>C1
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C2
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C3
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C4
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C5
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C6
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=287
C1 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C2 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C3 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C4 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C5 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C6 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
**************************************************
C1 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C2 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C3 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C4 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C5 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C6 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
**************************************************
C1 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C2 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C3 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C4 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C5 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C6 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
**************************************************
C1 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C2 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C3 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C4 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C5 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C6 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
**************************************************
C1 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C2 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C3 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C4 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C5 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C6 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
**************************************************
C1 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C2 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C3 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C4 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C5 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C6 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8610]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8610]--->[8610]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.846 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C2 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C3 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C4 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C5 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C6 MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
**************************************************
C1 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C2 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C3 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C4 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C5 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C6 TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
**************************************************
C1 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C2 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C3 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C4 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C5 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C6 SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
**************************************************
C1 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C2 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C3 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C4 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C5 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C6 YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
**************************************************
C1 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C2 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C3 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C4 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C5 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C6 RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
**************************************************
C1 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C2 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C3 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C4 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C5 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C6 FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C2 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C3 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C4 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C5 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C6 ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
**************************************************
C1 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C2 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C3 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C4 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C5 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C6 GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
**************************************************
C1 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C2 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C3 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C4 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C5 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C6 AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
**************************************************
C1 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C2 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C3 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C4 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C5 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C6 ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
**************************************************
C1 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C2 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C3 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C4 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C5 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C6 GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
**************************************************
C1 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C2 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C3 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C4 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C5 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C6 ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
**************************************************
C1 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C2 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C3 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C4 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C5 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C6 TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
**************************************************
C1 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C2 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C3 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C4 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C5 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C6 ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
**************************************************
C1 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C2 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C3 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C4 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C5 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C6 TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
**************************************************
C1 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C2 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C3 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C4 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C5 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C6 TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
**************************************************
C1 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C2 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C3 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C4 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C5 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C6 TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
**************************************************
C1 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C2 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C3 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C4 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C5 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C6 TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
**************************************************
C1 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C2 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C3 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C4 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C5 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C6 CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
**************************************************
C1 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C2 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C3 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C4 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C5 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C6 ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
**************************************************
C1 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C2 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C3 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C4 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C5 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C6 AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
**************************************************
C1 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C2 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C3 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C4 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C5 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C6 TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
**************************************************
C1 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C2 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C3 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C4 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C5 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C6 ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
**************************************************
C1 GCTTCGGCGCG
C2 GCTTCGGCGCG
C3 GCTTCGGCGCG
C4 GCTTCGGCGCG
C5 GCTTCGGCGCG
C6 GCTTCGGCGCG
***********
>C1
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C2
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C3
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C4
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C5
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C6
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C1
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C2
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C3
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C4
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C5
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C6
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 861 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859282
Setting output file names to "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1089405670
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5571185194
Seed = 302348072
Swapseed = 1579859282
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1926.959277 -- -24.965149
Chain 2 -- -1926.959277 -- -24.965149
Chain 3 -- -1926.959277 -- -24.965149
Chain 4 -- -1926.959277 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1926.959277 -- -24.965149
Chain 2 -- -1926.959277 -- -24.965149
Chain 3 -- -1926.959277 -- -24.965149
Chain 4 -- -1926.959277 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1926.959] (-1926.959) (-1926.959) (-1926.959) * [-1926.959] (-1926.959) (-1926.959) (-1926.959)
500 -- (-1192.506) (-1202.162) [-1188.710] (-1184.759) * [-1187.888] (-1193.155) (-1200.702) (-1193.446) -- 0:00:00
1000 -- [-1185.446] (-1185.922) (-1192.291) (-1182.609) * [-1187.930] (-1196.972) (-1192.600) (-1190.415) -- 0:16:39
1500 -- [-1183.347] (-1192.904) (-1190.561) (-1190.719) * (-1188.460) (-1192.846) (-1185.012) [-1188.324] -- 0:11:05
2000 -- [-1182.731] (-1188.259) (-1188.371) (-1186.632) * (-1182.996) (-1187.137) [-1185.549] (-1188.363) -- 0:08:19
2500 -- (-1192.686) (-1185.633) [-1180.018] (-1189.228) * (-1183.406) [-1186.909] (-1191.968) (-1182.000) -- 0:06:39
3000 -- (-1187.722) [-1184.085] (-1182.262) (-1188.781) * (-1191.011) (-1195.188) (-1192.053) [-1180.920] -- 0:05:32
3500 -- (-1192.133) (-1185.035) [-1186.146] (-1182.391) * (-1190.560) (-1183.540) [-1184.049] (-1180.353) -- 0:04:44
4000 -- (-1185.572) [-1182.811] (-1189.151) (-1181.919) * (-1186.655) [-1184.362] (-1196.180) (-1183.604) -- 0:04:09
4500 -- (-1185.003) (-1185.517) [-1185.913] (-1193.555) * (-1182.093) (-1183.801) [-1181.056] (-1182.536) -- 0:03:41
5000 -- (-1194.780) (-1179.025) (-1183.652) [-1185.214] * (-1187.232) [-1188.175] (-1185.068) (-1183.957) -- 0:03:19
Average standard deviation of split frequencies: 0.095647
5500 -- (-1188.809) (-1182.892) [-1183.119] (-1185.569) * (-1187.166) (-1191.024) (-1190.248) [-1188.436] -- 0:03:00
6000 -- (-1187.016) (-1185.465) (-1184.738) [-1180.034] * (-1186.751) (-1190.006) (-1187.812) [-1189.686] -- 0:02:45
6500 -- (-1186.515) (-1190.190) [-1183.229] (-1186.790) * [-1183.939] (-1189.015) (-1186.381) (-1187.361) -- 0:02:32
7000 -- (-1187.869) [-1192.182] (-1186.572) (-1180.756) * (-1190.480) (-1182.338) [-1182.431] (-1186.597) -- 0:02:21
7500 -- (-1187.547) (-1184.259) [-1183.046] (-1182.545) * (-1185.695) (-1193.406) [-1184.301] (-1194.701) -- 0:02:12
8000 -- (-1183.695) [-1186.935] (-1189.317) (-1190.067) * [-1188.036] (-1181.399) (-1191.060) (-1190.597) -- 0:02:04
8500 -- (-1193.430) [-1180.512] (-1181.221) (-1190.022) * [-1194.017] (-1187.532) (-1191.688) (-1190.705) -- 0:01:56
9000 -- (-1187.856) (-1183.407) (-1188.673) [-1187.329] * (-1184.779) (-1180.188) (-1190.703) [-1181.016] -- 0:01:50
