (-869.725) * (-868.938) (-871.204) [-868.625] (-870.120) -- 0:00:23
      594500 -- (-868.581) (-869.619) (-869.539) [-870.030] * [-869.427] (-871.467) (-868.610) (-871.168) -- 0:00:24
      595000 -- [-868.472] (-869.743) (-873.766) (-871.762) * (-871.700) [-870.639] (-869.426) (-868.506) -- 0:00:24

      Average standard deviation of split frequencies: 0.008602

      595500 -- (-870.834) [-869.424] (-871.239) (-868.318) * [-871.038] (-869.563) (-869.042) (-869.001) -- 0:00:24
      596000 -- (-870.567) [-872.969] (-868.142) (-870.114) * (-869.472) (-870.614) (-869.220) [-872.344] -- 0:00:24
      596500 -- (-869.966) [-871.669] (-870.300) (-869.719) * (-868.875) (-871.535) [-869.735] (-869.422) -- 0:00:24
      597000 -- (-870.122) (-871.278) [-870.284] (-870.234) * (-869.751) [-869.810] (-870.482) (-870.596) -- 0:00:24
      597500 -- (-869.632) [-870.384] (-871.603) (-873.561) * (-870.456) (-869.966) [-868.340] (-871.537) -- 0:00:24
      598000 -- (-869.932) (-870.604) [-873.502] (-874.496) * [-870.560] (-869.751) (-869.934) (-869.422) -- 0:00:24
      598500 -- (-869.474) (-868.260) [-872.438] (-870.313) * (-868.892) (-872.017) [-868.721] (-870.906) -- 0:00:24
      599000 -- (-868.283) [-868.256] (-874.516) (-869.842) * (-868.103) (-869.011) [-871.289] (-869.457) -- 0:00:24
      599500 -- (-871.513) (-869.082) (-869.435) [-870.592] * (-870.371) (-869.457) [-868.864] (-868.380) -- 0:00:24
      600000 -- (-871.101) (-868.169) [-869.306] (-868.193) * (-870.739) (-870.151) [-869.516] (-869.035) -- 0:00:24

      Average standard deviation of split frequencies: 0.008424

      600500 -- (-873.060) (-871.591) (-872.681) [-868.617] * (-870.160) (-868.461) (-870.673) [-870.168] -- 0:00:23
      601000 -- (-871.470) [-870.289] (-870.077) (-868.320) * (-871.782) (-871.193) (-874.364) [-868.729] -- 0:00:23
      601500 -- (-874.348) (-870.622) (-870.506) [-869.040] * (-868.733) (-869.158) [-870.697] (-869.530) -- 0:00:23
      602000 -- (-868.393) [-869.083] (-868.533) (-870.751) * [-869.002] (-870.777) (-870.043) (-872.237) -- 0:00:23
      602500 -- (-871.386) (-868.953) (-868.570) [-869.846] * [-877.085] (-869.886) (-872.848) (-870.816) -- 0:00:23
      603000 -- (-873.509) (-869.487) [-869.747] (-869.785) * (-869.878) (-870.587) (-876.613) [-874.748] -- 0:00:23
      603500 -- [-872.146] (-869.140) (-868.871) (-871.024) * (-869.974) (-871.749) [-868.246] (-870.990) -- 0:00:23
      604000 -- (-869.193) (-868.940) [-868.984] (-870.758) * (-870.126) (-870.889) [-868.707] (-871.751) -- 0:00:23
      604500 -- (-869.412) (-869.444) [-868.767] (-868.923) * [-868.875] (-873.488) (-871.863) (-872.449) -- 0:00:23
      605000 -- (-869.470) [-871.862] (-869.304) (-868.900) * [-868.468] (-870.604) (-869.924) (-870.434) -- 0:00:23

      Average standard deviation of split frequencies: 0.008090

      605500 -- (-870.884) (-873.959) [-868.350] (-872.262) * (-869.888) (-869.373) [-870.703] (-873.261) -- 0:00:23
      606000 -- (-869.940) (-869.510) [-869.357] (-873.557) * (-870.400) (-867.819) [-872.217] (-872.662) -- 0:00:23
      606500 -- (-871.202) (-868.058) [-868.579] (-869.328) * (-869.670) (-870.553) (-868.997) [-869.524] -- 0:00:23
      607000 -- [-869.469] (-870.062) (-868.696) (-868.934) * (-872.189) (-869.052) [-868.850] (-872.102) -- 0:00:23
      607500 -- [-870.064] (-872.182) (-874.262) (-868.823) * (-870.693) (-871.224) (-871.409) [-867.992] -- 0:00:23
      608000 -- (-868.934) (-875.775) [-869.268] (-874.349) * (-869.246) [-871.824] (-869.691) (-868.761) -- 0:00:23
      608500 -- [-871.116] (-869.535) (-870.869) (-870.984) * (-868.669) (-871.024) (-868.973) [-869.650] -- 0:00:23
      609000 -- (-872.191) [-870.146] (-871.590) (-869.206) * (-871.749) (-869.197) (-871.614) [-869.542] -- 0:00:23
      609500 -- (-868.544) (-872.675) [-870.089] (-868.851) * (-871.954) (-874.523) (-872.069) [-869.983] -- 0:00:23
      610000 -- (-870.083) (-869.456) [-872.970] (-872.836) * (-868.619) [-870.843] (-868.480) (-871.413) -- 0:00:23