9500 -- (-1194.891) [-1184.799] (-1186.155) (-1190.889) * (-1182.567) [-1187.329] (-1191.202) (-1189.674) -- 0:01:44
10000 -- (-1184.042) [-1181.428] (-1188.054) (-1184.817) * [-1185.649] (-1194.683) (-1195.013) (-1191.140) -- 0:01:39
Average standard deviation of split frequencies: 0.060476
10500 -- [-1187.392] (-1187.650) (-1187.417) (-1189.244) * [-1181.269] (-1185.394) (-1187.426) (-1185.385) -- 0:01:34
11000 -- (-1191.416) (-1196.749) (-1186.263) [-1186.794] * (-1189.766) (-1180.471) [-1187.687] (-1182.828) -- 0:01:29
11500 -- (-1182.892) (-1185.410) (-1192.933) [-1188.321] * [-1185.480] (-1181.817) (-1187.265) (-1198.843) -- 0:01:25
12000 -- (-1191.029) [-1193.787] (-1187.302) (-1187.918) * (-1180.958) (-1190.048) (-1183.014) [-1182.588] -- 0:01:22
12500 -- (-1182.972) (-1179.436) [-1189.424] (-1184.431) * (-1189.026) [-1188.625] (-1190.005) (-1188.053) -- 0:01:19
13000 -- [-1184.547] (-1179.818) (-1195.022) (-1192.136) * (-1182.480) [-1179.770] (-1185.160) (-1191.090) -- 0:01:15
13500 -- [-1186.260] (-1188.605) (-1197.326) (-1192.107) * (-1187.494) (-1189.042) (-1180.802) [-1193.698] -- 0:01:13
14000 -- [-1180.880] (-1188.868) (-1183.509) (-1186.334) * (-1188.959) (-1185.131) [-1186.781] (-1193.158) -- 0:01:10
14500 -- (-1184.661) [-1182.763] (-1186.849) (-1186.029) * (-1188.792) [-1181.097] (-1181.039) (-1194.191) -- 0:01:07
15000 -- [-1193.830] (-1189.692) (-1186.617) (-1184.893) * (-1193.049) (-1191.145) [-1182.794] (-1187.097) -- 0:01:05
Average standard deviation of split frequencies: 0.053401
15500 -- (-1185.783) (-1183.114) [-1189.978] (-1182.228) * [-1185.531] (-1189.765) (-1190.429) (-1187.467) -- 0:01:03
16000 -- (-1180.161) (-1193.956) (-1200.174) [-1181.251] * (-1177.863) [-1186.149] (-1181.887) (-1188.030) -- 0:01:01
16500 -- (-1184.331) (-1190.445) (-1190.731) [-1191.713] * [-1185.287] (-1185.797) (-1206.121) (-1183.787) -- 0:01:59
17000 -- (-1185.469) [-1184.462] (-1187.261) (-1188.457) * (-1181.897) [-1189.852] (-1185.681) (-1187.919) -- 0:01:55
17500 -- (-1197.568) (-1183.577) [-1179.226] (-1188.094) * [-1189.675] (-1185.815) (-1184.103) (-1180.452) -- 0:01:52
18000 -- [-1182.819] (-1187.434) (-1184.631) (-1183.081) * (-1194.425) (-1185.542) [-1184.699] (-1182.772) -- 0:01:49
18500 -- [-1196.166] (-1182.099) (-1180.421) (-1186.811) * (-1182.343) (-1188.931) [-1184.827] (-1183.933) -- 0:01:46
19000 -- [-1189.542] (-1190.311) (-1179.371) (-1181.769) * (-1192.804) (-1184.618) [-1186.713] (-1187.201) -- 0:01:43
19500 -- (-1192.825) (-1187.888) [-1178.190] (-1187.223) * (-1186.549) (-1185.826) [-1193.400] (-1186.562) -- 0:01:40
20000 -- (-1180.374) (-1185.429) [-1179.188] (-1195.198) * (-1191.959) (-1196.417) (-1184.948) [-1189.957] -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- [-1187.308] (-1188.112) (-1181.097) (-1192.089) * (-1193.867) [-1183.587] (-1188.752) (-1190.856) -- 0:01:35
21000 -- (-1184.990) [-1182.003] (-1179.300) (-1187.649) * (-1187.449) [-1185.763] (-1182.020) (-1181.533) -- 0:01:33
21500 -- (-1185.844) [-1184.994] (-1176.727) (-1186.997) * (-1183.983) [-1186.407] (-1184.961) (-1184.616) -- 0:01:31
22000 -- (-1184.985) [-1182.856] (-1178.919) (-1187.187) * (-1192.030) (-1185.781) (-1185.136) [-1185.715] -- 0:01:28
22500 -- (-1184.199) (-1191.336) (-1179.253) [-1192.974] * (-1185.315) [-1189.942] (-1176.614) (-1186.615) -- 0:01:26
23000 -- (-1183.628) (-1187.794) (-1185.917) [-1188.991] * (-1187.929) (-1198.295) (-1176.497) [-1189.281] -- 0:01:24
23500 -- (-1189.690) (-1192.159) (-1179.083) [-1188.269] * (-1183.606) (-1200.828) (-1179.844) [-1187.184] -- 0:01:23
24000 -- (-1187.459) (-1184.469) (-1179.747) [-1186.664] * (-1181.050) (-1192.417) (-1178.270) [-1192.829] -- 0:01:21
24500 -- [-1192.616] (-1185.863) (-1182.155) (-1183.992) * [-1184.746] (-1176.876) (-1178.391) (-1189.573) -- 0:01:19
25000 -- (-1183.225) [-1181.246] (-1183.444) (-1185.507) * (-1187.394) (-1176.420) [-1177.272] (-1190.304) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-1182.691) [-1187.469] (-1181.693) (-1188.273) * [-1187.083] (-1177.076) (-1178.417) (-1187.197) -- 0:01:16
26000 -- [-1179.957] (-1185.120) (-1176.502) (-1191.472) * (-1187.260) (-1179.557) [-1177.146] (-1186.009) -- 0:01:14
26500 -- [-1189.548] (-1189.719) (-1177.453) (-1201.756) * (-1187.912) [-1178.394] (-1177.757) (-1187.412) -- 0:01:13
27000 -- (-1189.255) [-1187.327] (-1179.077) (-1186.023) * (-1194.815) [-1175.785] (-1176.120) (-1189.954) -- 0:01:12
27500 -- [-1184.501] (-1181.712) (-1177.749) (-1176.580) * (-1190.560) [-1176.220] (-1176.697) (-1184.936) -- 0:01:10
28000 -- (-1191.510) (-1182.110) (-1181.984) [-1176.776] * (-1183.674) [-1177.718] (-1176.156) (-1188.495) -- 0:01:09
28500 -- (-1186.618) [-1198.927] (-1181.350) (-1176.012) * (-1187.220) (-1177.989) (-1175.988) [-1185.353] -- 0:01:08
29000 -- (-1187.620) (-1186.044) [-1178.731] (-1178.334) * (-1186.847) (-1175.772) (-1176.176) [-1186.492] -- 0:01:06
29500 -- (-1188.555) [-1186.817] (-1176.858) (-1178.279) * (-1189.873) [-1176.465] (-1179.467) (-1185.438) -- 0:01:05
30000 -- (-1187.235) (-1187.128) [-1177.505] (-1182.016) * (-1184.793) (-1178.847) (-1181.182) [-1183.159] -- 0:01:04
Average standard deviation of split frequencies: 0.025080
30500 -- (-1186.057) (-1192.927) [-1177.436] (-1178.730) * (-1186.781) [-1178.472] (-1180.519) (-1198.592) -- 0:01:03
31000 -- [-1187.495] (-1182.639) (-1178.497) (-1180.353) * (-1177.332) (-1179.298) (-1181.721) [-1185.446] -- 0:01:02
31500 -- [-1183.132] (-1195.902) (-1175.977) (-1176.686) * (-1183.309) (-1175.681) (-1177.352) [-1185.546] -- 0:01:32
32000 -- (-1199.656) (-1183.600) (-1177.289) [-1179.039] * (-1177.575) (-1175.788) (-1179.533) [-1189.033] -- 0:01:30
32500 -- (-1183.599) (-1186.851) (-1179.318) [-1176.764] * [-1178.451] (-1183.573) (-1178.463) (-1188.068) -- 0:01:29
33000 -- (-1187.482) [-1186.682] (-1179.016) (-1177.820) * (-1178.537) [-1179.063] (-1178.116) (-1184.036) -- 0:01:27
33500 -- (-1194.465) (-1196.637) (-1177.603) [-1175.986] * (-1178.888) (-1177.022) (-1178.125) [-1182.030] -- 0:01:26
34000 -- (-1182.840) [-1183.216] (-1177.923) (-1177.006) * (-1177.059) (-1180.397) (-1177.352) [-1184.037] -- 0:01:25
34500 -- [-1185.854] (-1179.625) (-1177.190) (-1177.070) * [-1176.231] (-1186.662) (-1177.707) (-1181.817) -- 0:01:23
35000 -- (-1194.273) (-1179.238) (-1177.369) [-1179.616] * (-1180.174) [-1178.719] (-1176.673) (-1187.890) -- 0:01:22
Average standard deviation of split frequencies: 0.026189
35500 -- (-1187.065) (-1178.105) [-1176.968] (-1176.834) * (-1177.937) [-1176.845] (-1177.063) (-1188.309) -- 0:01:21
36000 -- [-1185.809] (-1178.036) (-1177.874) (-1175.418) * (-1177.123) (-1176.631) (-1177.280) [-1186.331] -- 0:01:20
36500 -- (-1186.016) (-1177.982) (-1177.831) [-1175.813] * (-1178.189) (-1177.111) (-1180.654) [-1184.617] -- 0:01:19
37000 -- (-1189.361) (-1180.096) (-1178.854) [-1175.444] * (-1178.301) (-1179.819) (-1177.363) [-1182.473] -- 0:01:18
37500 -- (-1186.343) (-1180.018) [-1175.370] (-1175.449) * (-1178.441) (-1176.969) (-1179.097) [-1187.783] -- 0:01:17
38000 -- (-1182.985) (-1177.137) [-1175.490] (-1175.314) * [-1180.354] (-1179.855) (-1178.731) (-1195.760) -- 0:01:15
38500 -- (-1190.955) (-1178.017) (-1177.629) [-1176.163] * [-1178.752] (-1177.437) (-1177.943) (-1181.124) -- 0:01:14
39000 -- (-1186.905) [-1177.019] (-1179.406) (-1180.504) * (-1178.783) (-1176.447) (-1176.749) [-1184.664] -- 0:01:13
39500 -- (-1193.385) [-1176.538] (-1178.498) (-1178.008) * [-1176.856] (-1181.149) (-1176.204) (-1186.293) -- 0:01:12
40000 -- (-1190.180) (-1177.177) (-1177.762) [-1177.944] * (-1177.725) (-1178.720) (-1177.798) [-1183.277] -- 0:01:12
Average standard deviation of split frequencies: 0.029559
40500 -- (-1192.252) (-1177.099) [-1179.328] (-1177.659) * (-1177.180) [-1179.534] (-1180.552) (-1187.584) -- 0:01:11
41000 -- [-1184.089] (-1176.472) (-1180.669) (-1177.562) * (-1179.365) (-1178.413) (-1180.142) [-1188.936] -- 0:01:10
41500 -- (-1182.730) (-1176.961) [-1183.644] (-1176.882) * [-1179.460] (-1179.959) (-1182.751) (-1185.349) -- 0:01:09
42000 -- (-1177.636) [-1182.325] (-1176.298) (-1177.298) * (-1179.164) (-1177.094) (-1177.051) [-1182.995] -- 0:01:08
42500 -- [-1177.073] (-1178.918) (-1176.207) (-1179.164) * (-1176.288) (-1177.285) (-1175.869) [-1187.913] -- 0:01:07
43000 -- (-1177.817) [-1177.547] (-1177.301) (-1182.205) * [-1178.618] (-1179.661) (-1177.345) (-1187.574) -- 0:01:06
43500 -- (-1177.482) [-1177.330] (-1176.248) (-1178.952) * (-1176.594) (-1177.822) (-1179.476) [-1186.665] -- 0:01:05
44000 -- (-1176.024) (-1176.507) (-1177.456) [-1177.468] * [-1175.385] (-1178.789) (-1176.577) (-1186.149) -- 0:01:05
44500 -- [-1176.943] (-1177.098) (-1175.287) (-1179.090) * [-1175.602] (-1185.566) (-1176.913) (-1187.314) -- 0:01:04
45000 -- [-1177.802] (-1176.833) (-1177.402) (-1179.732) * (-1175.738) (-1178.812) (-1177.439) [-1184.487] -- 0:01:03
Average standard deviation of split frequencies: 0.030256
45500 -- (-1175.878) (-1178.615) [-1176.440] (-1178.435) * (-1177.559) (-1177.736) (-1177.464) [-1185.640] -- 0:01:02
46000 -- (-1175.776) [-1175.330] (-1177.410) (-1177.815) * (-1178.386) [-1175.745] (-1177.469) (-1186.260) -- 0:01:02
46500 -- (-1176.025) (-1175.611) [-1177.934] (-1176.159) * (-1181.550) [-1176.380] (-1181.961) (-1183.313) -- 0:01:01
47000 -- [-1175.304] (-1175.639) (-1177.114) (-1179.378) * [-1178.843] (-1177.346) (-1181.857) (-1188.751) -- 0:01:21
47500 -- (-1180.179) (-1175.707) [-1179.430] (-1175.804) * (-1177.328) [-1178.429] (-1177.624) (-1186.369) -- 0:01:20
48000 -- (-1181.229) (-1176.756) [-1177.896] (-1181.188) * (-1179.883) (-1178.429) [-1176.124] (-1189.463) -- 0:01:19
48500 -- (-1182.148) [-1176.803] (-1176.159) (-1183.882) * [-1176.416] (-1177.184) (-1175.472) (-1185.918) -- 0:01:18
49000 -- [-1176.989] (-1178.497) (-1178.050) (-1183.182) * (-1182.329) [-1177.709] (-1180.237) (-1182.199) -- 0:01:17
49500 -- (-1178.022) (-1177.948) [-1182.535] (-1179.559) * [-1178.625] (-1177.521) (-1178.865) (-1186.432) -- 0:01:16
50000 -- (-1178.024) [-1175.333] (-1178.490) (-1178.699) * (-1179.566) (-1181.056) (-1178.602) [-1190.424] -- 0:01:16
Average standard deviation of split frequencies: 0.033299
50500 -- (-1175.861) [-1177.671] (-1176.697) (-1177.020) * [-1178.242] (-1178.276) (-1176.882) (-1185.741) -- 0:01:15
51000 -- (-1176.322) [-1177.182] (-1177.573) (-1178.273) * [-1178.002] (-1178.226) (-1175.915) (-1188.266) -- 0:01:14
51500 -- (-1175.447) (-1176.410) [-1178.772] (-1177.492) * [-1177.061] (-1176.669) (-1177.539) (-1190.963) -- 0:01:13
52000 -- (-1175.284) (-1177.980) (-1177.435) [-1177.861] * (-1179.439) (-1175.764) (-1175.903) [-1184.857] -- 0:01:12
52500 -- [-1176.356] (-1178.900) (-1176.040) (-1176.821) * [-1180.885] (-1176.436) (-1177.408) (-1188.094) -- 0:01:12
53000 -- (-1177.571) (-1177.840) (-1179.618) [-1176.783] * (-1177.118) (-1178.625) (-1177.181) [-1185.318] -- 0:01:11
53500 -- (-1176.989) (-1177.777) (-1177.870) [-1176.624] * (-1178.864) (-1176.824) (-1177.805) [-1185.305] -- 0:01:10
54000 -- (-1180.153) (-1175.772) [-1177.445] (-1177.747) * [-1178.066] (-1176.701) (-1177.579) (-1188.776) -- 0:01:10
54500 -- [-1181.211] (-1178.548) (-1178.196) (-1177.726) * [-1178.679] (-1178.159) (-1179.029) (-1192.082) -- 0:01:09
55000 -- (-1178.239) [-1180.474] (-1178.933) (-1175.607) * (-1180.189) (-1176.791) (-1177.169) [-1192.331] -- 0:01:08
Average standard deviation of split frequencies: 0.029042
55500 -- [-1179.904] (-1179.764) (-1178.062) (-1176.845) * (-1179.756) (-1176.859) (-1177.915) [-1183.800] -- 0:01:08
56000 -- [-1177.068] (-1179.101) (-1179.477) (-1176.173) * (-1179.824) (-1177.014) [-1177.044] (-1187.046) -- 0:01:07
56500 -- (-1178.558) [-1179.418] (-1176.311) (-1182.008) * [-1176.480] (-1178.290) (-1177.622) (-1193.087) -- 0:01:06
57000 -- (-1179.007) [-1175.503] (-1179.983) (-1179.168) * [-1177.046] (-1176.291) (-1181.425) (-1189.982) -- 0:01:06
57500 -- (-1178.201) (-1176.841) (-1181.727) [-1178.117] * [-1178.673] (-1178.064) (-1179.829) (-1198.401) -- 0:01:05
58000 -- [-1176.107] (-1176.384) (-1179.550) (-1178.095) * (-1178.854) (-1177.141) (-1179.162) [-1184.221] -- 0:01:04
58500 -- (-1176.560) (-1178.528) (-1178.208) [-1175.992] * [-1177.236] (-1177.018) (-1178.182) (-1179.917) -- 0:01:04
59000 -- [-1177.032] (-1176.472) (-1179.881) (-1177.335) * (-1177.161) (-1176.219) [-1176.553] (-1176.010) -- 0:01:03
59500 -- (-1177.184) [-1176.475] (-1179.984) (-1178.028) * (-1176.229) [-1177.278] (-1179.539) (-1178.248) -- 0:01:03
60000 -- [-1177.486] (-1175.833) (-1184.678) (-1176.693) * (-1175.402) (-1177.264) (-1179.674) [-1175.741] -- 0:01:02
Average standard deviation of split frequencies: 0.028628
60500 -- (-1178.080) (-1178.447) (-1181.095) [-1177.192] * [-1177.016] (-1177.602) (-1179.618) (-1177.920) -- 0:01:02
61000 -- (-1178.268) [-1176.182] (-1179.795) (-1182.634) * (-1178.970) (-1177.569) (-1176.996) [-1176.091] -- 0:01:01
61500 -- (-1180.929) (-1175.473) [-1177.161] (-1178.629) * (-1178.969) (-1176.210) [-1177.631] (-1176.179) -- 0:01:01
62000 -- (-1179.921) [-1176.266] (-1178.016) (-1178.155) * (-1177.013) [-1175.330] (-1176.696) (-1175.766) -- 0:01:15
62500 -- (-1178.090) (-1180.503) [-1175.539] (-1184.563) * [-1176.511] (-1177.753) (-1175.472) (-1179.798) -- 0:01:15
63000 -- (-1178.475) [-1177.333] (-1175.499) (-1183.102) * (-1176.259) (-1175.450) [-1177.424] (-1177.602) -- 0:01:14
63500 -- [-1177.179] (-1180.630) (-1176.575) (-1181.524) * (-1177.844) [-1177.973] (-1177.934) (-1177.227) -- 0:01:13
64000 -- (-1177.124) (-1178.875) (-1178.221) [-1177.517] * [-1178.182] (-1175.622) (-1176.402) (-1178.555) -- 0:01:13
64500 -- (-1179.521) [-1176.914] (-1179.753) (-1176.200) * (-1176.252) [-1177.597] (-1176.186) (-1176.626) -- 0:01:12
65000 -- [-1178.029] (-1175.692) (-1179.826) (-1176.143) * (-1176.972) (-1175.522) [-1176.516] (-1179.302) -- 0:01:11
Average standard deviation of split frequencies: 0.032855
65500 -- (-1176.901) [-1177.459] (-1177.660) (-1180.195) * [-1178.119] (-1176.678) (-1176.274) (-1180.020) -- 0:01:11
66000 -- (-1176.384) (-1188.910) (-1178.956) [-1179.552] * (-1178.263) (-1176.440) [-1178.318] (-1176.688) -- 0:01:10
66500 -- [-1177.216] (-1184.377) (-1177.907) (-1182.373) * (-1181.950) (-1180.530) (-1180.508) [-1175.879] -- 0:01:10
67000 -- [-1176.655] (-1184.555) (-1178.510) (-1179.753) * (-1178.017) (-1176.856) [-1177.164] (-1176.996) -- 0:01:09
67500 -- (-1177.387) (-1177.723) (-1176.311) [-1178.052] * (-1180.533) (-1175.472) (-1176.016) [-1176.466] -- 0:01:09
68000 -- [-1176.334] (-1176.965) (-1175.116) (-1179.053) * (-1178.822) [-1176.447] (-1176.842) (-1177.397) -- 0:01:08
68500 -- (-1176.734) (-1177.436) [-1177.029] (-1178.189) * (-1178.380) (-1176.327) [-1176.739] (-1177.612) -- 0:01:07
69000 -- (-1175.636) (-1178.680) (-1176.281) [-1179.434] * (-1177.303) (-1177.631) (-1180.306) [-1178.890] -- 0:01:07
69500 -- (-1176.308) [-1177.808] (-1175.599) (-1179.626) * [-1180.110] (-1177.823) (-1179.326) (-1177.521) -- 0:01:06
70000 -- [-1175.673] (-1177.812) (-1175.599) (-1176.947) * (-1178.347) (-1177.993) [-1176.919] (-1176.728) -- 0:01:06
Average standard deviation of split frequencies: 0.029141
70500 -- (-1175.940) [-1178.746] (-1177.324) (-1177.540) * [-1178.471] (-1179.213) (-1178.277) (-1177.030) -- 0:01:05
71000 -- (-1175.589) (-1177.783) [-1175.345] (-1180.051) * (-1179.113) [-1179.070] (-1179.412) (-1178.256) -- 0:01:05
71500 -- (-1175.464) (-1177.392) [-1178.581] (-1177.642) * (-1176.435) (-1181.186) (-1178.709) [-1176.170] -- 0:01:04
72000 -- (-1178.065) [-1177.508] (-1175.818) (-1179.826) * (-1176.537) (-1182.232) [-1179.382] (-1178.872) -- 0:01:04
72500 -- [-1178.871] (-1177.445) (-1181.714) (-1178.769) * (-1178.664) (-1177.838) (-1177.771) [-1177.554] -- 0:01:03
73000 -- [-1177.309] (-1177.326) (-1176.487) (-1175.800) * (-1179.019) (-1177.293) [-1177.241] (-1176.345) -- 0:01:03
73500 -- (-1176.845) (-1178.992) [-1175.226] (-1178.432) * (-1181.131) (-1181.580) (-1181.176) [-1176.083] -- 0:01:03
74000 -- (-1177.762) (-1178.894) [-1176.590] (-1176.532) * [-1176.733] (-1178.945) (-1181.076) (-1175.768) -- 0:01:02
74500 -- (-1181.385) (-1178.697) [-1175.588] (-1175.970) * [-1176.164] (-1180.196) (-1178.453) (-1180.499) -- 0:01:02
75000 -- (-1177.882) [-1176.220] (-1176.641) (-1176.872) * [-1178.650] (-1179.503) (-1179.420) (-1183.935) -- 0:01:01
Average standard deviation of split frequencies: 0.027000
75500 -- (-1180.248) (-1175.468) (-1176.857) [-1176.654] * [-1176.610] (-1181.062) (-1176.394) (-1184.608) -- 0:01:01
76000 -- (-1180.066) (-1175.985) (-1177.573) [-1177.024] * [-1180.393] (-1181.613) (-1176.708) (-1176.402) -- 0:01:00
76500 -- (-1177.229) (-1177.634) (-1178.313) [-1177.670] * [-1176.194] (-1181.413) (-1178.091) (-1176.005) -- 0:01:00
77000 -- [-1182.874] (-1178.805) (-1178.289) (-1180.484) * (-1178.830) (-1176.887) (-1177.194) [-1177.013] -- 0:00:59
77500 -- (-1179.546) [-1177.331] (-1176.740) (-1177.556) * [-1175.878] (-1177.030) (-1177.725) (-1176.221) -- 0:00:59
78000 -- (-1180.022) (-1181.447) (-1177.197) [-1176.497] * (-1177.868) [-1177.429] (-1177.833) (-1175.940) -- 0:00:59
78500 -- [-1179.616] (-1182.237) (-1176.495) (-1177.778) * [-1176.676] (-1179.369) (-1177.862) (-1176.244) -- 0:01:10
79000 -- [-1177.252] (-1183.250) (-1176.202) (-1178.812) * (-1176.178) [-1177.353] (-1176.739) (-1184.168) -- 0:01:09
79500 -- (-1181.453) [-1178.305] (-1177.921) (-1178.072) * (-1176.905) [-1176.803] (-1176.167) (-1185.300) -- 0:01:09
80000 -- (-1178.525) [-1176.525] (-1177.846) (-1176.403) * (-1177.131) (-1179.788) [-1177.572] (-1180.569) -- 0:01:09
Average standard deviation of split frequencies: 0.026125
80500 -- (-1176.341) [-1176.688] (-1175.816) (-1177.503) * (-1176.082) [-1176.611] (-1178.153) (-1179.350) -- 0:01:08
81000 -- (-1176.374) (-1181.592) (-1178.622) [-1180.499] * (-1178.952) (-1176.239) [-1178.336] (-1176.709) -- 0:01:08
81500 -- [-1177.047] (-1176.480) (-1175.983) (-1178.945) * [-1176.692] (-1176.115) (-1177.972) (-1176.016) -- 0:01:07
82000 -- (-1177.085) (-1177.371) (-1178.193) [-1176.781] * (-1180.005) (-1179.557) (-1176.743) [-1176.254] -- 0:01:07
82500 -- (-1176.419) (-1177.430) [-1177.824] (-1175.968) * (-1176.184) (-1180.421) [-1175.543] (-1178.488) -- 0:01:06
83000 -- (-1180.765) (-1180.282) (-1178.284) [-1175.624] * (-1176.878) [-1175.518] (-1176.811) (-1177.274) -- 0:01:06
83500 -- (-1180.245) [-1176.544] (-1177.411) (-1175.887) * (-1176.554) (-1177.388) [-1177.080] (-1176.906) -- 0:01:05
84000 -- (-1178.766) (-1178.293) (-1177.680) [-1177.540] * (-1176.687) (-1178.764) [-1177.050] (-1176.991) -- 0:01:05
84500 -- (-1177.720) (-1183.174) (-1179.749) [-1179.018] * (-1176.010) (-1176.425) [-1175.759] (-1178.328) -- 0:01:05
85000 -- (-1178.330) (-1176.455) [-1178.817] (-1177.981) * (-1177.359) [-1176.316] (-1175.919) (-1176.319) -- 0:01:04
Average standard deviation of split frequencies: 0.025676
85500 -- (-1178.658) (-1175.530) (-1179.149) [-1177.212] * [-1177.836] (-1177.134) (-1175.178) (-1177.631) -- 0:01:04
86000 -- (-1179.874) (-1177.729) [-1179.466] (-1177.183) * (-1175.546) [-1180.328] (-1176.911) (-1175.723) -- 0:01:03
86500 -- (-1178.892) (-1178.809) (-1176.755) [-1176.353] * (-1176.284) (-1183.750) [-1178.338] (-1175.581) -- 0:01:03
87000 -- (-1178.492) (-1176.707) [-1176.834] (-1176.802) * (-1175.910) (-1181.352) [-1176.770] (-1175.624) -- 0:01:02
87500 -- (-1179.697) (-1176.507) [-1179.053] (-1177.957) * (-1176.790) (-1178.066) (-1179.067) [-1177.074] -- 0:01:02
88000 -- (-1179.613) (-1175.273) (-1180.513) [-1177.518] * (-1178.645) (-1178.772) (-1181.463) [-1176.829] -- 0:01:02
88500 -- [-1177.223] (-1175.774) (-1183.416) (-1179.886) * (-1181.547) (-1179.138) (-1181.273) [-1180.378] -- 0:01:01
89000 -- [-1175.794] (-1175.870) (-1178.760) (-1178.477) * (-1177.198) [-1178.123] (-1179.151) (-1177.714) -- 0:01:01
89500 -- [-1176.796] (-1180.032) (-1178.891) (-1178.788) * (-1178.400) (-1177.132) (-1180.232) [-1177.948] -- 0:01:01
90000 -- [-1179.376] (-1180.381) (-1179.840) (-1179.007) * (-1179.588) (-1177.563) (-1176.302) [-1176.155] -- 0:01:00
Average standard deviation of split frequencies: 0.025176
90500 -- (-1178.331) (-1175.816) [-1177.075] (-1177.121) * (-1178.103) (-1181.615) [-1176.206] (-1177.542) -- 0:01:00
91000 -- (-1184.488) (-1175.908) [-1180.139] (-1180.054) * (-1179.083) (-1179.274) [-1176.723] (-1177.308) -- 0:00:59
91500 -- (-1177.485) (-1176.754) [-1179.986] (-1177.850) * (-1176.693) (-1177.905) [-1175.717] (-1177.055) -- 0:00:59
92000 -- (-1178.473) (-1178.644) (-1179.499) [-1179.592] * (-1175.693) [-1176.804] (-1175.849) (-1178.880) -- 0:00:59
92500 -- [-1175.841] (-1179.009) (-1177.630) (-1176.168) * (-1176.054) [-1177.723] (-1176.705) (-1179.970) -- 0:00:58
93000 -- (-1176.172) (-1177.580) (-1175.793) [-1176.978] * (-1177.847) (-1178.765) [-1176.213] (-1177.964) -- 0:00:58
93500 -- (-1177.544) (-1176.883) [-1176.302] (-1177.777) * [-1176.272] (-1176.729) (-1176.350) (-1175.641) -- 0:00:58
94000 -- (-1176.778) (-1177.319) [-1177.977] (-1177.492) * (-1177.222) (-1177.427) [-1181.778] (-1176.479) -- 0:00:57
94500 -- (-1176.200) [-1176.160] (-1179.811) (-1176.990) * (-1176.874) (-1176.825) [-1176.464] (-1179.908) -- 0:00:57
95000 -- [-1176.588] (-1177.330) (-1176.996) (-1178.456) * (-1177.107) (-1176.556) [-1175.537] (-1178.190) -- 0:01:06
Average standard deviation of split frequencies: 0.025916
95500 -- (-1178.528) (-1177.106) (-1176.206) [-1178.449] * (-1177.130) [-1176.536] (-1181.915) (-1175.622) -- 0:01:06
96000 -- [-1179.449] (-1178.169) (-1176.280) (-1175.299) * (-1177.155) (-1177.714) (-1180.430) [-1176.538] -- 0:01:05
96500 -- (-1183.818) (-1177.532) (-1180.558) [-1175.352] * (-1178.446) [-1177.010] (-1179.497) (-1177.329) -- 0:01:05
97000 -- (-1178.678) (-1181.439) (-1177.130) [-1176.345] * (-1178.932) (-1176.639) (-1178.733) [-1177.073] -- 0:01:05
97500 -- (-1176.593) (-1175.650) (-1176.175) [-1176.720] * [-1178.927] (-1176.021) (-1177.280) (-1176.279) -- 0:01:04
98000 -- (-1176.177) (-1177.536) [-1175.951] (-1176.548) * (-1179.412) [-1177.727] (-1179.258) (-1176.552) -- 0:01:04
98500 -- [-1178.861] (-1175.996) (-1179.641) (-1176.291) * (-1180.165) (-1182.142) (-1179.929) [-1178.641] -- 0:01:04
99000 -- (-1175.656) [-1177.498] (-1177.695) (-1176.257) * (-1176.522) [-1175.566] (-1177.578) (-1176.215) -- 0:01:03
99500 -- (-1177.886) (-1179.388) (-1176.318) [-1176.492] * (-1177.484) (-1177.217) (-1176.730) [-1175.829] -- 0:01:03
100000 -- (-1177.394) (-1178.823) (-1180.310) [-1180.072] * (-1178.563) (-1177.957) (-1177.038) [-1175.997] -- 0:01:02
Average standard deviation of split frequencies: 0.022894
100500 -- [-1179.091] (-1181.272) (-1181.579) (-1177.665) * [-1177.195] (-1179.011) (-1178.078) (-1176.123) -- 0:01:02
101000 -- (-1177.189) [-1178.585] (-1176.655) (-1179.536) * (-1177.300) (-1176.660) [-1178.633] (-1175.963) -- 0:01:02
101500 -- (-1176.622) (-1177.374) [-1181.007] (-1177.116) * (-1182.905) [-1176.435] (-1176.371) (-1177.447) -- 0:01:01
102000 -- (-1177.884) [-1176.163] (-1177.382) (-1176.878) * (-1179.634) (-1175.998) (-1178.269) [-1178.971] -- 0:01:01
102500 -- (-1177.085) (-1177.294) (-1175.952) [-1177.440] * (-1178.151) [-1177.798] (-1178.576) (-1175.824) -- 0:01:01
103000 -- (-1176.684) (-1175.939) (-1176.973) [-1178.151] * (-1181.828) [-1175.507] (-1178.178) (-1177.526) -- 0:01:00
103500 -- (-1176.771) [-1178.269] (-1176.045) (-1179.842) * (-1177.882) (-1177.547) (-1179.789) [-1177.215] -- 0:01:00
104000 -- (-1178.558) (-1177.804) (-1176.638) [-1176.753] * (-1177.424) (-1176.415) (-1178.335) [-1175.770] -- 0:01:00
104500 -- [-1177.613] (-1178.163) (-1176.324) (-1180.686) * (-1177.813) (-1176.544) [-1177.896] (-1175.354) -- 0:00:59
105000 -- (-1176.244) [-1177.483] (-1176.740) (-1181.078) * [-1175.996] (-1176.698) (-1176.545) (-1175.282) -- 0:00:59
Average standard deviation of split frequencies: 0.024954
105500 -- (-1176.991) [-1176.294] (-1176.941) (-1181.169) * (-1176.967) [-1177.728] (-1179.267) (-1175.778) -- 0:00:59
106000 -- (-1176.242) [-1177.086] (-1177.193) (-1181.318) * [-1177.794] (-1177.435) (-1179.552) (-1175.502) -- 0:00:59
106500 -- (-1176.235) (-1177.721) [-1179.324] (-1179.622) * (-1176.021) (-1177.088) (-1181.659) [-1177.608] -- 0:00:58
107000 -- (-1176.719) [-1176.294] (-1176.263) (-1177.575) * (-1176.383) (-1179.150) (-1180.500) [-1176.034] -- 0:00:58
107500 -- [-1178.532] (-1178.836) (-1175.796) (-1177.502) * [-1177.076] (-1181.897) (-1178.107) (-1176.596) -- 0:00:58
108000 -- (-1180.239) (-1178.719) (-1175.664) [-1179.556] * (-1178.430) [-1176.333] (-1175.500) (-1178.238) -- 0:00:57
108500 -- (-1181.077) (-1177.588) [-1176.368] (-1176.568) * (-1179.916) (-1180.219) (-1175.477) [-1175.272] -- 0:00:57
109000 -- (-1177.906) (-1180.524) (-1175.791) [-1177.090] * [-1178.543] (-1185.261) (-1177.901) (-1175.291) -- 0:00:57
109500 -- [-1178.835] (-1180.226) (-1176.409) (-1175.843) * (-1178.067) (-1178.618) (-1177.368) [-1176.600] -- 0:00:56
110000 -- [-1184.351] (-1180.828) (-1178.472) (-1175.627) * (-1183.773) (-1179.975) [-1182.929] (-1177.877) -- 0:00:56
Average standard deviation of split frequencies: 0.024138
110500 -- (-1179.592) (-1180.496) [-1175.886] (-1175.631) * (-1179.963) (-1177.003) [-1182.423] (-1176.143) -- 0:00:56
111000 -- (-1179.692) (-1179.556) (-1176.842) [-1177.312] * (-1180.295) (-1177.801) [-1179.300] (-1179.552) -- 0:01:04
111500 -- (-1179.406) (-1177.435) [-1176.610] (-1177.925) * (-1179.016) (-1177.640) [-1180.620] (-1177.590) -- 0:01:03
112000 -- (-1179.469) [-1177.988] (-1179.534) (-1177.827) * [-1178.076] (-1179.604) (-1180.000) (-1177.036) -- 0:01:03
112500 -- (-1176.815) (-1181.420) [-1178.001] (-1177.780) * (-1176.624) (-1181.350) (-1177.526) [-1176.501] -- 0:01:03
113000 -- [-1175.971] (-1178.559) (-1175.980) (-1175.922) * (-1175.701) (-1178.428) (-1179.513) [-1176.480] -- 0:01:02
113500 -- [-1176.154] (-1180.685) (-1177.764) (-1177.822) * (-1180.074) (-1178.296) (-1177.823) [-1177.386] -- 0:01:02
114000 -- (-1177.236) [-1178.667] (-1177.621) (-1180.175) * (-1180.312) [-1178.296] (-1179.670) (-1176.271) -- 0:01:02
114500 -- (-1180.157) [-1177.580] (-1178.380) (-1178.924) * (-1181.138) [-1178.084] (-1179.040) (-1176.051) -- 0:01:01
115000 -- (-1179.412) (-1184.336) [-1177.354] (-1181.893) * (-1179.964) (-1176.947) (-1181.796) [-1176.966] -- 0:01:01
Average standard deviation of split frequencies: 0.021900
115500 -- (-1176.495) (-1183.737) [-1178.265] (-1175.464) * [-1176.571] (-1177.668) (-1179.328) (-1176.800) -- 0:01:01
116000 -- [-1175.950] (-1177.266) (-1176.862) (-1180.270) * (-1178.934) (-1178.585) [-1176.849] (-1175.906) -- 0:01:00
116500 -- (-1177.240) (-1176.368) [-1177.075] (-1179.406) * (-1176.927) [-1178.079] (-1178.594) (-1176.199) -- 0:01:00
117000 -- (-1180.837) (-1177.827) [-1179.121] (-1183.859) * [-1177.630] (-1177.857) (-1177.722) (-1176.885) -- 0:01:00
117500 -- (-1178.219) (-1178.663) [-1179.597] (-1182.694) * [-1178.694] (-1177.359) (-1177.821) (-1178.093) -- 0:01:00
118000 -- [-1179.065] (-1181.387) (-1181.384) (-1180.603) * [-1177.715] (-1177.726) (-1177.951) (-1178.861) -- 0:00:59
118500 -- (-1176.919) (-1179.170) [-1177.002] (-1176.460) * (-1175.753) (-1182.573) (-1181.317) [-1177.119] -- 0:00:59
119000 -- (-1176.107) [-1176.063] (-1177.104) (-1176.408) * (-1177.508) (-1178.853) (-1179.260) [-1178.817] -- 0:00:59
119500 -- [-1176.809] (-1176.209) (-1188.486) (-1177.830) * (-1177.253) (-1178.086) (-1180.433) [-1182.121] -- 0:00:58
120000 -- [-1177.018] (-1178.896) (-1179.060) (-1177.343) * [-1177.186] (-1176.918) (-1180.441) (-1181.350) -- 0:00:58
Average standard deviation of split frequencies: 0.021487
120500 -- (-1177.654) [-1178.660] (-1176.858) (-1177.395) * (-1177.369) (-1177.561) [-1176.344] (-1177.115) -- 0:00:58
121000 -- (-1181.753) (-1176.188) (-1176.431) [-1177.362] * [-1176.269] (-1178.084) (-1176.137) (-1175.981) -- 0:00:58
121500 -- (-1182.057) [-1176.590] (-1176.735) (-1176.884) * (-1176.079) (-1178.868) [-1176.366] (-1178.200) -- 0:00:57
122000 -- (-1180.919) (-1177.537) [-1177.777] (-1178.898) * (-1175.736) (-1178.386) [-1177.284] (-1175.980) -- 0:00:57
122500 -- [-1178.225] (-1176.820) (-1178.875) (-1182.112) * (-1175.651) [-1179.137] (-1175.794) (-1177.052) -- 0:00:57
123000 -- (-1175.585) [-1175.931] (-1176.022) (-1182.772) * (-1177.637) [-1177.517] (-1178.526) (-1179.149) -- 0:00:57
123500 -- (-1175.638) (-1177.837) (-1175.529) [-1175.356] * (-1178.482) (-1177.284) [-1176.778] (-1176.645) -- 0:00:56
124000 -- [-1175.979] (-1175.477) (-1179.158) (-1177.600) * (-1177.342) (-1178.064) (-1176.908) [-1176.189] -- 0:00:56
124500 -- (-1177.163) [-1175.233] (-1179.249) (-1178.209) * (-1178.903) (-1178.076) [-1178.073] (-1178.997) -- 0:00:56
125000 -- (-1176.920) [-1175.232] (-1177.826) (-1177.323) * (-1179.822) (-1179.454) [-1178.887] (-1179.603) -- 0:00:56
Average standard deviation of split frequencies: 0.022448
125500 -- (-1176.725) (-1176.919) [-1178.921] (-1179.663) * [-1177.984] (-1178.974) (-1175.175) (-1178.586) -- 0:00:55
126000 -- (-1175.953) [-1177.050] (-1179.210) (-1180.262) * (-1179.345) [-1181.621] (-1176.694) (-1179.785) -- 0:00:55
126500 -- (-1179.362) [-1176.498] (-1177.878) (-1179.425) * [-1175.794] (-1178.146) (-1175.300) (-1178.589) -- 0:00:55
127000 -- [-1176.998] (-1176.369) (-1178.747) (-1178.163) * [-1176.655] (-1176.690) (-1176.797) (-1180.526) -- 0:01:01
127500 -- [-1179.206] (-1176.072) (-1178.018) (-1179.095) * (-1179.686) (-1177.446) [-1176.674] (-1181.688) -- 0:01:01
128000 -- (-1177.453) (-1176.553) (-1177.746) [-1175.699] * (-1176.645) (-1183.173) [-1175.221] (-1181.436) -- 0:01:01
128500 -- (-1177.444) [-1176.716] (-1179.022) (-1177.522) * (-1176.743) (-1179.322) (-1175.325) [-1176.821] -- 0:01:01
129000 -- [-1176.507] (-1177.246) (-1180.887) (-1176.145) * (-1178.343) (-1180.777) (-1175.298) [-1178.355] -- 0:01:00
129500 -- [-1175.611] (-1179.068) (-1178.607) (-1175.835) * [-1176.969] (-1180.740) (-1181.534) (-1176.981) -- 0:01:00
130000 -- (-1178.043) [-1177.439] (-1177.811) (-1176.169) * (-1175.600) (-1179.889) (-1176.556) [-1177.954] -- 0:01:00
Average standard deviation of split frequencies: 0.022596
130500 -- (-1176.577) (-1179.385) [-1177.011] (-1175.767) * [-1175.978] (-1176.148) (-1180.421) (-1176.258) -- 0:00:59
131000 -- (-1177.502) (-1178.222) [-1179.580] (-1177.012) * [-1175.755] (-1177.299) (-1177.319) (-1176.091) -- 0:00:59
131500 -- (-1178.759) [-1176.588] (-1179.952) (-1176.766) * (-1179.525) (-1178.082) (-1179.567) [-1179.481] -- 0:00:59
132000 -- (-1179.696) (-1176.670) (-1178.241) [-1182.023] * (-1175.368) [-1178.611] (-1179.645) (-1177.514) -- 0:00:59
132500 -- (-1176.843) (-1179.619) (-1176.330) [-1179.220] * (-1178.385) [-1178.033] (-1177.125) (-1179.717) -- 0:00:58