      Average standard deviation of split frequencies: 0.008080

      610500 -- (-867.841) [-870.924] (-871.444) (-871.114) * (-869.945) (-869.691) (-869.412) [-868.540] -- 0:00:23
      611000 -- (-868.271) (-873.544) (-869.596) [-873.864] * (-871.577) (-870.711) (-870.413) [-868.088] -- 0:00:23
      611500 -- (-872.908) (-872.754) [-869.298] (-871.187) * (-868.338) (-869.832) [-869.836] (-870.459) -- 0:00:23
      612000 -- (-873.573) (-872.940) (-869.065) [-870.031] * [-870.317] (-869.574) (-871.953) (-869.112) -- 0:00:23
      612500 -- (-869.289) (-875.217) [-870.437] (-869.502) * (-873.192) (-871.084) (-868.072) [-870.084] -- 0:00:23
      613000 -- [-868.003] (-867.892) (-874.738) (-871.381) * (-869.730) (-874.027) (-871.142) [-870.085] -- 0:00:23
      613500 -- (-870.931) (-868.614) (-874.897) [-870.267] * (-869.300) [-873.433] (-872.992) (-873.373) -- 0:00:23
      614000 -- (-871.239) [-868.777] (-868.567) (-869.538) * (-871.388) (-870.785) [-871.003] (-873.016) -- 0:00:23
      614500 -- (-869.648) (-868.176) (-868.512) [-871.020] * (-871.588) (-868.391) [-870.515] (-874.080) -- 0:00:23
      615000 -- (-868.908) (-873.692) (-869.553) [-871.367] * (-869.236) (-868.530) [-869.287] (-870.001) -- 0:00:23

      Average standard deviation of split frequencies: 0.008010

      615500 -- (-868.897) (-876.199) (-871.223) [-868.439] * (-870.417) (-870.017) (-871.040) [-870.453] -- 0:00:23
      616000 -- (-872.819) (-868.601) [-870.204] (-869.921) * [-871.385] (-869.312) (-868.124) (-869.124) -- 0:00:23
      616500 -- [-870.050] (-870.880) (-870.205) (-871.431) * [-870.757] (-872.898) (-867.930) (-871.798) -- 0:00:23
      617000 -- (-871.006) (-871.978) [-871.040] (-870.285) * (-870.799) [-869.468] (-868.170) (-871.420) -- 0:00:22
      617500 -- (-870.731) (-869.251) (-868.712) [-870.203] * (-869.614) [-870.309] (-868.442) (-869.376) -- 0:00:22
      618000 -- (-871.613) (-870.610) (-872.066) [-871.487] * (-874.306) (-869.254) (-868.267) [-868.965] -- 0:00:22
      618500 -- (-871.806) (-869.560) [-872.450] (-870.989) * (-871.616) (-870.605) [-871.251] (-870.413) -- 0:00:22
      619000 -- (-869.937) (-869.805) (-869.571) [-874.109] * (-868.518) (-871.622) [-869.292] (-870.678) -- 0:00:22
      619500 -- (-876.733) [-871.258] (-868.686) (-868.605) * (-874.389) (-875.582) [-868.518] (-870.767) -- 0:00:22
      620000 -- [-872.421] (-869.220) (-868.711) (-870.365) * (-870.028) (-873.264) [-869.369] (-869.731) -- 0:00:22

      Average standard deviation of split frequencies: 0.008253

      620500 -- (-870.656) (-873.101) (-868.645) [-870.111] * (-870.778) [-871.728] (-872.305) (-870.680) -- 0:00:22
      621000 -- (-870.892) [-869.235] (-868.829) (-870.726) * (-872.709) (-871.372) [-868.750] (-870.159) -- 0:00:22
      621500 -- (-872.351) (-869.000) (-869.287) [-871.592] * (-875.403) (-872.912) [-868.059] (-870.691) -- 0:00:22
      622000 -- (-869.000) (-869.644) [-869.374] (-871.793) * (-868.192) (-870.470) [-868.527] (-873.080) -- 0:00:22
      622500 -- (-870.960) [-873.550] (-870.353) (-871.928) * (-868.933) (-875.283) [-868.739] (-870.806) -- 0:00:22
      623000 -- (-869.797) (-870.439) (-868.896) [-871.666] * (-869.647) (-868.774) [-869.176] (-871.394) -- 0:00:22
      623500 -- (-869.485) (-869.540) (-868.504) [-872.132] * [-870.693] (-874.424) (-873.565) (-873.399) -- 0:00:22
      624000 -- (-868.612) (-874.361) (-869.965) [-869.153] * (-876.013) (-871.500) [-874.264] (-872.331) -- 0:00:22
      624500 -- (-868.881) (-871.826) [-868.467] (-869.160) * (-874.673) [-872.455] (-872.538) (-870.888) -- 0:00:22
      625000 -- (-869.670) (-871.725) (-869.806) [-869.666] * (-871.207) (-870.427) [-868.989] (-869.360) -- 0:00:22