133000 -- [-1177.865] (-1176.998) (-1179.272) (-1177.731) * (-1178.594) (-1177.791) [-1177.846] (-1179.371) -- 0:00:58
133500 -- [-1178.056] (-1177.060) (-1176.692) (-1178.271) * [-1180.789] (-1177.427) (-1177.371) (-1177.226) -- 0:00:58
134000 -- (-1177.822) (-1177.417) [-1180.584] (-1177.403) * (-1180.204) (-1178.132) [-1182.322] (-1177.560) -- 0:00:58
134500 -- (-1177.889) [-1177.734] (-1176.597) (-1177.720) * (-1177.946) (-1177.494) (-1181.773) [-1177.038] -- 0:00:57
135000 -- [-1178.544] (-1180.685) (-1176.314) (-1177.184) * [-1176.372] (-1176.496) (-1179.207) (-1176.772) -- 0:00:57
Average standard deviation of split frequencies: 0.022915
135500 -- [-1179.260] (-1178.199) (-1177.825) (-1178.798) * (-1175.948) (-1176.983) [-1176.567] (-1176.772) -- 0:00:57
136000 -- (-1177.355) (-1177.875) [-1176.111] (-1179.818) * (-1177.293) (-1176.364) (-1176.443) [-1176.257] -- 0:00:57
136500 -- (-1178.645) (-1179.229) [-1177.572] (-1177.406) * (-1179.568) [-1175.755] (-1176.579) (-1178.615) -- 0:00:56
137000 -- (-1179.699) (-1177.175) (-1181.184) [-1176.879] * [-1175.641] (-1175.748) (-1176.841) (-1178.420) -- 0:00:56
137500 -- (-1179.228) (-1177.898) [-1177.336] (-1178.087) * (-1178.660) (-1178.322) (-1178.564) [-1181.222] -- 0:00:56
138000 -- (-1180.252) (-1177.827) (-1178.931) [-1177.575] * [-1176.631] (-1176.259) (-1177.047) (-1181.624) -- 0:00:56
138500 -- (-1177.999) (-1179.504) [-1178.504] (-1176.265) * (-1181.414) (-1176.259) (-1176.207) [-1179.910] -- 0:00:55
139000 -- (-1177.468) (-1178.262) [-1178.976] (-1176.734) * (-1177.434) (-1176.643) [-1177.368] (-1178.327) -- 0:00:55
139500 -- [-1177.017] (-1176.256) (-1177.443) (-1176.642) * (-1176.518) (-1176.617) (-1178.577) [-1175.723] -- 0:00:55
140000 -- (-1177.099) [-1176.345] (-1176.863) (-1177.135) * (-1178.054) (-1176.666) (-1175.840) [-1176.637] -- 0:00:55
Average standard deviation of split frequencies: 0.021290
140500 -- (-1176.704) (-1177.147) [-1180.891] (-1177.059) * (-1177.115) (-1177.851) (-1176.596) [-1177.311] -- 0:00:55
141000 -- (-1177.754) [-1177.050] (-1182.212) (-1178.049) * [-1175.631] (-1180.818) (-1175.808) (-1177.595) -- 0:00:54
141500 -- (-1177.479) (-1176.607) [-1176.663] (-1177.081) * (-1178.491) (-1178.433) (-1176.295) [-1176.432] -- 0:00:54
142000 -- (-1179.570) (-1176.450) [-1178.085] (-1178.517) * (-1179.518) (-1177.894) (-1176.434) [-1177.143] -- 0:00:54
142500 -- (-1178.251) (-1175.925) (-1177.747) [-1177.231] * [-1177.963] (-1177.918) (-1176.873) (-1178.143) -- 0:00:54
143000 -- (-1178.762) (-1178.441) (-1180.637) [-1179.044] * (-1177.153) (-1177.238) [-1179.191] (-1179.841) -- 0:00:53
143500 -- (-1178.822) [-1178.600] (-1181.183) (-1178.023) * (-1177.371) [-1178.651] (-1178.445) (-1178.751) -- 0:00:59
144000 -- (-1178.052) (-1178.033) [-1179.317] (-1178.815) * (-1183.366) (-1181.360) (-1177.014) [-1176.460] -- 0:00:59
144500 -- [-1176.521] (-1176.495) (-1181.518) (-1177.891) * (-1178.902) (-1183.463) [-1177.035] (-1176.392) -- 0:00:59
145000 -- [-1176.224] (-1180.182) (-1178.262) (-1178.037) * [-1176.026] (-1180.111) (-1177.194) (-1175.676) -- 0:00:58
Average standard deviation of split frequencies: 0.021462
145500 -- (-1176.283) (-1179.018) [-1179.101] (-1177.018) * (-1175.786) (-1177.235) (-1175.952) [-1176.154] -- 0:00:58
146000 -- [-1176.633] (-1179.511) (-1177.904) (-1177.151) * (-1176.276) (-1178.361) [-1176.475] (-1176.708) -- 0:00:58
146500 -- (-1177.890) (-1176.939) [-1177.344] (-1176.705) * [-1176.595] (-1183.501) (-1179.091) (-1177.165) -- 0:00:58
147000 -- (-1175.416) (-1179.497) [-1179.974] (-1176.712) * [-1176.610] (-1181.328) (-1181.755) (-1176.623) -- 0:00:58
147500 -- (-1175.609) [-1176.379] (-1176.234) (-1177.724) * (-1179.984) [-1176.452] (-1183.484) (-1175.633) -- 0:00:57
148000 -- (-1178.463) (-1176.206) (-1175.503) [-1177.454] * (-1180.882) (-1176.659) (-1177.249) [-1175.580] -- 0:00:57
148500 -- (-1177.171) [-1176.048] (-1175.475) (-1177.924) * (-1180.742) (-1176.955) (-1179.309) [-1177.246] -- 0:00:57
149000 -- (-1177.260) [-1175.725] (-1181.228) (-1177.397) * (-1176.903) (-1178.254) [-1177.752] (-1178.557) -- 0:00:57
149500 -- [-1177.464] (-1175.724) (-1179.345) (-1179.538) * (-1175.119) (-1179.674) [-1179.507] (-1175.760) -- 0:00:56
150000 -- [-1176.857] (-1178.154) (-1179.302) (-1177.757) * (-1176.566) (-1178.269) (-1181.100) [-1179.102] -- 0:00:56
Average standard deviation of split frequencies: 0.020245
150500 -- (-1177.537) (-1176.358) [-1178.169] (-1175.749) * (-1178.595) (-1176.308) (-1179.329) [-1176.468] -- 0:00:56
151000 -- (-1176.895) (-1176.493) (-1178.319) [-1176.922] * (-1178.324) (-1181.144) [-1181.082] (-1177.140) -- 0:00:56
151500 -- (-1177.661) (-1178.213) (-1177.567) [-1175.908] * [-1178.064] (-1180.207) (-1178.326) (-1178.590) -- 0:00:56
152000 -- [-1177.696] (-1178.515) (-1177.102) (-1180.457) * [-1177.151] (-1179.772) (-1178.453) (-1178.233) -- 0:00:55
152500 -- (-1179.731) (-1176.378) [-1178.104] (-1182.135) * (-1179.159) (-1176.507) (-1178.689) [-1177.952] -- 0:00:55
153000 -- (-1179.497) [-1180.653] (-1177.523) (-1179.971) * (-1177.000) (-1177.554) (-1177.032) [-1176.324] -- 0:00:55
153500 -- (-1184.435) (-1179.265) [-1177.523] (-1178.567) * (-1175.323) (-1176.191) (-1177.153) [-1177.483] -- 0:00:55
154000 -- (-1180.624) (-1177.155) (-1177.698) [-1180.436] * (-1176.142) (-1178.874) [-1179.659] (-1181.098) -- 0:00:54
154500 -- (-1177.089) (-1177.720) [-1177.058] (-1179.433) * (-1176.811) [-1177.425] (-1179.170) (-1177.813) -- 0:00:54
155000 -- (-1176.069) (-1178.552) [-1177.528] (-1177.664) * (-1176.653) [-1177.927] (-1180.651) (-1176.256) -- 0:00:54
Average standard deviation of split frequencies: 0.018299
155500 -- [-1180.012] (-1176.198) (-1176.344) (-1177.794) * (-1176.764) [-1176.135] (-1177.788) (-1175.775) -- 0:00:54
156000 -- (-1176.423) (-1178.585) (-1178.427) [-1177.109] * (-1176.349) [-1175.624] (-1175.983) (-1175.569) -- 0:00:54
156500 -- (-1176.721) [-1177.490] (-1177.049) (-1178.639) * (-1176.543) (-1176.378) [-1175.280] (-1176.808) -- 0:00:53
157000 -- (-1181.060) [-1177.457] (-1176.415) (-1175.710) * [-1176.157] (-1179.469) (-1175.893) (-1176.556) -- 0:00:53
157500 -- (-1177.643) (-1176.475) (-1177.892) [-1175.693] * [-1176.170] (-1180.849) (-1176.673) (-1177.180) -- 0:00:53
158000 -- [-1176.681] (-1177.967) (-1179.425) (-1176.558) * (-1175.724) (-1176.354) [-1180.896] (-1177.856) -- 0:00:53
158500 -- (-1178.218) [-1178.309] (-1178.949) (-1175.755) * (-1176.640) (-1180.333) [-1175.526] (-1176.756) -- 0:00:53
159000 -- (-1177.721) (-1179.889) (-1178.719) [-1179.605] * (-1177.875) (-1179.152) [-1178.782] (-1181.863) -- 0:00:52
159500 -- (-1177.246) [-1179.484] (-1178.687) (-1179.504) * [-1180.564] (-1178.041) (-1177.618) (-1177.206) -- 0:00:52
160000 -- (-1179.572) (-1182.754) [-1177.183] (-1181.485) * [-1178.618] (-1177.602) (-1179.145) (-1176.505) -- 0:00:57
Average standard deviation of split frequencies: 0.018093
160500 -- (-1176.928) (-1182.677) (-1181.259) [-1178.510] * (-1178.698) [-1176.942] (-1180.203) (-1178.078) -- 0:00:57
161000 -- [-1175.471] (-1180.925) (-1185.123) (-1175.747) * (-1176.510) (-1177.042) [-1178.098] (-1180.186) -- 0:00:57
161500 -- (-1176.317) (-1180.117) (-1176.727) [-1180.410] * (-1176.838) [-1178.095] (-1176.998) (-1180.964) -- 0:00:57
162000 -- (-1176.451) [-1176.063] (-1177.007) (-1180.374) * (-1178.639) (-1177.152) [-1177.137] (-1179.606) -- 0:00:56
162500 -- (-1176.625) (-1176.884) (-1177.404) [-1177.432] * (-1179.323) [-1178.651] (-1180.160) (-1178.139) -- 0:00:56
163000 -- (-1178.226) (-1176.911) [-1178.225] (-1177.059) * [-1179.061] (-1180.859) (-1180.313) (-1176.657) -- 0:00:56
163500 -- [-1180.716] (-1179.007) (-1181.989) (-1177.041) * (-1177.699) (-1179.596) (-1177.376) [-1179.000] -- 0:00:56
164000 -- (-1176.272) (-1179.742) (-1181.431) [-1177.043] * [-1178.202] (-1177.710) (-1181.793) (-1179.190) -- 0:00:56
164500 -- (-1175.779) [-1178.745] (-1176.149) (-1176.059) * (-1179.809) (-1176.795) [-1176.853] (-1177.744) -- 0:00:55
165000 -- (-1175.641) (-1181.053) (-1176.847) [-1176.306] * [-1178.465] (-1178.339) (-1182.647) (-1177.860) -- 0:00:55
Average standard deviation of split frequencies: 0.018616
165500 -- [-1176.573] (-1181.478) (-1176.410) (-1176.094) * (-1175.774) (-1175.547) [-1179.081] (-1178.456) -- 0:00:55
166000 -- [-1176.835] (-1177.798) (-1178.267) (-1175.494) * (-1177.957) (-1177.337) (-1179.032) [-1179.635] -- 0:00:55
166500 -- (-1177.928) (-1179.180) [-1178.521] (-1176.139) * (-1176.337) [-1176.600] (-1175.665) (-1177.146) -- 0:00:55
167000 -- (-1176.026) (-1179.356) (-1177.604) [-1176.375] * (-1177.841) (-1176.916) [-1175.778] (-1177.343) -- 0:00:54
167500 -- (-1177.103) [-1179.109] (-1181.977) (-1176.802) * [-1176.344] (-1177.998) (-1177.148) (-1179.228) -- 0:00:54
168000 -- (-1175.325) [-1180.184] (-1177.917) (-1175.970) * (-1177.755) (-1177.764) [-1177.249] (-1180.917) -- 0:00:54
168500 -- (-1176.512) (-1176.424) (-1176.015) [-1176.522] * (-1177.616) (-1179.022) [-1175.965] (-1176.718) -- 0:00:54
169000 -- [-1177.250] (-1175.968) (-1176.658) (-1177.820) * (-1179.271) (-1176.718) [-1175.915] (-1179.782) -- 0:00:54
169500 -- (-1175.734) (-1179.401) [-1176.107] (-1177.189) * (-1175.890) (-1175.818) (-1177.149) [-1179.696] -- 0:00:53
170000 -- (-1178.729) (-1177.092) [-1176.199] (-1176.796) * (-1177.291) [-1175.673] (-1178.010) (-1179.813) -- 0:00:53
Average standard deviation of split frequencies: 0.019028
170500 -- [-1177.815] (-1178.403) (-1175.529) (-1180.380) * [-1179.149] (-1175.865) (-1176.989) (-1180.951) -- 0:00:53
171000 -- (-1178.831) [-1182.167] (-1175.532) (-1181.223) * (-1178.825) (-1179.841) (-1176.816) [-1181.909] -- 0:00:53
171500 -- (-1176.491) (-1183.261) [-1175.521] (-1176.520) * (-1177.381) (-1178.110) [-1176.774] (-1179.419) -- 0:00:53
172000 -- (-1177.595) [-1178.752] (-1175.664) (-1176.756) * (-1181.205) (-1176.543) (-1175.449) [-1177.474] -- 0:00:52
172500 -- (-1178.015) (-1178.222) [-1176.026] (-1180.975) * (-1177.949) (-1181.342) (-1177.859) [-1177.924] -- 0:00:52
173000 -- (-1182.362) (-1176.063) (-1175.700) [-1181.086] * (-1178.173) [-1181.782] (-1177.538) (-1177.531) -- 0:00:52
173500 -- (-1181.305) (-1176.479) (-1177.299) [-1178.276] * (-1177.973) [-1182.045] (-1178.047) (-1176.870) -- 0:00:52
174000 -- (-1179.873) (-1176.757) (-1178.417) [-1178.948] * (-1176.473) (-1177.873) (-1178.404) [-1178.006] -- 0:00:52
174500 -- (-1178.023) (-1175.602) [-1176.523] (-1181.462) * [-1179.521] (-1179.001) (-1176.676) (-1177.176) -- 0:00:52
175000 -- [-1176.422] (-1175.640) (-1178.031) (-1178.263) * (-1176.446) (-1177.930) [-1175.823] (-1180.158) -- 0:00:51
Average standard deviation of split frequencies: 0.019537
175500 -- (-1176.011) (-1175.972) (-1177.992) [-1176.119] * (-1177.759) [-1177.012] (-1176.900) (-1179.048) -- 0:00:51
176000 -- [-1175.579] (-1175.972) (-1182.795) (-1179.919) * (-1177.140) [-1177.303] (-1177.111) (-1178.211) -- 0:00:51
176500 -- (-1177.163) (-1180.438) [-1177.637] (-1179.387) * (-1181.069) (-1177.543) (-1176.145) [-1176.700] -- 0:00:55
177000 -- (-1175.672) [-1183.005] (-1179.134) (-1180.907) * (-1187.601) [-1179.681] (-1179.357) (-1177.528) -- 0:00:55
177500 -- (-1181.294) [-1180.483] (-1179.529) (-1175.655) * (-1180.863) [-1177.991] (-1176.741) (-1176.426) -- 0:00:55
178000 -- [-1182.041] (-1179.853) (-1179.153) (-1178.949) * (-1181.197) [-1178.732] (-1176.000) (-1177.441) -- 0:00:55
178500 -- (-1181.258) (-1183.638) [-1178.297] (-1179.245) * (-1179.948) (-1180.914) [-1178.543] (-1180.669) -- 0:00:55
179000 -- (-1179.345) [-1179.092] (-1178.740) (-1176.912) * (-1176.823) [-1179.871] (-1178.588) (-1182.804) -- 0:00:55
179500 -- (-1180.953) (-1178.271) [-1175.172] (-1180.505) * (-1178.114) (-1179.935) (-1176.924) [-1177.623] -- 0:00:54
180000 -- (-1181.693) [-1176.390] (-1177.889) (-1178.817) * (-1175.978) (-1180.911) (-1180.462) [-1176.647] -- 0:00:54
Average standard deviation of split frequencies: 0.018700
180500 -- (-1177.355) (-1176.822) (-1178.783) [-1176.910] * (-1178.773) (-1181.814) (-1181.161) [-1177.146] -- 0:00:54
181000 -- (-1177.984) (-1179.760) [-1178.348] (-1176.545) * (-1177.019) [-1178.640] (-1177.276) (-1177.176) -- 0:00:54
181500 -- (-1179.476) (-1178.260) [-1176.041] (-1181.769) * (-1178.001) [-1180.711] (-1178.330) (-1181.894) -- 0:00:54
182000 -- (-1177.694) (-1177.358) [-1177.258] (-1178.621) * (-1178.134) (-1179.977) (-1176.096) [-1176.659] -- 0:00:53
182500 -- (-1179.259) (-1176.922) (-1177.138) [-1178.928] * [-1177.173] (-1176.948) (-1177.268) (-1179.854) -- 0:00:53
183000 -- [-1177.650] (-1177.544) (-1180.905) (-1176.991) * (-1177.940) [-1177.684] (-1178.583) (-1180.214) -- 0:00:53
183500 -- (-1176.393) [-1181.310] (-1176.622) (-1177.339) * (-1179.914) (-1178.184) [-1176.601] (-1180.114) -- 0:00:53
184000 -- [-1176.575] (-1176.553) (-1177.102) (-1177.190) * (-1177.280) [-1179.379] (-1176.854) (-1181.423) -- 0:00:53
184500 -- [-1177.464] (-1177.191) (-1177.359) (-1177.067) * [-1178.646] (-1179.810) (-1177.078) (-1176.124) -- 0:00:53
185000 -- (-1176.573) (-1176.839) (-1186.290) [-1177.314] * (-1177.184) [-1177.287] (-1177.234) (-1176.387) -- 0:00:52
Average standard deviation of split frequencies: 0.016807
185500 -- [-1176.532] (-1175.691) (-1183.796) (-1176.185) * (-1176.317) [-1177.241] (-1181.029) (-1180.902) -- 0:00:52
186000 -- (-1179.643) [-1176.243] (-1180.181) (-1176.295) * (-1177.344) (-1177.810) (-1176.091) [-1177.564] -- 0:00:52
186500 -- [-1177.909] (-1178.529) (-1177.705) (-1178.252) * (-1176.297) (-1179.474) [-1177.480] (-1177.983) -- 0:00:52
187000 -- [-1178.158] (-1177.017) (-1178.974) (-1178.271) * (-1179.280) (-1178.002) (-1177.995) [-1176.506] -- 0:00:52
187500 -- (-1175.811) (-1178.343) (-1177.452) [-1176.914] * (-1177.947) (-1177.608) (-1178.471) [-1176.559] -- 0:00:52
188000 -- (-1177.821) (-1177.418) [-1180.765] (-1177.431) * [-1177.112] (-1180.637) (-1178.471) (-1180.022) -- 0:00:51
188500 -- (-1176.900) (-1179.521) (-1180.270) [-1177.219] * (-1177.292) (-1176.124) [-1178.702] (-1176.918) -- 0:00:51
189000 -- (-1180.189) [-1177.740] (-1180.238) (-1177.593) * (-1183.179) [-1175.629] (-1180.131) (-1179.292) -- 0:00:51
189500 -- (-1176.281) [-1179.482] (-1182.600) (-1177.530) * [-1185.898] (-1176.746) (-1177.430) (-1178.766) -- 0:00:51
190000 -- (-1175.594) (-1178.693) [-1181.654] (-1176.423) * (-1182.588) (-1177.407) [-1177.775] (-1179.951) -- 0:00:51
Average standard deviation of split frequencies: 0.014544
190500 -- [-1176.644] (-1178.693) (-1181.718) (-1177.392) * (-1178.070) [-1178.123] (-1176.827) (-1178.881) -- 0:00:50
191000 -- (-1180.544) (-1178.855) [-1178.095] (-1177.451) * (-1176.758) [-1177.034] (-1178.511) (-1179.505) -- 0:00:50
191500 -- [-1182.439] (-1178.562) (-1179.710) (-1178.557) * (-1177.791) [-1177.636] (-1177.412) (-1181.325) -- 0:00:50
192000 -- (-1178.202) [-1178.725] (-1179.331) (-1179.433) * (-1176.562) (-1177.105) (-1180.479) [-1177.435] -- 0:00:50
192500 -- (-1177.915) (-1181.550) [-1176.654] (-1176.844) * (-1176.372) (-1178.689) [-1175.653] (-1178.604) -- 0:00:50
193000 -- [-1177.430] (-1177.556) (-1177.143) (-1177.703) * [-1176.445] (-1178.697) (-1178.733) (-1176.136) -- 0:00:54
193500 -- (-1177.520) (-1181.384) [-1176.470] (-1176.618) * (-1179.532) [-1176.033] (-1176.387) (-1179.919) -- 0:00:54
194000 -- (-1179.788) (-1178.034) (-1176.696) [-1175.918] * [-1180.183] (-1176.083) (-1176.099) (-1178.549) -- 0:00:54
194500 -- (-1178.283) [-1178.878] (-1179.793) (-1176.089) * (-1177.259) (-1177.480) (-1175.250) [-1177.228] -- 0:00:53
195000 -- (-1180.309) [-1177.705] (-1179.353) (-1176.037) * (-1176.605) (-1178.516) [-1175.765] (-1178.312) -- 0:00:53
Average standard deviation of split frequencies: 0.015421
195500 -- (-1181.940) (-1182.086) [-1182.009] (-1176.209) * (-1178.454) [-1176.967] (-1175.416) (-1181.383) -- 0:00:53
196000 -- (-1182.754) (-1177.435) (-1176.594) [-1176.131] * [-1178.177] (-1176.974) (-1176.027) (-1178.123) -- 0:00:53
196500 -- (-1182.583) [-1176.385] (-1178.615) (-1176.099) * (-1179.570) [-1177.348] (-1176.188) (-1176.949) -- 0:00:53
197000 -- (-1180.057) [-1176.010] (-1175.630) (-1176.059) * (-1178.092) (-1178.761) [-1175.201] (-1176.841) -- 0:00:52
197500 -- (-1180.132) [-1176.708] (-1180.127) (-1175.763) * (-1182.288) (-1180.471) (-1177.925) [-1176.920] -- 0:00:52
198000 -- (-1177.781) (-1178.851) (-1175.590) [-1175.278] * [-1176.684] (-1179.070) (-1178.766) (-1177.644) -- 0:00:52
198500 -- [-1177.363] (-1177.055) (-1175.807) (-1176.865) * [-1176.781] (-1180.335) (-1177.085) (-1175.855) -- 0:00:52
199000 -- (-1177.926) (-1181.019) [-1176.665] (-1179.636) * [-1176.781] (-1175.629) (-1176.393) (-1175.568) -- 0:00:52
199500 -- [-1180.105] (-1177.966) (-1176.072) (-1177.922) * (-1176.670) (-1177.405) (-1177.699) [-1175.679] -- 0:00:52
200000 -- (-1181.447) [-1177.361] (-1175.547) (-1178.601) * (-1177.040) [-1177.455] (-1180.971) (-1181.133) -- 0:00:51
Average standard deviation of split frequencies: 0.016168
200500 -- (-1178.739) (-1177.432) [-1176.172] (-1178.523) * [-1176.583] (-1176.887) (-1177.452) (-1176.914) -- 0:00:51
201000 -- (-1178.889) [-1177.567] (-1179.421) (-1177.351) * (-1177.421) (-1176.889) [-1177.030] (-1178.165) -- 0:00:51
201500 -- (-1178.144) (-1177.562) (-1185.400) [-1175.598] * (-1175.712) [-1176.619] (-1178.852) (-1175.445) -- 0:00:51
202000 -- (-1180.439) [-1176.746] (-1189.227) (-1175.521) * (-1178.144) (-1175.948) [-1175.586] (-1175.531) -- 0:00:51
202500 -- (-1176.589) (-1181.048) (-1177.874) [-1175.315] * (-1177.562) [-1175.832] (-1176.305) (-1177.191) -- 0:00:51
203000 -- [-1178.180] (-1179.572) (-1178.818) (-1177.194) * (-1179.047) (-1175.676) [-1178.255] (-1178.057) -- 0:00:51
203500 -- [-1177.610] (-1179.087) (-1178.611) (-1176.679) * (-1179.421) [-1176.485] (-1179.589) (-1177.094) -- 0:00:50
204000 -- (-1177.322) [-1177.894] (-1178.411) (-1179.167) * (-1179.768) [-1176.458] (-1177.582) (-1179.238) -- 0:00:50
204500 -- (-1176.877) (-1177.594) (-1178.485) [-1176.459] * (-1176.366) [-1176.803] (-1176.319) (-1177.347) -- 0:00:50
205000 -- (-1176.486) [-1181.271] (-1177.350) (-1177.299) * [-1176.653] (-1182.679) (-1176.817) (-1176.127) -- 0:00:50
Average standard deviation of split frequencies: 0.015346
205500 -- [-1176.614] (-1179.119) (-1178.508) (-1177.639) * (-1187.477) [-1177.688] (-1178.678) (-1175.690) -- 0:00:50
206000 -- (-1176.675) (-1181.755) (-1179.358) [-1176.038] * [-1177.504] (-1180.186) (-1178.842) (-1179.168) -- 0:00:50
206500 -- (-1176.739) (-1177.272) (-1178.845) [-1177.238] * (-1177.255) [-1179.356] (-1176.985) (-1176.926) -- 0:00:49
207000 -- (-1176.522) [-1177.411] (-1176.877) (-1175.875) * [-1184.071] (-1178.802) (-1179.836) (-1176.975) -- 0:00:49
207500 -- [-1178.631] (-1178.237) (-1178.522) (-1176.751) * (-1184.766) (-1178.426) [-1180.376] (-1178.644) -- 0:00:49
208000 -- (-1178.345) [-1178.876] (-1177.383) (-1175.646) * (-1177.299) (-1178.840) (-1178.234) [-1179.807] -- 0:00:49
208500 -- (-1176.824) (-1181.588) (-1177.994) [-1177.573] * (-1177.731) (-1177.267) (-1176.791) [-1179.063] -- 0:00:49
209000 -- (-1176.945) (-1175.936) (-1176.776) [-1177.212] * (-1177.205) (-1175.473) [-1177.565] (-1180.505) -- 0:00:52
209500 -- (-1175.222) [-1176.219] (-1178.702) (-1177.136) * [-1177.625] (-1176.334) (-1178.625) (-1177.318) -- 0:00:52
210000 -- (-1176.514) (-1177.526) [-1177.581] (-1176.799) * [-1177.697] (-1176.473) (-1178.584) (-1176.187) -- 0:00:52
Average standard deviation of split frequencies: 0.014084
210500 -- (-1175.858) (-1179.010) [-1176.535] (-1177.187) * (-1176.187) (-1177.450) [-1178.971] (-1177.423) -- 0:00:52
211000 -- [-1178.078] (-1182.173) (-1176.534) (-1177.078) * (-1177.312) (-1176.349) [-1177.312] (-1178.890) -- 0:00:52
211500 -- [-1177.386] (-1180.891) (-1178.402) (-1177.637) * (-1177.965) [-1176.226] (-1180.879) (-1176.702) -- 0:00:52
212000 -- [-1177.721] (-1181.682) (-1178.141) (-1178.097) * (-1176.988) [-1176.115] (-1179.862) (-1179.955) -- 0:00:52
212500 -- [-1177.563] (-1177.472) (-1176.392) (-1175.401) * (-1181.334) (-1175.512) [-1176.317] (-1178.315) -- 0:00:51
213000 -- (-1175.998) [-1179.981] (-1176.666) (-1178.564) * (-1176.788) [-1176.510] (-1177.977) (-1179.118) -- 0:00:51
213500 -- (-1177.164) [-1176.117] (-1177.020) (-1180.511) * (-1177.773) (-1176.856) [-1178.120] (-1175.905) -- 0:00:51
214000 -- (-1181.416) (-1176.456) (-1175.247) [-1177.870] * (-1177.329) (-1175.834) [-1177.705] (-1178.395) -- 0:00:51
214500 -- (-1188.784) [-1176.980] (-1175.301) (-1176.239) * (-1179.792) (-1178.108) (-1179.343) [-1176.056] -- 0:00:51
215000 -- (-1183.236) (-1178.041) (-1176.001) [-1176.635] * (-1180.053) [-1175.914] (-1178.278) (-1178.556) -- 0:00:51
Average standard deviation of split frequencies: 0.014122
215500 -- [-1176.961] (-1177.339) (-1183.551) (-1177.404) * (-1177.837) (-1180.199) (-1179.667) [-1175.713] -- 0:00:50
216000 -- (-1177.228) (-1184.967) (-1183.388) [-1177.557] * (-1178.586) [-1176.736] (-1177.401) (-1180.362) -- 0:00:50
216500 -- (-1178.394) [-1182.668] (-1177.542) (-1177.786) * (-1179.180) [-1176.787] (-1179.522) (-1178.832) -- 0:00:50
217000 -- (-1177.167) [-1176.625] (-1179.251) (-1177.203) * (-1178.426) (-1176.556) [-1181.173] (-1175.933) -- 0:00:50
217500 -- (-1177.566) (-1182.751) [-1178.998] (-1176.864) * (-1179.516) (-1177.209) [-1176.439] (-1177.212) -- 0:00:50
218000 -- (-1179.702) (-1178.392) (-1179.217) [-1176.719] * [-1176.756] (-1175.798) (-1179.895) (-1177.743) -- 0:00:50
218500 -- [-1177.710] (-1179.422) (-1179.806) (-1175.964) * [-1178.688] (-1175.842) (-1177.833) (-1175.949) -- 0:00:50
219000 -- (-1180.120) [-1176.834] (-1176.870) (-1175.966) * (-1181.785) (-1176.563) [-1176.241] (-1175.609) -- 0:00:49
219500 -- (-1177.803) (-1178.831) (-1179.468) [-1178.189] * [-1176.876] (-1177.635) (-1179.442) (-1177.575) -- 0:00:49
220000 -- (-1180.131) (-1177.482) [-1186.794] (-1175.940) * (-1176.739) (-1178.099) (-1179.221) [-1176.674] -- 0:00:49
Average standard deviation of split frequencies: 0.017090
220500 -- (-1179.770) [-1180.343] (-1180.294) (-1176.752) * (-1176.056) (-1180.112) [-1178.039] (-1177.800) -- 0:00:49
221000 -- (-1177.903) (-1180.264) (-1178.508) [-1176.015] * (-1176.206) (-1179.945) (-1179.545) [-1176.572] -- 0:00:49
221500 -- (-1175.787) (-1177.987) [-1178.418] (-1178.147) * (-1176.348) [-1179.638] (-1175.698) (-1176.187) -- 0:00:49
222000 -- (-1176.299) (-1177.968) [-1176.407] (-1180.232) * [-1176.148] (-1178.479) (-1176.705) (-1176.543) -- 0:00:49
222500 -- (-1176.369) (-1175.938) [-1179.844] (-1177.780) * (-1176.083) [-1180.735] (-1176.183) (-1175.812) -- 0:00:48
223000 -- (-1177.694) (-1177.638) (-1183.602) [-1177.806] * [-1178.021] (-1176.943) (-1180.205) (-1177.280) -- 0:00:48
223500 -- (-1176.287) [-1178.669] (-1179.353) (-1180.293) * (-1177.754) (-1176.589) (-1181.710) [-1178.025] -- 0:00:48
224000 -- (-1177.393) (-1178.021) [-1175.577] (-1179.552) * (-1178.576) (-1175.996) (-1175.855) [-1179.496] -- 0:00:48
224500 -- (-1176.243) (-1179.295) (-1176.050) [-1178.174] * (-1182.740) (-1177.106) (-1175.730) [-1175.639] -- 0:00:48
225000 -- (-1175.661) (-1177.038) (-1176.577) [-1177.275] * [-1180.656] (-1178.815) (-1175.382) (-1181.348) -- 0:00:51
Average standard deviation of split frequencies: 0.015528
225500 -- (-1177.198) (-1178.263) (-1176.619) [-1176.510] * (-1177.515) (-1177.014) [-1175.960] (-1178.615) -- 0:00:51
226000 -- [-1176.359] (-1178.346) (-1182.169) (-1178.156) * (-1179.780) (-1176.189) [-1176.619] (-1178.214) -- 0:00:51
226500 -- (-1175.906) (-1177.530) (-1183.242) [-1181.194] * (-1178.299) (-1177.006) (-1176.175) [-1179.073] -- 0:00:51
227000 -- (-1176.128) (-1181.714) [-1177.408] (-1178.433) * [-1184.633] (-1178.184) (-1178.936) (-1177.838) -- 0:00:51
227500 -- (-1177.002) [-1177.496] (-1176.818) (-1177.317) * [-1178.200] (-1176.793) (-1176.816) (-1179.273) -- 0:00:50
228000 -- (-1178.202) (-1177.230) (-1177.852) [-1177.728] * (-1177.095) (-1180.143) [-1176.936] (-1176.527) -- 0:00:50
228500 -- (-1177.354) (-1178.832) (-1176.413) [-1176.577] * (-1176.348) [-1176.434] (-1176.808) (-1176.376) -- 0:00:50
229000 -- (-1178.466) (-1175.823) (-1177.888) [-1176.859] * (-1180.509) (-1176.769) [-1178.398] (-1175.543) -- 0:00:50
229500 -- [-1178.814] (-1176.520) (-1179.063) (-1181.568) * (-1176.100) (-1179.231) [-1176.682] (-1175.838) -- 0:00:50
230000 -- (-1179.113) [-1176.152] (-1180.214) (-1176.078) * [-1177.406] (-1178.570) (-1177.923) (-1176.057) -- 0:00:50
Average standard deviation of split frequencies: 0.016349
230500 -- (-1178.658) [-1176.991] (-1175.763) (-1176.327) * [-1179.063] (-1178.305) (-1177.927) (-1175.764) -- 0:00:50
231000 -- (-1179.126) [-1175.945] (-1177.289) (-1176.318) * (-1179.150) [-1178.033] (-1175.600) (-1178.665) -- 0:00:49
231500 -- [-1175.970] (-1179.941) (-1178.048) (-1175.353) * (-1178.176) [-1181.320] (-1177.910) (-1180.234) -- 0:00:49
232000 -- [-1177.668] (-1181.922) (-1178.389) (-1176.423) * (-1175.995) [-1180.123] (-1179.318) (-1178.049) -- 0:00:49
232500 -- (-1177.245) [-1183.820] (-1176.088) (-1176.991) * (-1176.194) [-1178.020] (-1187.225) (-1178.163) -- 0:00:49
233000 -- (-1176.745) [-1181.458] (-1178.172) (-1180.237) * (-1179.213) (-1177.908) [-1179.750] (-1180.935) -- 0:00:49
233500 -- (-1177.402) (-1180.202) (-1178.565) [-1175.323] * (-1177.455) [-1182.689] (-1183.190) (-1180.704) -- 0:00:49
234000 -- (-1175.667) [-1181.296] (-1178.469) (-1176.080) * (-1180.244) (-1180.517) [-1176.732] (-1179.504) -- 0:00:49
234500 -- (-1177.700) [-1176.066] (-1177.547) (-1175.431) * [-1177.956] (-1180.280) (-1177.586) (-1177.777) -- 0:00:48
235000 -- (-1177.195) (-1175.941) (-1175.859) [-1176.625] * (-1177.375) (-1180.170) (-1176.230) [-1178.267] -- 0:00:48
Average standard deviation of split frequencies: 0.016979
235500 -- (-1176.554) (-1176.507) [-1175.712] (-1175.907) * (-1179.204) (-1177.527) (-1176.815) [-1177.387] -- 0:00:48
236000 -- [-1181.187] (-1177.991) (-1175.802) (-1176.706) * [-1176.023] (-1179.531) (-1177.387) (-1176.832) -- 0:00:48
236500 -- (-1177.714) (-1175.582) [-1177.226] (-1177.486) * (-1175.809) (-1176.266) [-1177.365] (-1175.643) -- 0:00:48
237000 -- (-1179.692) [-1178.696] (-1177.610) (-1179.719) * [-1180.843] (-1176.837) (-1177.075) (-1180.547) -- 0:00:48
237500 -- (-1179.910) (-1177.704) [-1175.922] (-1180.688) * (-1179.484) [-1179.428] (-1177.207) (-1176.265) -- 0:00:48
238000 -- (-1178.168) [-1177.917] (-1177.176) (-1179.101) * (-1177.683) (-1178.055) (-1176.759) [-1178.115] -- 0:00:48
238500 -- (-1178.761) (-1178.020) (-1178.552) [-1176.534] * (-1178.438) [-1177.016] (-1176.168) (-1176.501) -- 0:00:47
239000 -- (-1181.358) [-1175.591] (-1179.482) (-1176.666) * (-1176.558) (-1177.033) [-1178.010] (-1177.912) -- 0:00:47
239500 -- (-1179.136) [-1176.248] (-1180.825) (-1176.340) * (-1177.609) (-1177.406) [-1176.595] (-1178.672) -- 0:00:47
240000 -- (-1177.140) (-1177.669) (-1182.286) [-1176.318] * [-1176.656] (-1179.009) (-1176.815) (-1178.233) -- 0:00:50
Average standard deviation of split frequencies: 0.016976
240500 -- (-1176.582) (-1177.176) (-1184.508) [-1175.926] * [-1175.806] (-1177.981) (-1176.406) (-1178.642) -- 0:00:50
241000 -- (-1177.251) [-1178.474] (-1180.901) (-1182.736) * (-1180.009) (-1178.011) (-1176.669) [-1179.570] -- 0:00:50
241500 -- [-1176.600] (-1177.184) (-1180.638) (-1183.020) * (-1177.874) (-1179.855) [-1176.757] (-1176.994) -- 0:00:50
242000 -- (-1176.923) (-1179.461) (-1178.970) [-1177.806] * (-1177.460) [-1179.872] (-1176.757) (-1179.467) -- 0:00:50
242500 -- (-1176.416) [-1176.999] (-1176.980) (-1175.812) * (-1178.253) [-1179.597] (-1176.587) (-1179.611) -- 0:00:49
243000 -- [-1177.358] (-1178.222) (-1175.994) (-1175.783) * (-1178.934) (-1179.463) (-1179.368) [-1179.249] -- 0:00:49
243500 -- (-1178.247) (-1178.848) [-1176.658] (-1177.914) * (-1176.217) (-1176.544) (-1179.393) [-1175.409] -- 0:00:49
244000 -- (-1176.720) (-1177.167) (-1175.925) [-1176.397] * (-1177.668) (-1176.165) (-1178.176) [-1176.091] -- 0:00:49
244500 -- (-1179.762) (-1186.803) [-1176.875] (-1177.166) * (-1178.866) (-1179.897) [-1176.422] (-1176.868) -- 0:00:49
245000 -- (-1182.970) [-1178.027] (-1175.634) (-1178.743) * (-1175.652) [-1176.830] (-1181.368) (-1176.192) -- 0:00:49
Average standard deviation of split frequencies: 0.017353
245500 -- (-1181.564) [-1178.060] (-1176.852) (-1177.796) * (-1177.096) [-1178.144] (-1179.980) (-1175.323) -- 0:00:49
246000 -- (-1180.367) (-1176.883) [-1178.398] (-1176.543) * (-1177.154) (-1179.656) [-1178.999] (-1177.475) -- 0:00:49
246500 -- [-1176.907] (-1178.525) (-1178.757) (-1179.927) * (-1178.000) [-1176.205] (-1179.713) (-1176.099) -- 0:00:48
247000 -- [-1176.194] (-1177.345) (-1177.440) (-1178.191) * (-1177.441) [-1177.513] (-1178.786) (-1179.322) -- 0:00:48
247500 -- (-1179.848) (-1178.114) [-1179.129] (-1178.292) * [-1184.456] (-1178.659) (-1177.421) (-1176.426) -- 0:00:48
248000 -- [-1180.607] (-1179.478) (-1182.167) (-1180.129) * (-1176.721) (-1180.033) [-1175.711] (-1176.300) -- 0:00:48
248500 -- (-1177.729) (-1179.485) [-1181.458] (-1178.895) * (-1176.425) [-1180.430] (-1176.001) (-1176.705) -- 0:00:48
249000 -- (-1184.563) [-1176.645] (-1179.042) (-1180.465) * (-1180.921) (-1176.736) [-1177.107] (-1177.614) -- 0:00:48
249500 -- (-1179.378) [-1181.875] (-1177.246) (-1177.984) * (-1176.486) (-1176.465) [-1177.206] (-1175.923) -- 0:00:48
250000 -- (-1177.639) [-1177.864] (-1181.137) (-1180.963) * (-1176.616) (-1179.664) [-1177.138] (-1176.500) -- 0:00:48
Average standard deviation of split frequencies: 0.016299
250500 -- (-1177.154) [-1177.973] (-1178.377) (-1179.073) * (-1178.395) [-1178.709] (-1180.063) (-1179.276) -- 0:00:47
251000 -- [-1176.269] (-1178.763) (-1176.093) (-1180.028) * (-1181.147) (-1180.648) (-1177.643) [-1175.891] -- 0:00:47
251500 -- (-1179.551) [-1179.430] (-1178.601) (-1184.689) * [-1180.832] (-1180.648) (-1176.371) (-1176.406) -- 0:00:47
252000 -- (-1181.218) (-1177.873) [-1177.957] (-1181.690) * (-1178.483) (-1177.696) [-1176.069] (-1179.647) -- 0:00:47
252500 -- (-1179.166) (-1176.416) [-1177.809] (-1179.600) * [-1178.917] (-1177.774) (-1175.869) (-1177.074) -- 0:00:47
253000 -- [-1176.028] (-1176.342) (-1177.265) (-1180.874) * (-1178.949) (-1179.620) [-1175.922] (-1177.135) -- 0:00:47
253500 -- (-1176.133) (-1176.680) (-1179.220) [-1176.372] * (-1178.313) (-1176.103) (-1176.113) [-1176.014] -- 0:00:47
254000 -- (-1176.986) (-1179.119) [-1179.915] (-1177.396) * [-1176.567] (-1176.235) (-1179.141) (-1183.219) -- 0:00:46
254500 -- (-1176.788) (-1184.207) [-1177.313] (-1175.684) * (-1176.637) [-1177.584] (-1182.252) (-1175.881) -- 0:00:46
255000 -- (-1178.258) [-1178.809] (-1176.819) (-1177.976) * (-1177.558) [-1175.660] (-1179.606) (-1180.745) -- 0:00:46
Average standard deviation of split frequencies: 0.016266