      Average standard deviation of split frequencies: 0.008534

      625500 -- [-868.494] (-871.328) (-870.072) (-869.949) * [-871.342] (-869.801) (-869.294) (-872.548) -- 0:00:22
      626000 -- (-872.887) (-871.184) [-872.465] (-872.726) * (-869.760) (-871.006) (-869.971) [-872.249] -- 0:00:22
      626500 -- [-872.708] (-869.384) (-869.787) (-870.755) * [-869.377] (-872.425) (-869.762) (-869.731) -- 0:00:22
      627000 -- [-872.831] (-871.724) (-867.985) (-870.373) * (-869.621) (-868.007) (-869.006) [-870.227] -- 0:00:22
      627500 -- (-872.277) [-877.256] (-867.951) (-872.550) * [-873.950] (-871.304) (-868.871) (-873.060) -- 0:00:22
      628000 -- (-869.434) (-869.343) [-869.678] (-873.695) * (-869.368) (-869.502) [-869.593] (-873.708) -- 0:00:22
      628500 -- (-868.520) [-870.796] (-874.309) (-869.146) * (-869.050) [-869.975] (-869.510) (-872.429) -- 0:00:22
      629000 -- (-869.233) [-869.903] (-870.379) (-871.264) * (-870.246) [-870.362] (-868.408) (-871.869) -- 0:00:22
      629500 -- [-872.757] (-869.692) (-871.043) (-873.461) * (-871.424) (-871.672) [-869.577] (-870.368) -- 0:00:22
      630000 -- [-873.864] (-873.728) (-869.945) (-868.730) * (-869.150) (-874.722) [-874.323] (-871.596) -- 0:00:22

      Average standard deviation of split frequencies: 0.008720

      630500 -- [-868.619] (-874.616) (-870.869) (-868.808) * (-871.850) (-871.701) [-873.395] (-874.159) -- 0:00:22
      631000 -- (-868.873) (-872.842) [-868.894] (-868.808) * (-872.676) (-871.637) [-868.927] (-871.076) -- 0:00:22
      631500 -- (-869.926) [-870.661] (-868.167) (-870.022) * (-872.819) [-870.639] (-870.159) (-868.320) -- 0:00:22
      632000 -- (-869.820) (-868.786) [-871.678] (-874.548) * (-868.944) [-869.351] (-869.769) (-868.714) -- 0:00:22
      632500 -- (-871.864) [-873.291] (-870.379) (-870.115) * (-871.601) [-869.694] (-872.289) (-868.369) -- 0:00:22
      633000 -- (-871.376) [-869.007] (-868.486) (-870.544) * (-870.012) (-872.634) [-869.255] (-870.990) -- 0:00:22
      633500 -- [-869.768] (-868.548) (-870.695) (-871.185) * (-868.986) [-871.748] (-871.930) (-870.891) -- 0:00:21
      634000 -- (-870.944) (-868.413) (-868.469) [-871.592] * [-869.810] (-873.845) (-875.198) (-868.344) -- 0:00:21
      634500 -- (-870.224) (-868.817) [-869.374] (-873.653) * (-869.503) [-868.946] (-872.667) (-869.078) -- 0:00:21
      635000 -- [-868.713] (-871.963) (-869.967) (-870.283) * (-871.400) (-870.529) [-868.960] (-869.984) -- 0:00:21

      Average standard deviation of split frequencies: 0.008697

      635500 -- (-868.182) (-871.142) [-868.224] (-873.466) * (-868.669) [-869.884] (-869.070) (-870.126) -- 0:00:21
      636000 -- (-867.674) (-869.693) (-870.588) [-870.181] * (-869.979) (-871.830) [-868.596] (-868.991) -- 0:00:21
      636500 -- (-869.435) (-869.559) (-871.959) [-869.068] * [-869.671] (-870.643) (-871.036) (-868.472) -- 0:00:21
      637000 -- (-875.910) (-870.542) [-870.294] (-870.922) * (-869.524) (-869.686) (-868.809) [-869.083] -- 0:00:21
      637500 -- [-869.053] (-868.777) (-869.569) (-870.548) * (-869.142) (-869.810) [-868.351] (-868.679) -- 0:00:21
      638000 -- [-867.805] (-868.672) (-870.047) (-869.174) * [-868.378] (-869.926) (-870.497) (-868.628) -- 0:00:21
      638500 -- (-870.758) [-868.920] (-870.875) (-871.903) * (-869.168) [-870.802] (-871.234) (-869.665) -- 0:00:21
      639000 -- [-871.397] (-874.203) (-868.591) (-871.629) * (-870.979) (-871.644) (-871.274) [-868.478] -- 0:00:21
      639500 -- (-868.779) (-873.738) [-868.410] (-871.588) * (-878.455) (-872.545) [-870.746] (-869.913) -- 0:00:21
      640000 -- (-868.370) (-868.944) (-870.597) [-870.884] * (-871.471) [-870.273] (-872.432) (-873.339) -- 0:00:21