255500 -- [-1179.718] (-1179.657) (-1176.774) (-1178.321) * (-1188.020) (-1176.141) [-1180.155] (-1184.647) -- 0:00:49
256000 -- [-1175.973] (-1175.359) (-1177.571) (-1178.388) * (-1178.637) [-1176.449] (-1178.631) (-1180.729) -- 0:00:49
256500 -- (-1176.012) (-1177.804) (-1176.661) [-1175.428] * (-1179.171) [-1176.889] (-1178.898) (-1183.269) -- 0:00:49
257000 -- [-1176.698] (-1176.610) (-1177.472) (-1177.141) * [-1181.931] (-1176.010) (-1179.526) (-1180.232) -- 0:00:49
257500 -- (-1175.804) [-1176.635] (-1178.169) (-1176.457) * (-1176.221) (-1177.229) (-1178.452) [-1177.266] -- 0:00:49
258000 -- (-1180.835) [-1176.233] (-1176.668) (-1177.179) * [-1176.380] (-1179.090) (-1176.817) (-1176.384) -- 0:00:48
258500 -- (-1182.451) (-1175.962) [-1176.575] (-1178.008) * (-1177.227) [-1181.451] (-1178.104) (-1180.217) -- 0:00:48
259000 -- (-1185.399) (-1182.464) (-1179.935) [-1176.379] * (-1176.513) (-1177.301) (-1176.934) [-1177.024] -- 0:00:48
259500 -- (-1178.815) [-1179.958] (-1177.487) (-1175.923) * (-1176.871) (-1177.045) [-1177.082] (-1175.762) -- 0:00:48
260000 -- [-1176.645] (-1182.213) (-1179.249) (-1178.437) * [-1177.831] (-1177.325) (-1178.036) (-1176.681) -- 0:00:48
Average standard deviation of split frequencies: 0.015573
260500 -- (-1176.985) (-1178.338) (-1179.984) [-1177.663] * [-1181.151] (-1177.315) (-1176.460) (-1180.882) -- 0:00:48
261000 -- (-1180.132) (-1179.250) [-1178.483] (-1176.942) * (-1175.780) (-1177.469) [-1176.756] (-1181.761) -- 0:00:48
261500 -- (-1184.041) (-1178.527) (-1177.977) [-1175.965] * (-1177.652) (-1177.119) (-1179.930) [-1176.358] -- 0:00:48
262000 -- (-1181.036) (-1178.492) (-1177.655) [-1176.253] * (-1176.248) [-1176.449] (-1178.900) (-1176.886) -- 0:00:47
262500 -- (-1177.492) [-1177.692] (-1178.594) (-1177.354) * (-1179.378) [-1176.460] (-1176.076) (-1176.360) -- 0:00:47
263000 -- [-1177.224] (-1176.250) (-1178.960) (-1176.936) * (-1179.850) (-1181.088) (-1177.346) [-1176.858] -- 0:00:47
263500 -- (-1177.205) [-1176.555] (-1177.634) (-1177.525) * [-1181.548] (-1181.532) (-1180.455) (-1177.303) -- 0:00:47
264000 -- [-1177.454] (-1176.555) (-1176.791) (-1177.168) * (-1176.037) (-1182.857) (-1176.180) [-1180.089] -- 0:00:47
264500 -- (-1183.170) [-1176.857] (-1177.575) (-1177.396) * [-1176.773] (-1180.335) (-1178.841) (-1178.918) -- 0:00:47
265000 -- (-1182.869) (-1177.640) (-1177.102) [-1177.226] * [-1176.467] (-1178.328) (-1181.586) (-1177.038) -- 0:00:47
Average standard deviation of split frequencies: 0.015654
265500 -- (-1179.936) [-1175.962] (-1177.729) (-1177.955) * (-1177.436) [-1176.542] (-1181.145) (-1179.407) -- 0:00:47
266000 -- (-1178.197) (-1177.678) [-1176.929] (-1176.425) * [-1179.701] (-1176.242) (-1179.998) (-1176.925) -- 0:00:46
266500 -- (-1176.590) (-1176.060) (-1177.625) [-1176.442] * (-1177.594) [-1176.830] (-1176.764) (-1177.426) -- 0:00:46
267000 -- [-1176.590] (-1177.516) (-1178.273) (-1177.500) * (-1177.795) (-1180.266) [-1176.133] (-1176.070) -- 0:00:46
267500 -- (-1178.190) [-1177.505] (-1178.000) (-1179.503) * (-1178.350) (-1179.729) [-1175.672] (-1176.078) -- 0:00:46
268000 -- (-1179.622) (-1176.578) [-1177.320] (-1180.369) * (-1178.982) (-1177.065) (-1179.383) [-1176.078] -- 0:00:46
268500 -- [-1177.919] (-1176.071) (-1175.697) (-1176.642) * (-1179.458) [-1177.183] (-1176.795) (-1176.173) -- 0:00:46
269000 -- (-1178.572) (-1175.427) (-1175.629) [-1179.220] * (-1176.755) (-1179.559) (-1178.889) [-1176.323] -- 0:00:46
269500 -- (-1180.018) [-1175.198] (-1175.482) (-1180.427) * (-1179.575) [-1176.326] (-1177.133) (-1178.209) -- 0:00:46
270000 -- (-1176.834) (-1175.583) (-1175.482) [-1176.646] * (-1182.170) (-1176.343) (-1176.117) [-1178.318] -- 0:00:45
Average standard deviation of split frequencies: 0.015367
270500 -- (-1175.594) [-1177.813] (-1178.682) (-1176.224) * (-1186.621) (-1176.851) [-1176.974] (-1178.054) -- 0:00:45
271000 -- (-1176.013) (-1177.475) [-1178.210] (-1176.240) * (-1177.495) (-1177.841) [-1177.059] (-1178.675) -- 0:00:45
271500 -- (-1177.660) [-1178.803] (-1177.257) (-1175.821) * (-1176.600) (-1179.928) [-1176.326] (-1178.683) -- 0:00:45
272000 -- (-1176.536) (-1183.863) (-1178.180) [-1175.846] * (-1177.767) (-1177.276) [-1175.759] (-1180.562) -- 0:00:48
272500 -- (-1177.016) (-1176.273) [-1178.271] (-1175.597) * (-1178.424) (-1175.578) [-1176.737] (-1178.863) -- 0:00:48
273000 -- (-1176.418) (-1176.319) [-1177.179] (-1178.449) * (-1179.413) (-1175.923) [-1177.887] (-1179.345) -- 0:00:47
273500 -- (-1176.184) (-1179.190) (-1176.805) [-1178.634] * (-1180.500) (-1178.941) [-1176.147] (-1176.880) -- 0:00:47
274000 -- (-1176.020) [-1179.190] (-1178.768) (-1176.175) * [-1178.579] (-1181.841) (-1179.729) (-1176.317) -- 0:00:47
274500 -- [-1175.807] (-1178.839) (-1177.449) (-1176.935) * (-1176.094) (-1182.778) (-1178.757) [-1180.637] -- 0:00:47
275000 -- (-1176.013) [-1177.647] (-1176.457) (-1181.644) * (-1175.913) (-1176.457) [-1178.972] (-1178.493) -- 0:00:47
Average standard deviation of split frequencies: 0.014367
275500 -- (-1176.678) [-1179.763] (-1176.148) (-1176.667) * (-1177.323) (-1180.529) [-1178.737] (-1177.810) -- 0:00:47
276000 -- (-1177.827) (-1181.190) (-1179.363) [-1176.010] * (-1179.719) (-1176.813) (-1176.811) [-1177.976] -- 0:00:47
276500 -- (-1177.350) (-1179.354) [-1177.399] (-1175.374) * (-1177.901) (-1176.831) [-1176.852] (-1178.525) -- 0:00:47
277000 -- (-1178.905) [-1177.115] (-1179.266) (-1176.593) * [-1177.544] (-1178.056) (-1178.499) (-1175.309) -- 0:00:46
277500 -- (-1177.267) (-1177.882) [-1178.398] (-1179.333) * [-1176.133] (-1176.716) (-1177.333) (-1179.851) -- 0:00:46
278000 -- (-1181.123) (-1176.493) [-1176.873] (-1176.518) * (-1175.435) (-1175.659) [-1178.472] (-1181.403) -- 0:00:46
278500 -- (-1176.638) (-1176.422) (-1178.636) [-1175.805] * (-1178.717) (-1179.102) (-1178.896) [-1180.244] -- 0:00:46
279000 -- [-1177.000] (-1178.146) (-1180.147) (-1175.676) * (-1179.144) (-1176.206) [-1177.720] (-1178.737) -- 0:00:46
279500 -- [-1175.659] (-1178.587) (-1178.801) (-1180.785) * (-1177.619) (-1175.924) (-1178.350) [-1176.332] -- 0:00:46
280000 -- (-1176.909) [-1177.485] (-1177.743) (-1175.502) * (-1177.663) (-1178.263) (-1176.798) [-1178.460] -- 0:00:46
Average standard deviation of split frequencies: 0.013717
280500 -- [-1178.189] (-1175.313) (-1177.147) (-1176.531) * (-1177.925) (-1178.141) [-1176.788] (-1177.076) -- 0:00:46
281000 -- (-1184.377) [-1175.799] (-1177.094) (-1177.195) * (-1178.502) (-1180.925) [-1175.270] (-1176.696) -- 0:00:46
281500 -- (-1178.951) (-1178.542) [-1178.221] (-1177.188) * (-1177.088) (-1177.298) (-1179.492) [-1176.707] -- 0:00:45
282000 -- (-1177.435) [-1177.644] (-1177.233) (-1176.087) * [-1178.869] (-1177.389) (-1178.783) (-1176.380) -- 0:00:45
282500 -- (-1176.492) (-1177.422) [-1177.459] (-1178.669) * (-1181.833) (-1177.231) (-1179.392) [-1184.223] -- 0:00:45
283000 -- [-1178.049] (-1181.997) (-1178.288) (-1177.997) * (-1177.934) (-1180.123) (-1176.635) [-1177.348] -- 0:00:45
283500 -- (-1177.420) [-1181.165] (-1177.886) (-1177.395) * (-1178.903) (-1177.235) (-1181.005) [-1177.338] -- 0:00:45
284000 -- [-1177.066] (-1176.590) (-1177.449) (-1178.561) * (-1180.198) (-1177.748) (-1179.297) [-1175.890] -- 0:00:45
284500 -- (-1175.805) [-1177.756] (-1177.442) (-1178.153) * (-1177.310) (-1177.259) [-1181.149] (-1176.038) -- 0:00:45
285000 -- (-1176.571) (-1177.627) (-1179.374) [-1177.633] * [-1178.699] (-1177.902) (-1178.525) (-1177.666) -- 0:00:45
Average standard deviation of split frequencies: 0.012911
285500 -- (-1177.576) (-1177.438) (-1178.246) [-1175.654] * (-1177.801) (-1176.555) (-1178.221) [-1178.169] -- 0:00:45
286000 -- (-1179.270) (-1177.352) (-1177.696) [-1175.636] * (-1180.625) (-1176.407) [-1177.946] (-1175.945) -- 0:00:44
286500 -- [-1176.924] (-1177.274) (-1179.028) (-1177.353) * (-1177.479) (-1178.948) (-1177.019) [-1178.824] -- 0:00:44
287000 -- (-1179.806) (-1175.591) (-1179.601) [-1177.222] * (-1182.099) (-1177.924) [-1176.417] (-1176.013) -- 0:00:44
287500 -- (-1178.764) (-1180.056) (-1178.394) [-1177.958] * (-1180.675) (-1175.911) [-1175.780] (-1176.496) -- 0:00:44
288000 -- (-1175.945) [-1175.560] (-1178.626) (-1178.774) * [-1177.843] (-1176.900) (-1176.103) (-1176.057) -- 0:00:44
288500 -- (-1175.682) (-1177.007) [-1179.017] (-1177.691) * (-1179.463) [-1178.509] (-1181.731) (-1176.797) -- 0:00:46
289000 -- [-1177.422] (-1180.157) (-1176.937) (-1177.369) * (-1179.046) (-1181.337) (-1177.151) [-1178.316] -- 0:00:46
289500 -- [-1177.061] (-1179.561) (-1177.273) (-1176.922) * (-1176.478) (-1179.638) [-1178.140] (-1179.271) -- 0:00:46
290000 -- (-1177.318) [-1179.330] (-1179.266) (-1176.177) * (-1179.479) [-1178.760] (-1182.302) (-1179.279) -- 0:00:46
Average standard deviation of split frequencies: 0.012974
290500 -- (-1179.036) (-1182.283) (-1178.663) [-1175.250] * (-1181.819) [-1178.845] (-1180.710) (-1176.870) -- 0:00:46
291000 -- [-1178.188] (-1180.066) (-1181.466) (-1176.808) * (-1179.711) [-1177.052] (-1180.238) (-1176.360) -- 0:00:46
291500 -- [-1177.123] (-1178.566) (-1182.289) (-1178.716) * (-1176.381) [-1177.689] (-1179.300) (-1176.471) -- 0:00:46
292000 -- (-1180.292) (-1178.405) [-1175.456] (-1179.793) * [-1176.460] (-1177.214) (-1176.814) (-1184.637) -- 0:00:46
292500 -- (-1178.559) [-1178.736] (-1179.474) (-1179.907) * (-1180.076) (-1177.186) [-1176.820] (-1179.364) -- 0:00:45
293000 -- (-1177.558) (-1182.913) (-1180.664) [-1177.785] * (-1177.410) [-1176.456] (-1177.076) (-1176.690) -- 0:00:45
293500 -- (-1179.227) (-1176.536) [-1179.480] (-1178.793) * (-1177.323) [-1178.489] (-1175.541) (-1176.214) -- 0:00:45
294000 -- [-1177.113] (-1181.416) (-1179.951) (-1179.489) * [-1176.727] (-1177.065) (-1176.299) (-1177.648) -- 0:00:45
294500 -- [-1178.040] (-1179.750) (-1176.533) (-1177.819) * [-1178.438] (-1177.072) (-1178.165) (-1178.947) -- 0:00:45
295000 -- (-1177.569) (-1179.269) (-1179.595) [-1177.629] * (-1177.893) (-1177.928) [-1176.993] (-1176.660) -- 0:00:45
Average standard deviation of split frequencies: 0.012918
295500 -- [-1176.448] (-1179.803) (-1176.181) (-1176.243) * (-1176.960) [-1176.625] (-1176.677) (-1175.948) -- 0:00:45
296000 -- (-1176.443) (-1178.618) (-1176.310) [-1176.612] * (-1181.322) (-1175.919) [-1176.671] (-1182.076) -- 0:00:45
296500 -- (-1176.973) (-1177.061) [-1181.475] (-1177.860) * (-1176.104) (-1179.245) [-1176.413] (-1180.975) -- 0:00:45
297000 -- (-1177.363) (-1178.307) (-1178.474) [-1177.131] * (-1175.999) (-1178.299) [-1176.485] (-1180.783) -- 0:00:44
297500 -- [-1177.588] (-1177.629) (-1178.571) (-1177.975) * (-1176.287) [-1176.247] (-1178.484) (-1181.774) -- 0:00:44
298000 -- (-1177.216) (-1177.603) (-1179.422) [-1176.993] * [-1176.668] (-1176.851) (-1180.324) (-1177.050) -- 0:00:44
298500 -- (-1179.994) [-1177.875] (-1177.976) (-1178.789) * (-1177.737) (-1177.875) (-1183.309) [-1176.929] -- 0:00:44
299000 -- [-1179.089] (-1175.373) (-1177.561) (-1179.013) * (-1180.035) (-1177.029) [-1177.665] (-1177.918) -- 0:00:44
299500 -- (-1178.048) (-1178.254) (-1177.236) [-1177.064] * (-1181.392) (-1176.788) (-1177.765) [-1176.401] -- 0:00:44
300000 -- (-1178.434) (-1176.645) (-1176.968) [-1180.735] * (-1177.387) (-1176.631) [-1176.297] (-1175.553) -- 0:00:44
Average standard deviation of split frequencies: 0.012717
300500 -- (-1180.831) (-1176.646) (-1177.351) [-1180.654] * (-1179.084) [-1177.084] (-1176.230) (-1175.158) -- 0:00:44
301000 -- (-1178.210) (-1178.289) [-1176.534] (-1178.749) * (-1179.425) (-1176.436) [-1177.397] (-1176.828) -- 0:00:44
301500 -- [-1177.478] (-1175.666) (-1177.544) (-1176.395) * (-1178.857) [-1183.007] (-1180.397) (-1181.265) -- 0:00:44
302000 -- (-1177.554) (-1175.840) (-1178.167) [-1177.247] * (-1178.135) (-1179.761) (-1177.522) [-1180.844] -- 0:00:43
302500 -- (-1175.740) [-1176.697] (-1178.148) (-1176.124) * (-1177.037) (-1177.427) [-1177.753] (-1178.153) -- 0:00:43
303000 -- (-1177.624) [-1175.274] (-1179.496) (-1175.925) * (-1175.517) (-1176.601) [-1178.195] (-1177.736) -- 0:00:43
303500 -- (-1185.973) [-1175.604] (-1180.779) (-1178.544) * (-1178.660) (-1178.014) [-1179.816] (-1177.962) -- 0:00:43
304000 -- (-1179.649) (-1177.647) (-1177.319) [-1178.373] * [-1176.172] (-1175.831) (-1178.294) (-1178.641) -- 0:00:43
304500 -- (-1177.171) (-1176.356) (-1177.101) [-1177.854] * [-1176.326] (-1176.531) (-1176.454) (-1176.974) -- 0:00:45
305000 -- (-1177.279) (-1175.650) (-1177.578) [-1178.573] * (-1177.300) [-1177.048] (-1178.128) (-1180.036) -- 0:00:45
Average standard deviation of split frequencies: 0.012410
305500 -- [-1177.698] (-1176.818) (-1177.763) (-1178.718) * (-1177.452) (-1176.616) (-1176.272) [-1175.491] -- 0:00:45
306000 -- (-1176.742) [-1176.988] (-1183.131) (-1177.291) * (-1176.500) [-1176.482] (-1176.121) (-1182.927) -- 0:00:45
306500 -- [-1181.653] (-1175.581) (-1178.505) (-1178.432) * (-1178.511) (-1178.859) (-1179.197) [-1180.836] -- 0:00:45
307000 -- (-1177.080) (-1176.884) (-1181.987) [-1179.547] * (-1179.489) (-1177.762) [-1179.845] (-1179.088) -- 0:00:45
307500 -- (-1177.155) (-1177.081) [-1181.788] (-1176.601) * (-1177.940) (-1179.379) (-1180.470) [-1176.603] -- 0:00:45
308000 -- [-1176.677] (-1177.988) (-1179.629) (-1177.554) * (-1177.511) (-1177.723) [-1177.308] (-1177.263) -- 0:00:44
308500 -- (-1181.145) [-1177.812] (-1176.284) (-1176.541) * (-1178.481) [-1176.927] (-1177.920) (-1179.207) -- 0:00:44
309000 -- (-1175.809) [-1177.128] (-1179.753) (-1177.395) * (-1178.631) [-1176.216] (-1176.728) (-1179.449) -- 0:00:44
309500 -- (-1175.574) [-1178.098] (-1178.708) (-1179.357) * (-1180.275) [-1177.511] (-1177.110) (-1177.754) -- 0:00:44
310000 -- [-1178.180] (-1178.237) (-1176.627) (-1178.188) * [-1179.884] (-1177.087) (-1179.618) (-1177.129) -- 0:00:44
Average standard deviation of split frequencies: 0.013488
310500 -- (-1178.370) [-1178.059] (-1179.549) (-1176.912) * [-1178.882] (-1179.945) (-1176.031) (-1179.672) -- 0:00:44
311000 -- (-1177.384) (-1177.895) [-1177.690] (-1181.649) * (-1177.159) (-1180.356) (-1176.633) [-1178.045] -- 0:00:44
311500 -- (-1175.407) (-1176.452) (-1184.124) [-1177.760] * [-1177.785] (-1179.772) (-1176.472) (-1176.502) -- 0:00:44
312000 -- (-1176.710) [-1177.149] (-1176.738) (-1175.544) * (-1180.138) [-1181.651] (-1180.352) (-1176.646) -- 0:00:44
312500 -- (-1179.011) (-1176.572) [-1178.145] (-1179.664) * [-1183.210] (-1176.742) (-1178.013) (-1178.398) -- 0:00:44
313000 -- (-1178.218) (-1177.032) (-1178.455) [-1177.312] * (-1175.880) (-1176.827) (-1179.360) [-1176.948] -- 0:00:43
313500 -- (-1176.260) (-1177.380) [-1177.329] (-1176.048) * (-1177.169) [-1176.489] (-1179.352) (-1175.800) -- 0:00:43
314000 -- [-1178.353] (-1175.868) (-1180.531) (-1176.406) * [-1178.134] (-1176.545) (-1177.765) (-1176.734) -- 0:00:43
314500 -- (-1176.006) (-1176.514) (-1178.052) [-1175.643] * [-1178.271] (-1175.412) (-1180.364) (-1176.315) -- 0:00:43
315000 -- [-1176.729] (-1178.757) (-1176.134) (-1179.899) * [-1177.210] (-1175.972) (-1175.826) (-1177.803) -- 0:00:43
Average standard deviation of split frequencies: 0.014211
315500 -- (-1176.163) (-1177.484) [-1175.791] (-1178.120) * (-1181.101) (-1178.565) (-1176.249) [-1177.759] -- 0:00:43
316000 -- (-1177.832) (-1176.535) [-1175.468] (-1175.988) * (-1178.883) (-1183.186) (-1182.995) [-1181.407] -- 0:00:43
316500 -- [-1176.431] (-1175.806) (-1177.456) (-1177.045) * [-1176.503] (-1178.610) (-1181.867) (-1181.731) -- 0:00:43
317000 -- [-1175.452] (-1176.516) (-1177.829) (-1176.477) * (-1175.914) [-1179.072] (-1179.042) (-1176.816) -- 0:00:43
317500 -- (-1177.301) (-1178.161) (-1182.110) [-1178.784] * (-1176.260) (-1180.167) (-1176.330) [-1177.646] -- 0:00:42
318000 -- (-1179.012) (-1177.383) [-1176.941] (-1182.629) * (-1177.299) (-1177.340) [-1177.168] (-1175.700) -- 0:00:42
318500 -- (-1177.535) [-1175.653] (-1178.500) (-1176.053) * (-1179.033) [-1177.241] (-1176.587) (-1176.352) -- 0:00:42
319000 -- (-1177.535) [-1178.679] (-1178.084) (-1178.073) * [-1177.366] (-1179.675) (-1175.564) (-1181.505) -- 0:00:42
319500 -- (-1176.077) (-1178.892) [-1177.235] (-1178.661) * [-1177.413] (-1175.805) (-1176.383) (-1177.880) -- 0:00:42
320000 -- (-1175.283) [-1178.813] (-1176.065) (-1178.030) * (-1176.888) (-1178.003) [-1176.014] (-1177.869) -- 0:00:42
Average standard deviation of split frequencies: 0.013557
320500 -- (-1176.019) (-1178.537) [-1176.534] (-1179.927) * [-1177.734] (-1179.291) (-1179.018) (-1177.725) -- 0:00:42
321000 -- (-1176.962) (-1177.387) [-1177.865] (-1176.319) * [-1181.491] (-1177.095) (-1175.877) (-1179.376) -- 0:00:44
321500 -- (-1177.023) (-1181.594) (-1176.441) [-1176.746] * (-1175.638) (-1177.805) (-1180.044) [-1179.039] -- 0:00:44
322000 -- (-1179.324) (-1177.854) [-1177.909] (-1175.968) * (-1177.479) (-1176.795) [-1179.108] (-1177.134) -- 0:00:44
322500 -- (-1178.415) (-1179.254) [-1176.247] (-1177.684) * (-1176.798) (-1178.041) [-1176.848] (-1176.374) -- 0:00:44
323000 -- [-1178.670] (-1180.577) (-1179.264) (-1177.616) * (-1175.449) (-1177.585) (-1176.056) [-1175.337] -- 0:00:44
323500 -- [-1176.855] (-1178.170) (-1180.528) (-1183.362) * (-1175.925) [-1179.089] (-1177.253) (-1179.144) -- 0:00:43
324000 -- (-1177.878) (-1175.492) (-1176.881) [-1177.139] * (-1177.527) [-1178.378] (-1176.505) (-1178.594) -- 0:00:43
324500 -- (-1176.748) [-1175.858] (-1175.289) (-1179.451) * (-1180.288) (-1178.665) (-1178.814) [-1177.311] -- 0:00:43
325000 -- (-1177.471) (-1178.589) [-1176.223] (-1175.317) * (-1181.867) [-1177.865] (-1176.165) (-1178.630) -- 0:00:43
Average standard deviation of split frequencies: 0.014139
325500 -- (-1177.612) (-1176.713) [-1175.329] (-1176.267) * (-1179.082) (-1177.918) [-1176.532] (-1177.542) -- 0:00:43
326000 -- (-1175.977) (-1176.806) [-1175.328] (-1176.736) * (-1179.809) (-1178.996) (-1178.481) [-1178.695] -- 0:00:43
326500 -- (-1177.590) (-1179.462) [-1180.923] (-1175.398) * (-1176.481) [-1177.895] (-1176.781) (-1177.488) -- 0:00:43
327000 -- [-1176.510] (-1179.494) (-1182.281) (-1176.427) * [-1177.276] (-1179.173) (-1178.970) (-1178.049) -- 0:00:43
327500 -- (-1176.250) [-1175.957] (-1177.395) (-1181.405) * (-1176.896) (-1180.350) (-1177.455) [-1179.291] -- 0:00:43
328000 -- (-1175.450) [-1177.324] (-1176.631) (-1183.996) * (-1177.143) [-1178.261] (-1179.580) (-1176.110) -- 0:00:43
328500 -- (-1176.931) (-1179.047) [-1176.303] (-1176.121) * (-1176.511) (-1179.652) [-1177.523] (-1175.348) -- 0:00:42
329000 -- (-1176.583) [-1176.900] (-1176.124) (-1177.078) * (-1183.578) (-1176.936) [-1177.311] (-1177.219) -- 0:00:42
329500 -- (-1178.681) (-1177.304) [-1179.704] (-1179.169) * (-1176.688) [-1176.508] (-1177.800) (-1179.789) -- 0:00:42
330000 -- [-1178.455] (-1178.203) (-1177.672) (-1176.106) * (-1178.995) (-1175.808) [-1177.623] (-1178.589) -- 0:00:42
Average standard deviation of split frequencies: 0.014019
330500 -- (-1180.372) (-1180.830) (-1177.278) [-1176.633] * (-1176.654) (-1176.767) [-1176.179] (-1178.502) -- 0:00:42
331000 -- (-1176.379) (-1175.643) [-1177.264] (-1177.321) * (-1175.978) (-1177.670) (-1177.114) [-1178.837] -- 0:00:42
331500 -- (-1180.030) (-1179.190) [-1177.123] (-1178.692) * (-1178.503) (-1179.118) [-1179.200] (-1176.589) -- 0:00:42
332000 -- (-1179.452) (-1179.197) [-1176.410] (-1178.004) * (-1177.447) (-1177.761) [-1176.685] (-1178.123) -- 0:00:42
332500 -- [-1178.573] (-1176.234) (-1177.073) (-1177.334) * (-1179.887) (-1177.698) [-1176.366] (-1179.102) -- 0:00:42
333000 -- (-1177.755) [-1176.673] (-1180.510) (-1178.968) * (-1175.657) (-1178.658) [-1177.748] (-1176.921) -- 0:00:42
333500 -- (-1177.181) [-1178.708] (-1178.745) (-1181.803) * (-1185.109) (-1178.274) (-1179.519) [-1175.991] -- 0:00:41
334000 -- (-1178.235) (-1178.786) [-1178.745] (-1179.847) * (-1186.915) [-1177.399] (-1179.301) (-1176.824) -- 0:00:41
334500 -- (-1177.100) (-1181.156) [-1176.464] (-1178.947) * (-1176.698) (-1176.597) (-1180.488) [-1176.401] -- 0:00:41
335000 -- (-1176.985) (-1179.159) [-1175.486] (-1178.042) * (-1176.418) (-1176.712) (-1180.537) [-1176.699] -- 0:00:41
Average standard deviation of split frequencies: 0.012462
335500 -- (-1177.507) (-1180.613) [-1176.908] (-1179.895) * (-1177.873) [-1176.743] (-1177.718) (-1177.940) -- 0:00:41
336000 -- (-1177.945) [-1178.430] (-1178.592) (-1175.780) * [-1175.944] (-1176.077) (-1179.373) (-1178.926) -- 0:00:41
336500 -- (-1177.974) [-1177.520] (-1177.989) (-1178.459) * (-1180.680) [-1176.008] (-1179.905) (-1179.925) -- 0:00:41
337000 -- (-1179.485) [-1178.402] (-1177.863) (-1178.046) * (-1177.243) [-1175.378] (-1179.715) (-1180.322) -- 0:00:41
337500 -- [-1179.611] (-1177.653) (-1181.753) (-1176.816) * [-1178.097] (-1176.105) (-1176.505) (-1179.891) -- 0:00:43
338000 -- [-1179.640] (-1176.468) (-1176.579) (-1177.395) * [-1176.588] (-1175.692) (-1177.281) (-1177.941) -- 0:00:43
338500 -- (-1177.350) (-1177.139) [-1177.786] (-1176.975) * (-1175.877) (-1176.804) (-1177.959) [-1179.470] -- 0:00:42
339000 -- (-1177.189) (-1175.776) (-1179.723) [-1176.895] * (-1176.185) (-1180.144) (-1179.844) [-1179.167] -- 0:00:42
339500 -- (-1177.927) (-1177.259) (-1180.405) [-1176.147] * (-1179.603) (-1181.291) (-1177.703) [-1176.821] -- 0:00:42
340000 -- (-1182.882) (-1178.804) [-1178.383] (-1177.453) * (-1177.139) [-1179.675] (-1182.662) (-1177.285) -- 0:00:42
Average standard deviation of split frequencies: 0.014097
340500 -- (-1179.427) [-1177.951] (-1177.646) (-1179.234) * (-1178.134) (-1176.987) (-1177.763) [-1177.748] -- 0:00:42
341000 -- (-1180.221) (-1176.702) [-1177.717] (-1178.067) * (-1180.958) [-1178.113] (-1176.763) (-1178.913) -- 0:00:42
341500 -- (-1177.702) (-1177.464) [-1176.544] (-1178.208) * [-1178.582] (-1177.719) (-1177.668) (-1180.128) -- 0:00:42
342000 -- [-1181.621] (-1176.636) (-1179.347) (-1182.172) * (-1177.171) (-1175.546) [-1180.249] (-1182.193) -- 0:00:42
342500 -- (-1178.976) (-1182.723) (-1178.173) [-1178.563] * (-1175.157) [-1176.230] (-1178.005) (-1176.935) -- 0:00:42
343000 -- (-1176.574) [-1177.576] (-1176.951) (-1178.978) * [-1175.153] (-1175.302) (-1176.401) (-1176.101) -- 0:00:42
343500 -- [-1177.548] (-1177.144) (-1177.574) (-1177.493) * (-1175.486) [-1179.773] (-1176.917) (-1176.065) -- 0:00:42
344000 -- (-1181.964) (-1176.034) [-1177.535] (-1177.996) * (-1175.822) (-1175.581) [-1176.069] (-1175.393) -- 0:00:41
344500 -- [-1177.096] (-1179.203) (-1177.716) (-1177.804) * [-1178.161] (-1176.368) (-1176.907) (-1175.696) -- 0:00:41
345000 -- (-1176.323) (-1180.684) [-1178.768] (-1176.044) * (-1175.772) [-1177.798] (-1178.451) (-1175.658) -- 0:00:41
Average standard deviation of split frequencies: 0.014079
345500 -- (-1177.494) (-1178.199) (-1179.600) [-1177.606] * (-1176.365) [-1181.979] (-1178.106) (-1175.811) -- 0:00:41
346000 -- [-1177.771] (-1176.245) (-1180.390) (-1176.287) * (-1175.878) (-1178.717) [-1177.950] (-1177.181) -- 0:00:41
346500 -- (-1176.487) [-1178.372] (-1181.058) (-1179.994) * [-1177.421] (-1176.956) (-1177.710) (-1176.822) -- 0:00:41
347000 -- (-1175.314) (-1179.139) (-1175.700) [-1177.596] * (-1176.655) [-1177.700] (-1177.303) (-1176.701) -- 0:00:41
347500 -- (-1179.244) [-1175.902] (-1176.651) (-1176.837) * (-1176.655) (-1178.484) (-1178.419) [-1177.409] -- 0:00:41
348000 -- (-1176.892) [-1176.781] (-1179.161) (-1178.082) * (-1177.407) (-1177.965) [-1176.273] (-1177.376) -- 0:00:41
348500 -- [-1177.733] (-1179.440) (-1179.930) (-1176.523) * (-1182.460) (-1177.262) [-1175.935] (-1177.901) -- 0:00:41
349000 -- (-1177.869) (-1176.544) (-1179.343) [-1175.723] * [-1178.414] (-1176.549) (-1176.725) (-1176.591) -- 0:00:41
349500 -- [-1179.253] (-1176.444) (-1177.168) (-1177.934) * (-1179.250) (-1175.638) (-1177.114) [-1177.541] -- 0:00:40
350000 -- [-1176.013] (-1179.018) (-1177.601) (-1178.266) * (-1178.951) (-1176.536) (-1177.775) [-1178.748] -- 0:00:40
Average standard deviation of split frequencies: 0.013680
350500 -- (-1176.226) [-1177.968] (-1179.221) (-1178.296) * (-1178.495) (-1177.664) (-1178.688) [-1179.172] -- 0:00:40
351000 -- (-1176.327) [-1178.489] (-1176.741) (-1179.879) * (-1181.292) (-1176.060) (-1176.475) [-1179.790] -- 0:00:40
351500 -- (-1179.728) (-1178.062) [-1176.273] (-1178.175) * [-1178.567] (-1175.531) (-1180.074) (-1179.737) -- 0:00:40
352000 -- (-1176.410) [-1178.686] (-1177.130) (-1177.629) * (-1178.346) (-1177.964) (-1177.560) [-1179.891] -- 0:00:40
352500 -- [-1176.330] (-1177.894) (-1181.434) (-1178.344) * (-1178.124) (-1176.352) [-1179.628] (-1179.026) -- 0:00:40
353000 -- (-1180.136) [-1177.579] (-1182.269) (-1177.397) * (-1178.379) [-1177.020] (-1178.451) (-1178.958) -- 0:00:40
353500 -- (-1175.590) (-1177.578) [-1180.306] (-1177.406) * [-1176.410] (-1176.278) (-1177.709) (-1178.400) -- 0:00:42
354000 -- (-1176.155) (-1175.995) (-1176.325) [-1177.393] * (-1178.295) (-1177.689) (-1180.768) [-1180.292] -- 0:00:41
354500 -- (-1176.349) (-1176.185) (-1176.505) [-1176.999] * (-1178.732) [-1177.782] (-1184.391) (-1178.567) -- 0:00:41
355000 -- (-1176.164) (-1177.698) (-1181.130) [-1176.257] * (-1176.487) (-1176.473) (-1184.996) [-1176.829] -- 0:00:41
Average standard deviation of split frequencies: 0.013943
355500 -- (-1176.116) (-1176.558) (-1178.267) [-1176.408] * (-1178.163) [-1176.206] (-1180.676) (-1176.603) -- 0:00:41
356000 -- (-1179.410) (-1178.824) [-1178.932] (-1176.660) * [-1178.815] (-1176.964) (-1177.199) (-1177.084) -- 0:00:41
356500 -- [-1177.166] (-1180.624) (-1178.668) (-1177.254) * (-1176.107) [-1176.501] (-1180.072) (-1175.530) -- 0:00:41
357000 -- (-1179.865) (-1176.588) (-1178.789) [-1175.743] * (-1178.342) [-1175.460] (-1176.291) (-1176.294) -- 0:00:41
357500 -- [-1181.265] (-1177.331) (-1178.511) (-1178.923) * (-1175.830) (-1175.872) [-1175.465] (-1179.488) -- 0:00:41
358000 -- [-1176.902] (-1176.833) (-1177.976) (-1177.836) * [-1176.724] (-1176.132) (-1175.946) (-1180.446) -- 0:00:41
358500 -- (-1175.821) (-1181.094) (-1181.677) [-1178.529] * (-1175.825) (-1176.017) [-1176.236] (-1184.225) -- 0:00:41
359000 -- (-1177.966) (-1176.716) [-1177.041] (-1177.660) * (-1176.026) [-1177.515] (-1176.113) (-1180.451) -- 0:00:41
359500 -- (-1179.130) (-1176.357) [-1180.749] (-1175.336) * (-1178.263) [-1177.795] (-1176.113) (-1179.574) -- 0:00:40
360000 -- [-1177.873] (-1180.723) (-1177.820) (-1175.559) * (-1184.484) (-1176.426) (-1176.435) [-1181.677] -- 0:00:40
Average standard deviation of split frequencies: 0.015300
360500 -- (-1175.418) (-1177.642) (-1176.479) [-1176.652] * (-1179.361) (-1176.715) (-1178.025) [-1178.493] -- 0:00:40
361000 -- (-1175.592) [-1177.991] (-1176.675) (-1176.417) * (-1181.269) [-1178.707] (-1177.540) (-1178.181) -- 0:00:40
361500 -- (-1177.900) (-1175.990) [-1176.215] (-1176.417) * (-1177.835) (-1180.676) (-1179.096) [-1177.175] -- 0:00:40
362000 -- (-1176.869) [-1175.664] (-1179.332) (-1176.158) * (-1175.960) (-1177.342) (-1176.833) [-1175.819] -- 0:00:40
362500 -- [-1176.952] (-1176.523) (-1179.576) (-1175.362) * [-1176.901] (-1175.901) (-1175.475) (-1175.680) -- 0:00:40
363000 -- (-1176.194) (-1175.527) (-1177.928) [-1177.551] * (-1176.901) (-1178.411) (-1175.835) [-1177.599] -- 0:00:40
363500 -- (-1176.294) [-1176.788] (-1177.703) (-1177.804) * (-1175.975) [-1176.792] (-1175.613) (-1178.300) -- 0:00:40
364000 -- (-1178.337) [-1178.708] (-1178.382) (-1178.688) * [-1175.764] (-1177.193) (-1181.023) (-1178.240) -- 0:00:40
364500 -- [-1176.599] (-1179.248) (-1177.499) (-1178.071) * (-1176.498) [-1177.193] (-1180.493) (-1176.157) -- 0:00:40
365000 -- [-1176.913] (-1182.650) (-1178.647) (-1179.959) * (-1178.298) (-1178.724) [-1178.673] (-1176.757) -- 0:00:40
Average standard deviation of split frequencies: 0.015380
365500 -- (-1184.305) [-1177.983] (-1178.259) (-1177.996) * (-1180.747) (-1181.266) (-1177.524) [-1177.611] -- 0:00:39
366000 -- (-1176.469) (-1176.759) (-1179.026) [-1176.511] * (-1176.335) (-1176.625) (-1177.867) [-1177.625] -- 0:00:39
366500 -- [-1178.304] (-1176.201) (-1178.235) (-1177.207) * (-1179.485) [-1178.716] (-1176.962) (-1180.226) -- 0:00:39
367000 -- [-1178.230] (-1176.917) (-1178.314) (-1176.887) * (-1176.495) (-1175.819) [-1179.764] (-1179.125) -- 0:00:39
367500 -- (-1179.643) (-1179.820) [-1176.955] (-1177.300) * [-1177.726] (-1176.938) (-1179.337) (-1177.243) -- 0:00:39
368000 -- (-1179.759) (-1176.090) (-1179.574) [-1177.887] * (-1177.599) (-1178.155) [-1177.306] (-1178.111) -- 0:00:39
368500 -- (-1185.515) (-1177.883) (-1178.103) [-1178.090] * (-1177.919) (-1184.199) (-1177.339) [-1177.863] -- 0:00:39
369000 -- (-1180.947) (-1176.709) [-1179.638] (-1177.641) * [-1177.778] (-1177.866) (-1181.725) (-1175.712) -- 0:00:39
369500 -- (-1176.402) (-1178.797) (-1176.577) [-1177.472] * [-1177.689] (-1177.588) (-1178.725) (-1177.746) -- 0:00:39
370000 -- (-1176.672) [-1176.619] (-1176.956) (-1176.867) * [-1177.548] (-1179.542) (-1176.115) (-1178.124) -- 0:00:40
Average standard deviation of split frequencies: 0.014962
370500 -- [-1178.865] (-1180.397) (-1179.452) (-1178.152) * (-1180.024) (-1178.684) [-1175.930] (-1178.121) -- 0:00:40
371000 -- (-1180.866) (-1178.377) (-1177.057) [-1177.299] * (-1177.348) (-1177.128) [-1177.849] (-1177.680) -- 0:00:40
371500 -- [-1177.278] (-1179.957) (-1176.876) (-1177.222) * (-1177.045) (-1177.583) (-1175.227) [-1178.403] -- 0:00:40
372000 -- (-1181.208) (-1184.158) (-1176.475) [-1177.210] * (-1177.084) (-1182.111) (-1179.439) [-1177.427] -- 0:00:40
372500 -- (-1181.517) (-1180.106) (-1178.308) [-1177.561] * (-1178.114) [-1176.188] (-1179.721) (-1177.510) -- 0:00:40
373000 -- (-1178.633) [-1177.761] (-1180.296) (-1178.728) * [-1178.080] (-1179.311) (-1178.148) (-1177.468) -- 0:00:40
373500 -- (-1177.598) (-1176.329) (-1178.892) [-1177.035] * (-1177.233) (-1179.635) (-1176.116) [-1175.824] -- 0:00:40
374000 -- (-1177.454) (-1181.158) [-1175.960] (-1176.253) * [-1178.713] (-1181.545) (-1179.572) (-1176.200) -- 0:00:40
374500 -- (-1177.097) (-1176.616) [-1176.693] (-1176.344) * [-1178.690] (-1182.278) (-1180.589) (-1178.280) -- 0:00:40
375000 -- (-1177.558) [-1175.554] (-1177.083) (-1176.879) * (-1176.258) (-1177.863) (-1178.473) [-1178.450] -- 0:00:40
Average standard deviation of split frequencies: 0.015045
375500 -- (-1177.894) (-1175.731) [-1178.464] (-1175.975) * (-1179.418) (-1178.781) (-1181.199) [-1177.029] -- 0:00:39
376000 -- (-1177.145) (-1177.548) [-1177.022] (-1176.241) * (-1180.664) (-1178.728) (-1178.207) [-1177.257] -- 0:00:39
376500 -- (-1176.188) (-1177.548) [-1177.152] (-1179.336) * (-1179.250) (-1176.967) [-1176.449] (-1181.490) -- 0:00:39
377000 -- [-1179.507] (-1180.749) (-1176.124) (-1176.715) * (-1176.942) (-1178.511) [-1175.361] (-1179.750) -- 0:00:39
377500 -- (-1179.234) (-1182.259) [-1179.692] (-1176.294) * (-1176.837) (-1176.497) [-1175.628] (-1179.074) -- 0:00:39
378000 -- [-1177.560] (-1177.044) (-1176.665) (-1176.825) * (-1179.719) [-1176.522] (-1179.211) (-1181.090) -- 0:00:39