      Average standard deviation of split frequencies: 0.008928

      640500 -- (-879.285) (-868.943) [-869.656] (-871.672) * [-868.547] (-870.332) (-871.073) (-871.955) -- 0:00:21
      641000 -- [-870.834] (-869.527) (-869.571) (-874.973) * [-870.196] (-871.376) (-871.020) (-868.903) -- 0:00:21
      641500 -- (-870.885) (-875.287) [-869.593] (-869.613) * (-868.942) [-870.487] (-868.285) (-869.169) -- 0:00:21
      642000 -- (-870.305) (-872.453) [-868.853] (-870.553) * [-868.375] (-870.720) (-871.592) (-871.827) -- 0:00:21
      642500 -- (-870.449) (-869.620) (-869.271) [-869.441] * [-869.490] (-868.525) (-874.009) (-869.173) -- 0:00:21
      643000 -- (-871.506) (-872.369) [-870.194] (-875.435) * [-870.165] (-869.268) (-868.415) (-870.692) -- 0:00:21
      643500 -- (-870.284) [-870.669] (-869.025) (-870.070) * [-868.680] (-869.781) (-869.286) (-872.002) -- 0:00:21
      644000 -- (-872.101) (-870.023) [-870.288] (-869.333) * (-871.731) (-869.434) [-872.504] (-871.091) -- 0:00:21
      644500 -- (-871.443) (-869.254) (-869.242) [-869.763] * (-873.745) (-868.997) [-869.379] (-872.098) -- 0:00:21
      645000 -- (-869.300) (-870.443) (-869.025) [-869.180] * [-871.178] (-875.188) (-869.873) (-871.292) -- 0:00:21

      Average standard deviation of split frequencies: 0.008854

      645500 -- (-870.599) (-869.531) [-868.702] (-870.883) * (-875.472) (-873.253) [-868.344] (-869.087) -- 0:00:21
      646000 -- (-868.457) (-870.537) [-868.307] (-870.818) * [-870.106] (-875.187) (-869.791) (-869.653) -- 0:00:21
      646500 -- [-868.379] (-872.316) (-870.322) (-871.105) * (-870.496) (-873.239) (-870.899) [-867.878] -- 0:00:21
      647000 -- (-870.312) (-870.211) (-870.344) [-870.114] * (-870.171) (-871.748) [-872.295] (-869.316) -- 0:00:21
      647500 -- (-868.652) [-868.430] (-872.466) (-868.800) * [-870.213] (-869.153) (-877.121) (-869.358) -- 0:00:21
      648000 -- (-868.854) (-869.135) (-868.878) [-870.954] * (-871.683) (-869.348) (-870.838) [-870.294] -- 0:00:21
      648500 -- (-874.415) (-869.840) [-868.162] (-869.502) * (-869.772) [-872.347] (-868.016) (-872.761) -- 0:00:21
      649000 -- (-872.005) (-870.965) (-868.138) [-871.931] * (-869.664) [-869.881] (-872.377) (-871.083) -- 0:00:21
      649500 -- (-870.829) (-871.478) (-874.272) [-869.155] * [-868.134] (-871.592) (-871.435) (-868.797) -- 0:00:21
      650000 -- (-873.411) (-869.562) [-868.231] (-870.771) * (-872.210) (-872.146) [-870.186] (-872.357) -- 0:00:21

      Average standard deviation of split frequencies: 0.008646

      650500 -- (-870.595) (-870.895) (-870.169) [-869.943] * (-868.716) [-869.676] (-868.846) (-869.253) -- 0:00:20
      651000 -- (-869.816) [-869.551] (-870.454) (-867.879) * (-868.831) (-868.380) [-869.048] (-868.724) -- 0:00:20
      651500 -- [-872.218] (-871.563) (-875.242) (-872.984) * [-870.715] (-871.684) (-871.285) (-869.672) -- 0:00:20
      652000 -- [-870.575] (-868.836) (-868.891) (-869.338) * (-871.795) [-868.586] (-869.633) (-871.476) -- 0:00:20
      652500 -- (-869.408) (-870.309) [-870.214] (-870.313) * (-869.819) (-868.529) [-869.714] (-870.599) -- 0:00:20
      653000 -- (-870.224) (-870.396) (-869.065) [-869.160] * (-869.620) [-869.341] (-869.545) (-870.169) -- 0:00:20
      653500 -- [-870.682] (-869.901) (-868.803) (-869.604) * (-868.146) [-868.589] (-872.848) (-870.509) -- 0:00:20
      654000 -- (-869.888) [-869.132] (-871.300) (-870.956) * (-870.740) (-869.087) [-871.652] (-872.906) -- 0:00:20
      654500 -- (-869.785) [-869.100] (-870.293) (-870.788) * (-873.799) [-869.091] (-870.229) (-870.445) -- 0:00:20
      655000 -- (-869.065) (-872.295) (-869.633) [-871.355] * (-871.403) [-869.531] (-870.982) (-869.577) -- 0:00:20

      Average standard deviation of split frequencies: 0.008959

      655500 -- (-869.231) (-877.991) [-870.880] (-871.931) * (-875.152) (-871.507) (-871.979) [-870.439] -- 0:00:20
      656000 -- (-869.725) (-873.219) [-870.549] (-872.296) * (-872.756) [-870.933] (-872.259) (-871.555) -- 0:00:20
      656500 -- (-871.091) (-869.371) [-870.713] (-875.914) * (-869.711) (-869.713) [-871.120] (-871.626) -- 0:00:20
      657000 -- (-870.869) [-867.920] (-871.210) (-871.577) * (-870.265) [-871.827] (-869.249) (-869.672) -- 0:00:20
      657500 -- (-872.472) (-870.229) [-871.043] (-871.429) * (-871.472) (-869.091) [-869.792] (-870.325) -- 0:00:20
      658000 -- [-868.325] (-868.677) (-872.373) (-869.945) * [-870.121] (-871.034) (-869.345) (-872.795) -- 0:00:20
      658500 -- (-871.332) [-868.833] (-867.915) (-869.332) * (-871.295) (-872.259) (-869.988) [-870.164] -- 0:00:20
      659000 -- (-869.873) [-871.955] (-869.907) (-870.180) * [-870.405] (-870.826) (-871.190) (-872.831) -- 0:00:20
      659500 -- [-870.186] (-873.133) (-869.056) (-873.773) * (-868.170) (-869.478) [-869.028] (-876.807) -- 0:00:20
      660000 -- (-868.971) [-870.062] (-868.917) (-871.984) * (-868.419) (-868.422) (-873.646) [-868.340] -- 0:00:20

      Average standard deviation of split frequencies: 0.009181

      660500 -- (-869.330) (-868.791) (-869.260) [-869.011] * (-871.418) (-869.368) (-868.451) [-868.593] -- 0:00:20
      661000 -- (-870.755) [-871.125] (-869.188) (-878.741) * (-869.061) (-868.951) (-868.303) [-868.849] -- 0:00:20
      661500 -- (-869.689) (-873.107) [-871.032] (-870.199) * (-870.480) [-868.980] (-870.535) (-868.153) -- 0:00:20
      662000 -- [-869.640] (-869.206) (-872.948) (-873.227) * (-872.496) (-871.507) (-867.830) [-870.943] -- 0:00:20
      662500 -- (-868.890) [-869.103] (-871.099) (-871.508) * (-876.513) (-871.017) [-868.493] (-872.749) -- 0:00:20
      663000 -- (-875.336) (-869.742) [-869.466] (-871.380) * (-872.236) (-869.641) [-869.391] (-872.446) -- 0:00:20
      663500 -- (-873.533) (-869.686) [-872.210] (-870.923) * (-868.720) (-868.922) (-869.152) [-875.326] -- 0:00:20
      664000 -- (-868.563) [-869.241] (-871.823) (-869.892) * (-874.242) [-868.980] (-868.847) (-871.634) -- 0:00:20
      664500 -- (-874.749) [-868.368] (-871.610) (-869.675) * (-870.628) (-869.762) (-872.096) [-872.220] -- 0:00:20
      665000 -- (-871.865) (-873.560) [-868.851] (-869.719) * [-870.124] (-868.719) (-869.942) (-872.962) -- 0:00:20

      Average standard deviation of split frequencies: 0.008871

      665500 -- (-872.303) (-872.688) [-871.447] (-869.484) * (-869.022) (-869.349) [-871.963] (-871.557) -- 0:00:20
      666000 -- (-868.468) (-870.859) [-868.265] (-868.871) * (-869.214) [-871.771] (-868.484) (-871.515) -- 0:00:20
      666500 -- (-868.674) (-869.483) (-869.044) [-868.486] * (-871.580) (-873.049) [-869.356] (-869.925) -- 0:00:20
      667000 -- (-868.152) [-868.750] (-870.411) (-870.616) * (-874.102) [-869.341] (-869.383) (-868.044) -- 0:00:19
      667500 -- (-870.179) (-871.906) [-869.364] (-868.331) * (-875.059) (-871.701) [-871.380] (-869.990) -- 0:00:19
      668000 -- (-874.454) (-869.652) [-869.808] (-868.415) * [-870.803] (-868.743) (-872.486) (-872.310) -- 0:00:19
      668500 -- (-870.666) (-868.986) (-872.519) [-869.073] * (-869.564) (-872.168) [-870.362] (-869.184) -- 0:00:19
      669000 -- (-868.938) (-871.297) (-873.150) [-870.086] * (-872.688) (-872.524) (-874.664) [-869.052] -- 0:00:19
      669500 -- [-869.268] (-871.462) (-872.171) (-870.196) * (-869.962) (-869.415) [-873.332] (-870.544) -- 0:00:19
      670000 -- (-873.532) [-869.050] (-869.928) (-869.873) * (-871.434) (-874.893) [-868.871] (-869.207) -- 0:00:19

      Average standard deviation of split frequencies: 0.008575

      670500 -- (-870.031) [-868.240] (-868.665) (-870.354) * (-870.333) (-872.953) [-869.185] (-869.871) -- 0:00:19
      671000 -- (-871.334) (-877.039) (-869.554) [-872.292] * [-867.836] (-876.711) (-870.548) (-869.562) -- 0:00:19
      671500 -- (-868.707) (-868.747) [-869.181] (-872.821) * [-868.106] (-875.624) (-871.630) (-868.670) -- 0:00:19
      672000 -- [-870.134] (-868.383) (-868.374) (-869.754) * (-871.166) (-872.155) (-873.864) [-869.457] -- 0:00:19
      672500 -- [-870.948] (-868.716) (-870.970) (-868.717) * [-872.557] (-870.501) (-872.408) (-870.187) -- 0:00:19
      673000 -- (-871.066) (-868.539) (-871.353) [-869.831] * (-872.847) [-870.451] (-868.207) (-870.426) -- 0:00:19
      673500 -- (-870.486) (-869.015) [-871.313] (-871.358) * (-871.450) (-868.463) (-869.701) [-869.980] -- 0:00:19
      674000 -- (-869.120) (-872.235) (-870.662) [-869.771] * (-873.415) (-869.616) [-870.899] (-870.610) -- 0:00:19
      674500 -- (-870.160) [-872.758] (-869.763) (-871.217) * [-874.619] (-872.684) (-871.216) (-869.077) -- 0:00:19
      675000 -- [-869.272] (-873.373) (-870.576) (-871.864) * (-873.555) (-868.243) [-870.102] (-869.580) -- 0:00:19

      Average standard deviation of split frequencies: 0.008229

      675500 -- [-867.884] (-870.309) (-868.666) (-870.615) * (-870.389) (-869.221) (-868.515) [-870.793] -- 0:00:19
      676000 -- (-869.589) (-868.904) (-870.690) [-873.436] * (-870.075) (-868.546) [-871.795] (-869.810) -- 0:00:19
      676500 -- [-872.054] (-872.028) (-867.958) (-868.566) * [-870.453] (-871.311) (-872.389) (-870.707) -- 0:00:19
      677000 -- (-872.695) (-869.641) (-868.632) [-869.079] * (-868.691) (-868.632) (-870.351) [-868.542] -- 0:00:19
      677500 -- (-875.444) (-868.898) (-868.629) [-868.833] * [-871.203] (-871.233) (-872.490) (-870.187) -- 0:00:19
      678000 -- (-868.696) (-871.747) [-871.281] (-870.451) * (-867.968) [-869.440] (-872.351) (-868.391) -- 0:00:19
      678500 -- (-869.240) [-868.888] (-872.901) (-868.301) * (-868.539) [-868.242] (-875.246) (-870.109) -- 0:00:19
      679000 -- (-871.968) (-868.599) (-870.899) [-869.157] * (-871.224) [-868.512] (-873.184) (-872.758) -- 0:00:19
      679500 -- (-869.343) (-871.120) [-869.481] (-869.371) * [-868.234] (-871.057) (-873.919) (-872.676) -- 0:00:19
      680000 -- (-870.044) (-871.026) [-868.483] (-871.350) * (-869.333) (-870.458) [-869.699] (-871.228) -- 0:00:19

      Average standard deviation of split frequencies: 0.008495

      680500 -- (-872.020) (-869.591) (-869.502) [-869.999] * (-869.135) (-874.321) (-869.634) [-871.050] -- 0:00:19
      681000 -- (-870.437) (-870.108) [-868.218] (-868.295) * (-871.355) (-869.552) [-869.450] (-870.490) -- 0:00:19
      681500 -- (-869.681) (-869.959) (-871.823) [-871.314] * (-874.202) (-873.192) (-871.843) [-871.569] -- 0:00:19
      682000 -- (-872.769) (-871.024) (-871.653) [-871.449] * [-868.782] (-869.674) (-870.653) (-876.199) -- 0:00:19
      682500 -- (-871.645) (-872.111) [-870.888] (-870.567) * (-870.492) (-872.168) (-870.536) [-869.098] -- 0:00:19
      683000 -- (-871.878) (-872.064) (-870.784) [-873.701] * [-869.578] (-870.413) (-868.632) (-870.122) -- 0:00:19
      683500 -- (-869.790) (-869.764) [-869.906] (-869.715) * (-871.789) (-869.822) (-869.900) [-869.202] -- 0:00:18
      684000 -- (-873.294) (-870.344) (-870.621) [-869.592] * (-869.299) [-870.077] (-868.237) (-870.781) -- 0:00:18
      684500 -- (-868.501) (-869.754) (-874.329) [-870.567] * (-868.158) (-870.269) [-868.746] (-871.162) -- 0:00:18
      685000 -- (-868.361) (-868.215) [-868.796] (-868.771) * (-870.244) [-869.418] (-872.012) (-873.117) -- 0:00:18

      Average standard deviation of split frequencies: 0.008704

      685500 -- (-868.374) (-868.379) (-868.092) [-868.692] * (-868.705) (-870.668) (-875.434) [-870.710] -- 0:00:18
      686000 -- [-869.176] (-870.147) (-877.815) (-870.848) * (-868.645) [-870.484] (-868.180) (-871.610) -- 0:00:18
      686500 -- (-871.183) (-872.962) (-874.159) [-870.056] * (-871.447) [-872.681] (-871.408) (-869.594) -- 0:00:18
      687000 -- [-871.589] (-871.369) (-871.662) (-869.722) * (-872.775) (-873.665) (-869.908) [-869.693] -- 0:00:18
      687500 -- (-870.640) [-869.893] (-872.554) (-874.270) * (-869.631) [-871.310] (-869.440) (-870.857) -- 0:00:18
      688000 -- (-870.570) (-869.189) [-869.334] (-870.105) * (-869.397) (-869.193) [-872.641] (-869.770) -- 0:00:18
      688500 -- (-869.030) (-870.430) (-869.453) [-876.189] * (-869.875) (-874.137) [-871.193] (-869.431) -- 0:00:18
      689000 -- [-868.841] (-872.272) (-870.277) (-873.035) * [-872.493] (-874.346) (-872.247) (-868.687) -- 0:00:18
      689500 -- (-869.805) (-871.886) [-868.887] (-872.524) * (-874.268) (-868.151) [-870.548] (-869.825) -- 0:00:18
      690000 -- (-873.897) [-869.227] (-872.378) (-870.626) * (-873.108) (-868.557) [-870.493] (-868.819) -- 0:00:18

      Average standard deviation of split frequencies: 0.009237

      690500 -- (-870.267) (-870.167) (-869.546) [-871.460] * (-868.724) (-868.703) [-868.987] (-869.043) -- 0:00:18
      691000 -- (-869.615) [-870.014] (-870.463) (-869.649) * (-869.569) [-869.539] (-869.169) (-869.913) -- 0:00:18
      691500 -- (-869.827) [-868.667] (-870.651) (-871.068) * (-870.369) [-870.617] (-871.615) (-875.240) -- 0:00:18
      692000 -- (-869.217) (-869.978) [-868.759] (-868.927) * (-873.971) (-869.569) [-870.557] (-875.346) -- 0:00:18
      692500 -- (-870.504) [-870.099] (-870.306) (-867.991) * (-869.989) [-870.188] (-872.769) (-877.039) -- 0:00:18
      693000 -- (-870.517) (-872.199) (-870.854) [-869.004] * (-870.496) (-870.858) [-870.779] (-872.117) -- 0:00:18
      693500 -- (-869.580) (-868.870) [-870.962] (-869.602) * (-871.902) [-872.047] (-868.512) (-869.840) -- 0:00:18
      694000 -- (-871.187) (-868.174) [-870.754] (-869.517) * [-869.908] (-869.480) (-868.982) (-869.787) -- 0:00:18
      694500 -- [-868.632] (-868.628) (-868.241) (-869.834) * (-872.761) (-870.682) [-869.642] (-870.894) -- 0:00:18
      695000 -- (-869.556) (-876.691) [-868.482] (-869.305) * (-868.649) [-870.764] (-871.402) (-871.610) -- 0:00:18

      Average standard deviation of split frequencies: 0.009076

      695500 -- (-869.093) (-868.120) [-873.863] (-868.985) * (-872.374) (-868.307) (-869.322) [-870.546] -- 0:00:18
      696000 -- (-872.797) (-872.042) [-872.157] (-871.185) * (-870.339) (-867.969) (-873.623) [-868.900] -- 0:00:18
      696500 -- (-872.084) [-870.179] (-873.943) (-870.497) * (-870.494) (-869.377) [-870.127] (-867.970) -- 0:00:18
      697000 -- (-869.893) [-869.830] (-872.720) (-872.943) * (-872.473) (-878.501) (-877.224) [-869.383] -- 0:00:18
      697500 -- (-871.002) (-869.615) [-869.871] (-870.038) * (-878.266) (-872.686) [-870.230] (-869.376) -- 0:00:18
      698000 -- [-868.858] (-870.202) (-869.624) (-870.897) * (-868.875) (-868.866) (-868.433) [-870.586] -- 0:00:18
      698500 -- (-868.158) (-870.449) (-870.048) [-868.302] * (-875.074) (-870.751) [-870.117] (-870.788) -- 0:00:18
      699000 -- (-868.590) (-879.716) [-869.119] (-868.074) * (-869.109) (-873.369) (-869.381) [-872.530] -- 0:00:18
      699500 -- [-870.883] (-870.091) (-870.978) (-869.622) * [-869.733] (-871.698) (-869.919) (-869.976) -- 0:00:18
      700000 -- [-868.951] (-869.450) (-870.105) (-873.132) * (-869.911) [-869.935] (-870.878) (-871.231) -- 0:00:18

      Average standard deviation of split frequencies: 0.009105

      700500 -- (-872.023) (-871.608) (-869.306) [-869.692] * (-872.335) (-872.115) (-871.461) [-869.758] -- 0:00:17
      701000 -- (-871.706) [-870.448] (-869.405) (-869.435) * (-871.764) [-869.687] (-870.539) (-876.203) -- 0:00:17
      701500 -- (-870.682) (-868.287) (-868.404) [-869.766] * (-870.507) [-872.450] (-871.376) (-872.149) -- 0:00:17
      702000 -- (-870.101) (-868.726) (-869.079) [-868.509] * (-876.488) (-870.637) [-869.881] (-870.297) -- 0:00:17
      702500 -- [-869.622] (-873.507) (-868.832) (-871.146) * (-868.845) (-871.585) (-869.235) [-870.996] -- 0:00:17
      703000 -- (-870.542) [-870.778] (-870.318) (-868.795) * [-870.272] (-870.941) (-869.480) (-872.268) -- 0:00:17
      703500 -- (-869.938) [-870.073] (-868.322) (-868.707) * (-870.848) (-869.249) [-868.234] (-870.744) -- 0:00:17
      704000 -- (-870.917) (-870.960) (-868.320) [-869.867] * (-868.622) [-872.046] (-868.252) (-870.913) -- 0:00:17
      704500 -- [-870.329] (-869.666) (-868.842) (-869.823) * (-870.747) [-870.019] (-871.957) (-869.746) -- 0:00:17
      705000 -- [-870.569] (-872.542) (-868.876) (-870.675) * (-869.050) [-868.759] (-873.841) (-871.849) -- 0:00:17

      Average standard deviation of split frequencies: 0.009482

      705500 -- (-869.491) [-868.782] (-869.412) (-871.056) * (-868.951) [-868.676] (-869.062) (-871.590) -- 0:00:17
      706000 -- (-870.364) (-867.978) (-869.465) [-867.819] * (-868.910) (-870.379) [-870.511] (-868.946) -- 0:00:17
      706500 -- (-870.840) (-868.963) [-869.170] (-869.728) * (-869.644) [-869.158] (-869.233) (-870.958) -- 0:00:17
      707000 -- [-869.070] (-869.412) (-872.978) (-870.236) * (-871.439) (-871.532) [-868.944] (-874.061) -- 0:00:17
      707500 -- [-868.819] (-868.912) (-869.203) (-868.830) * (-870.988) (-871.168) [-869.342] (-871.230) -- 0:00:17
      708000 -- (-870.376) [-868.065] (-875.095) (-869.434) * [-871.249] (-870.634) (-870.528) (-869.083) -- 0:00:17
      708500 -- (-869.306) (-870.216) (-871.317) [-869.635] * (-868.003) (-871.095) [-868.510] (-875.101) -- 0:00:17
      709000 -- (-869.040) [-868.855] (-869.156) (-868.134) * (-869.669) (-872.003) [-868.366] (-870.463) -- 0:00:17
      709500 -- (-868.563) [-870.640] (-869.026) (-868.134) * (-873.518) [-870.805] (-870.068) (-869.879) -- 0:00:17
      710000 -- [-869.064] (-869.261) (-869.674) (-870.019) * (-877.633) [-868.828] (-869.228) (-871.709) -- 0:00:17

      Average standard deviation of split frequencies: 0.009552

      710500 -- (-872.188) [-868.517] (-873.258) (-873.791) * (-873.985) (-872.963) (-869.710) [-869.593] -- 0:00:17
      711000 -- (-867.955) (-874.853) (-869.379) [-870.240] * (-872.061) [-869.370] (-869.056) (-869.505) -- 0:00:17
      711500 -- (-868.465) (-868.303) [-872.199] (-870.493) * (-870.800) (-870.596) (-868.065) [-870.346] -- 0:00:17
      712000 -- (-873.178) (-870.773) (-870.836) [-870.920] * [-868.398] (-869.898) (-870.350) (-871.153) -- 0:00:17
      712500 -- (-868.819) (-868.891) [-867.991] (-871.443) * (-872.127) [-872.033] (-872.203) (-868.700) -- 0:00:17
      713000 -- (-868.819) (-870.703) [-868.723] (-871.049) * (-871.905) (-871.936) (-871.111) [-868.723] -- 0:00:17
      713500 -- (-868.564) (-868.419) [-871.737] (-868.088) * (-873.066) (-869.046) [-870.536] (-869.633) -- 0:00:17
      714000 -- [-868.808] (-868.505) (-871.072) (-868.319) * [-873.653] (-869.257) (-872.050) (-868.645) -- 0:00:17
      714500 -- (-873.782) (-870.029) [-870.370] (-869.145) * [-870.680] (-872.569) (-872.469) (-870.532) -- 0:00:17
      715000 -- (-870.165) (-870.336) (-869.666) [-870.126] * (-869.549) (-870.254) [-871.109] (-869.952) -- 0:00:17

      Average standard deviation of split frequencies: 0.009612

      715500 -- (-869.737) [-869.865] (-869.327) (-874.576) * (-871.291) (-872.974) [-869.736] (-869.424) -- 0:00:17
      716000 -- (-870.226) (-869.553) [-870.309] (-869.478) * (-871.402) (-871.651) [-870.972] (-869.651) -- 0:00:17
      716500 -- (-874.316) (-869.985) (-873.092) [-870.716] * (-870.672) [-869.098] (-871.267) (-871.197) -- 0:00:17
      717000 -- (-878.799) (-870.471) (-874.101) [-872.766] * (-875.226) (-868.297) [-868.711] (-870.298) -- 0:00:16
      717500 -- [-869.641] (-871.116) (-874.473) (-868.821) * (-870.324) (-868.386) (-869.390) [-868.299] -- 0:00:16
      718000 -- [-869.103] (-870.050) (-872.280) (-869.864) * (-872.450) (-870.145) [-871.030] (-868.103) -- 0:00:16
      718500 -- [-869.459] (-878.197) (-874.582) (-869.637) * (-870.651) [-874.923] (-869.862) (-870.676) -- 0:00:16
      719000 -- [-868.700] (-877.134) (-870.423) (-870.245) * (-869.659) [-871.399]