378500 -- (-1177.619) (-1177.593) [-1176.389] (-1176.944) * (-1176.427) (-1178.845) (-1177.913) [-1179.945] -- 0:00:39
379000 -- [-1177.824] (-1178.526) (-1177.898) (-1179.178) * [-1176.237] (-1176.982) (-1178.125) (-1178.255) -- 0:00:39
379500 -- [-1179.190] (-1177.502) (-1175.746) (-1179.553) * (-1177.176) [-1175.735] (-1178.362) (-1176.910) -- 0:00:39
380000 -- [-1177.386] (-1179.545) (-1182.564) (-1179.271) * (-1177.013) (-1176.074) (-1178.021) [-1177.883] -- 0:00:39
Average standard deviation of split frequencies: 0.014496
380500 -- (-1175.647) [-1177.039] (-1181.774) (-1176.981) * (-1177.213) (-1176.500) (-1176.585) [-1181.598] -- 0:00:39
381000 -- (-1177.138) [-1176.179] (-1180.844) (-1176.965) * (-1178.549) (-1177.779) [-1177.036] (-1175.857) -- 0:00:38
381500 -- (-1176.640) [-1178.027] (-1179.100) (-1179.922) * [-1176.111] (-1175.333) (-1179.302) (-1176.530) -- 0:00:38
382000 -- [-1176.603] (-1176.181) (-1179.070) (-1183.469) * (-1180.427) [-1175.846] (-1178.304) (-1183.025) -- 0:00:38
382500 -- (-1179.719) [-1179.088] (-1177.634) (-1178.443) * (-1178.825) (-1179.508) [-1176.841] (-1182.340) -- 0:00:38
383000 -- (-1182.292) [-1176.956] (-1175.968) (-1179.666) * [-1177.017] (-1189.621) (-1176.340) (-1177.733) -- 0:00:38
383500 -- [-1179.767] (-1177.037) (-1175.747) (-1179.789) * [-1178.952] (-1177.599) (-1177.757) (-1180.183) -- 0:00:38
384000 -- (-1180.827) (-1177.153) [-1175.763] (-1177.371) * (-1178.986) [-1177.808] (-1177.432) (-1178.137) -- 0:00:38
384500 -- (-1177.944) (-1177.459) (-1177.227) [-1179.768] * (-1180.122) (-1180.810) [-1178.193] (-1179.434) -- 0:00:38
385000 -- [-1177.610] (-1177.634) (-1176.250) (-1177.310) * (-1181.166) (-1185.649) (-1178.989) [-1176.447] -- 0:00:38
Average standard deviation of split frequencies: 0.014224
385500 -- (-1177.768) [-1177.815] (-1180.225) (-1178.159) * [-1177.153] (-1180.945) (-1183.327) (-1178.339) -- 0:00:38
386000 -- (-1177.648) [-1179.317] (-1181.259) (-1179.213) * [-1176.060] (-1177.568) (-1184.361) (-1177.821) -- 0:00:38
386500 -- (-1178.893) (-1178.735) (-1182.496) [-1179.510] * (-1177.593) [-1180.642] (-1179.792) (-1177.678) -- 0:00:39
387000 -- (-1180.034) (-1178.371) (-1178.172) [-1180.800] * (-1179.937) (-1181.534) [-1175.821] (-1178.442) -- 0:00:39
387500 -- (-1176.925) (-1179.694) (-1178.007) [-1178.770] * (-1182.358) [-1177.515] (-1175.804) (-1176.713) -- 0:00:39
388000 -- (-1175.984) [-1180.200] (-1179.175) (-1177.676) * (-1176.595) (-1177.003) [-1176.135] (-1182.820) -- 0:00:39
388500 -- (-1175.820) (-1176.963) [-1176.026] (-1179.543) * (-1177.855) (-1175.607) [-1177.010] (-1176.781) -- 0:00:39
389000 -- (-1177.652) (-1175.442) (-1178.398) [-1177.904] * (-1179.269) (-1177.655) [-1176.717] (-1177.992) -- 0:00:39
389500 -- (-1176.662) (-1175.532) [-1175.760] (-1177.391) * (-1176.348) (-1175.470) [-1176.394] (-1177.400) -- 0:00:39
390000 -- (-1179.605) [-1177.707] (-1175.854) (-1177.977) * (-1180.566) [-1178.587] (-1176.388) (-1180.152) -- 0:00:39
Average standard deviation of split frequencies: 0.013131
390500 -- (-1177.440) (-1176.190) [-1176.279] (-1178.039) * (-1178.393) (-1177.985) [-1176.348] (-1179.618) -- 0:00:39
391000 -- [-1176.311] (-1176.316) (-1175.490) (-1179.271) * [-1178.130] (-1178.782) (-1178.960) (-1178.332) -- 0:00:38
391500 -- (-1176.904) (-1180.395) (-1178.832) [-1180.807] * (-1181.159) (-1179.384) (-1180.322) [-1177.199] -- 0:00:38
392000 -- [-1178.109] (-1177.332) (-1175.956) (-1178.774) * (-1183.049) (-1178.287) [-1178.795] (-1177.781) -- 0:00:38
392500 -- (-1176.882) [-1177.222] (-1177.781) (-1177.863) * [-1177.867] (-1179.432) (-1179.986) (-1176.425) -- 0:00:38
393000 -- (-1176.602) (-1178.931) [-1176.719] (-1177.379) * (-1175.827) [-1178.171] (-1179.630) (-1176.925) -- 0:00:38
393500 -- (-1177.023) (-1184.298) [-1180.818] (-1177.469) * (-1176.379) (-1179.906) (-1177.662) [-1175.972] -- 0:00:38
394000 -- (-1177.112) [-1176.687] (-1179.640) (-1180.982) * (-1178.739) (-1177.443) [-1175.727] (-1175.261) -- 0:00:38
394500 -- (-1175.289) [-1178.821] (-1178.643) (-1176.925) * (-1182.507) (-1178.132) [-1175.653] (-1176.765) -- 0:00:38
395000 -- [-1178.168] (-1177.194) (-1176.071) (-1183.052) * (-1177.502) (-1177.660) [-1175.651] (-1177.831) -- 0:00:38
Average standard deviation of split frequencies: 0.012814
395500 -- [-1176.184] (-1176.422) (-1179.006) (-1182.347) * (-1178.314) (-1184.437) [-1177.137] (-1179.376) -- 0:00:38
396000 -- [-1178.850] (-1176.730) (-1177.739) (-1176.042) * (-1176.490) (-1181.067) [-1176.180] (-1177.757) -- 0:00:38
396500 -- (-1178.736) (-1175.916) (-1175.538) [-1176.495] * (-1177.267) [-1176.058] (-1177.735) (-1185.848) -- 0:00:38
397000 -- (-1177.917) (-1178.059) (-1175.237) [-1177.531] * (-1180.279) (-1176.950) [-1178.383] (-1184.447) -- 0:00:37
397500 -- (-1177.509) (-1176.891) [-1176.130] (-1181.954) * (-1179.847) (-1177.329) (-1179.060) [-1178.467] -- 0:00:37
398000 -- (-1178.581) [-1176.929] (-1175.987) (-1183.313) * (-1182.796) (-1177.714) [-1176.506] (-1179.456) -- 0:00:37
398500 -- (-1176.270) [-1177.499] (-1177.252) (-1185.333) * (-1179.572) (-1177.935) (-1181.493) [-1177.329] -- 0:00:37
399000 -- (-1177.230) [-1176.519] (-1177.343) (-1177.454) * (-1180.638) (-1180.596) (-1177.899) [-1177.479] -- 0:00:37
399500 -- (-1176.515) [-1179.438] (-1177.023) (-1178.448) * [-1176.379] (-1187.330) (-1180.221) (-1177.098) -- 0:00:37
400000 -- [-1177.997] (-1177.617) (-1178.068) (-1178.294) * (-1179.704) (-1178.401) (-1178.043) [-1177.029] -- 0:00:37
Average standard deviation of split frequencies: 0.012873
400500 -- (-1179.209) (-1183.439) (-1178.601) [-1175.532] * (-1179.229) (-1178.658) (-1176.159) [-1180.024] -- 0:00:37
401000 -- (-1181.027) [-1180.522] (-1176.597) (-1176.962) * (-1177.664) [-1180.370] (-1177.300) (-1179.334) -- 0:00:37
401500 -- (-1178.240) (-1179.363) (-1176.484) [-1177.648] * [-1175.187] (-1181.081) (-1175.644) (-1178.068) -- 0:00:37
402000 -- [-1177.526] (-1176.382) (-1178.076) (-1178.796) * (-1182.215) (-1178.995) (-1176.549) [-1175.871] -- 0:00:37
402500 -- (-1177.096) [-1176.757] (-1176.569) (-1180.637) * (-1182.610) (-1182.492) (-1177.217) [-1175.480] -- 0:00:38
403000 -- (-1176.963) (-1177.887) (-1179.217) [-1178.376] * (-1177.148) (-1176.554) (-1181.242) [-1177.426] -- 0:00:38
403500 -- (-1179.821) [-1177.616] (-1180.044) (-1178.056) * (-1176.735) (-1176.397) (-1183.757) [-1180.134] -- 0:00:38
404000 -- (-1180.625) [-1177.781] (-1178.368) (-1177.743) * (-1177.824) [-1175.750] (-1176.804) (-1177.006) -- 0:00:38
404500 -- (-1175.407) (-1176.053) [-1180.834] (-1179.695) * (-1175.840) (-1175.813) (-1176.844) [-1176.691] -- 0:00:38
405000 -- (-1178.253) [-1177.208] (-1184.231) (-1182.074) * [-1176.000] (-1175.737) (-1177.640) (-1177.512) -- 0:00:38
Average standard deviation of split frequencies: 0.013250
405500 -- (-1179.796) (-1179.945) (-1180.897) [-1179.619] * (-1175.649) [-1177.152] (-1177.333) (-1178.053) -- 0:00:38
406000 -- [-1176.713] (-1180.398) (-1180.790) (-1176.522) * (-1176.209) (-1177.900) (-1180.029) [-1177.615] -- 0:00:38
406500 -- [-1176.788] (-1178.278) (-1178.548) (-1179.381) * [-1179.321] (-1176.690) (-1178.860) (-1179.667) -- 0:00:37
407000 -- [-1177.314] (-1179.919) (-1176.974) (-1176.812) * (-1180.152) (-1175.545) (-1180.000) [-1175.886] -- 0:00:37
407500 -- (-1179.098) (-1175.687) (-1176.506) [-1178.826] * (-1181.303) (-1176.010) (-1176.519) [-1176.129] -- 0:00:37
408000 -- [-1178.393] (-1175.767) (-1175.833) (-1175.557) * (-1176.354) [-1176.486] (-1175.793) (-1175.941) -- 0:00:37
408500 -- [-1177.144] (-1182.344) (-1176.715) (-1177.606) * [-1180.707] (-1178.028) (-1180.002) (-1177.032) -- 0:00:37
409000 -- (-1176.679) (-1178.616) [-1176.023] (-1178.339) * [-1180.958] (-1177.735) (-1176.079) (-1179.832) -- 0:00:37
409500 -- [-1176.774] (-1176.144) (-1178.385) (-1179.846) * (-1178.565) (-1181.345) [-1177.544] (-1182.065) -- 0:00:37
410000 -- (-1177.239) (-1176.785) (-1178.557) [-1176.867] * (-1177.067) [-1180.586] (-1176.305) (-1181.844) -- 0:00:37
Average standard deviation of split frequencies: 0.013273
410500 -- (-1178.712) (-1178.603) (-1176.974) [-1176.772] * (-1176.314) (-1177.104) (-1176.594) [-1177.228] -- 0:00:37
411000 -- (-1176.322) [-1178.795] (-1175.815) (-1178.862) * (-1179.904) (-1176.041) (-1177.016) [-1177.476] -- 0:00:37
411500 -- (-1179.337) (-1178.240) (-1175.887) [-1175.540] * [-1176.473] (-1175.783) (-1177.696) (-1177.237) -- 0:00:37
412000 -- (-1178.057) [-1179.952] (-1175.923) (-1175.429) * [-1177.412] (-1178.136) (-1178.740) (-1176.322) -- 0:00:37
412500 -- (-1175.930) (-1178.119) (-1179.193) [-1176.859] * (-1177.364) (-1177.496) (-1179.185) [-1176.218] -- 0:00:37
413000 -- (-1178.003) (-1178.308) [-1178.654] (-1176.494) * (-1175.705) [-1175.350] (-1180.611) (-1177.629) -- 0:00:36
413500 -- (-1177.420) (-1177.235) (-1177.861) [-1176.573] * (-1175.620) [-1176.004] (-1179.353) (-1178.313) -- 0:00:36
414000 -- (-1177.410) (-1180.362) [-1177.346] (-1177.420) * (-1176.172) (-1182.614) (-1176.903) [-1176.174] -- 0:00:36
414500 -- (-1179.347) (-1177.416) (-1178.303) [-1175.543] * (-1178.274) (-1178.086) [-1178.889] (-1177.759) -- 0:00:36
415000 -- (-1176.451) (-1178.392) (-1177.524) [-1176.809] * (-1176.074) (-1178.238) [-1177.607] (-1176.750) -- 0:00:36
Average standard deviation of split frequencies: 0.013386
415500 -- (-1179.890) [-1180.108] (-1177.016) (-1177.514) * (-1181.945) (-1178.863) (-1181.605) [-1177.694] -- 0:00:36
416000 -- (-1175.839) [-1178.348] (-1177.842) (-1179.444) * (-1182.248) (-1180.715) [-1178.294] (-1176.045) -- 0:00:36
416500 -- [-1178.074] (-1179.916) (-1177.417) (-1179.113) * (-1179.802) (-1178.721) [-1177.949] (-1176.624) -- 0:00:36
417000 -- (-1179.475) (-1177.101) (-1175.561) [-1177.926] * (-1178.402) (-1177.238) (-1178.765) [-1178.632] -- 0:00:36
417500 -- (-1183.121) [-1176.570] (-1179.568) (-1177.992) * (-1177.745) (-1177.607) (-1178.902) [-1178.046] -- 0:00:36
418000 -- (-1179.504) (-1176.458) [-1175.819] (-1176.748) * [-1178.798] (-1178.315) (-1177.481) (-1176.365) -- 0:00:36
418500 -- (-1177.774) [-1176.787] (-1176.338) (-1176.759) * (-1178.834) [-1179.533] (-1177.621) (-1176.258) -- 0:00:36
419000 -- (-1176.613) [-1177.153] (-1177.154) (-1176.019) * (-1178.750) (-1181.758) (-1177.101) [-1176.043] -- 0:00:37
419500 -- [-1176.336] (-1178.360) (-1176.320) (-1178.208) * (-1178.151) (-1177.970) (-1176.712) [-1176.584] -- 0:00:37
420000 -- [-1176.961] (-1178.037) (-1176.193) (-1178.115) * (-1178.406) (-1177.830) [-1176.769] (-1176.832) -- 0:00:37
Average standard deviation of split frequencies: 0.013868
420500 -- (-1176.965) (-1175.868) (-1177.445) [-1176.830] * [-1178.947] (-1177.562) (-1176.196) (-1178.399) -- 0:00:37
421000 -- (-1176.837) [-1179.329] (-1176.719) (-1177.925) * (-1178.221) (-1178.763) [-1178.395] (-1177.380) -- 0:00:37
421500 -- (-1177.034) (-1182.161) [-1176.284] (-1178.991) * (-1180.942) [-1176.121] (-1178.683) (-1179.114) -- 0:00:37
422000 -- [-1176.530] (-1182.845) (-1176.723) (-1177.825) * (-1178.688) (-1176.644) (-1178.147) [-1176.571] -- 0:00:36
422500 -- (-1177.017) (-1176.028) (-1177.277) [-1178.479] * [-1177.673] (-1175.419) (-1176.201) (-1175.195) -- 0:00:36
423000 -- (-1175.728) [-1175.707] (-1178.024) (-1178.937) * (-1176.619) (-1176.138) [-1176.113] (-1176.183) -- 0:00:36
423500 -- (-1178.643) [-1175.689] (-1176.698) (-1179.245) * [-1178.092] (-1180.481) (-1176.270) (-1177.546) -- 0:00:36
424000 -- (-1176.115) (-1176.992) (-1176.154) [-1176.010] * (-1175.808) (-1177.370) [-1176.232] (-1175.563) -- 0:00:36
424500 -- (-1176.413) (-1177.424) [-1176.984] (-1176.101) * (-1177.305) (-1178.544) [-1178.086] (-1178.511) -- 0:00:36
425000 -- [-1178.602] (-1175.534) (-1178.283) (-1177.897) * (-1184.507) (-1176.024) (-1178.934) [-1175.912] -- 0:00:36
Average standard deviation of split frequencies: 0.013556
425500 -- (-1176.919) (-1177.616) [-1177.853] (-1178.654) * (-1177.464) [-1180.217] (-1179.095) (-1175.790) -- 0:00:36
426000 -- (-1177.902) [-1175.813] (-1177.749) (-1176.662) * (-1177.495) (-1176.532) [-1176.225] (-1176.992) -- 0:00:36
426500 -- (-1176.719) (-1178.415) [-1176.901] (-1176.201) * (-1176.812) (-1176.901) (-1175.432) [-1179.449] -- 0:00:36
427000 -- (-1176.900) (-1177.100) [-1179.668] (-1176.799) * (-1179.769) (-1178.625) [-1175.445] (-1178.602) -- 0:00:36
427500 -- (-1176.169) (-1176.484) (-1177.053) [-1176.799] * (-1178.314) (-1177.113) [-1176.049] (-1179.402) -- 0:00:36
428000 -- [-1177.384] (-1176.432) (-1183.161) (-1175.495) * [-1178.745] (-1176.727) (-1177.284) (-1180.483) -- 0:00:36
428500 -- [-1177.469] (-1177.051) (-1178.759) (-1176.541) * (-1178.662) (-1175.366) (-1179.450) [-1175.772] -- 0:00:36
429000 -- [-1177.763] (-1176.034) (-1177.026) (-1176.706) * (-1177.201) (-1177.503) (-1177.800) [-1176.694] -- 0:00:35
429500 -- (-1177.752) (-1176.264) [-1178.374] (-1177.588) * (-1180.941) (-1178.159) (-1177.207) [-1176.610] -- 0:00:35
430000 -- (-1179.473) [-1176.151] (-1180.653) (-1175.828) * (-1177.457) (-1177.398) [-1177.207] (-1179.706) -- 0:00:35
Average standard deviation of split frequencies: 0.012861
430500 -- (-1180.897) [-1176.645] (-1178.112) (-1175.591) * (-1175.976) (-1179.733) [-1176.877] (-1180.191) -- 0:00:35
431000 -- (-1179.626) [-1179.466] (-1176.911) (-1176.580) * (-1177.125) (-1178.547) [-1175.760] (-1178.366) -- 0:00:35
431500 -- (-1177.797) (-1176.761) [-1177.698] (-1175.691) * (-1178.248) (-1178.616) [-1181.573] (-1178.122) -- 0:00:35
432000 -- (-1177.770) (-1178.450) [-1181.303] (-1175.800) * (-1176.002) (-1181.730) [-1183.291] (-1177.130) -- 0:00:35
432500 -- (-1178.005) [-1178.047] (-1177.784) (-1176.710) * [-1176.589] (-1178.414) (-1177.609) (-1186.637) -- 0:00:35
433000 -- (-1178.432) [-1178.614] (-1177.802) (-1176.289) * (-1178.397) (-1181.667) [-1178.631] (-1179.474) -- 0:00:35
433500 -- (-1177.451) (-1175.632) (-1176.093) [-1175.833] * (-1177.091) [-1181.695] (-1177.412) (-1182.155) -- 0:00:35
434000 -- (-1177.064) (-1176.102) (-1177.638) [-1176.039] * [-1176.590] (-1178.143) (-1176.373) (-1178.560) -- 0:00:35
434500 -- (-1176.510) (-1177.846) [-1176.913] (-1176.294) * [-1176.475] (-1175.927) (-1175.755) (-1179.106) -- 0:00:35
435000 -- (-1180.682) [-1179.929] (-1182.399) (-1175.296) * (-1176.312) (-1175.804) (-1175.654) [-1180.399] -- 0:00:35
Average standard deviation of split frequencies: 0.013110
435500 -- (-1178.123) [-1182.046] (-1179.919) (-1175.296) * (-1180.653) [-1177.860] (-1175.654) (-1176.180) -- 0:00:36
436000 -- [-1177.287] (-1183.693) (-1176.754) (-1177.916) * (-1178.861) (-1181.333) [-1175.626] (-1177.262) -- 0:00:36
436500 -- (-1178.658) (-1179.405) [-1178.814] (-1177.403) * [-1177.847] (-1178.185) (-1176.002) (-1177.769) -- 0:00:36
437000 -- (-1176.537) [-1177.199] (-1176.955) (-1175.846) * (-1177.920) (-1178.168) [-1175.999] (-1177.610) -- 0:00:36
437500 -- (-1177.640) (-1176.905) (-1180.218) [-1176.227] * (-1178.638) (-1176.648) [-1176.089] (-1177.518) -- 0:00:36
438000 -- (-1179.791) (-1178.018) (-1179.109) [-1176.492] * (-1176.617) (-1177.849) [-1176.218] (-1177.119) -- 0:00:35
438500 -- (-1180.940) (-1180.659) (-1181.461) [-1176.890] * (-1179.713) [-1175.863] (-1178.840) (-1176.137) -- 0:00:35
439000 -- [-1178.654] (-1177.493) (-1176.614) (-1175.677) * (-1175.610) (-1180.300) (-1176.253) [-1175.801] -- 0:00:35
439500 -- [-1177.988] (-1178.595) (-1176.376) (-1175.815) * (-1180.612) (-1179.429) (-1179.747) [-1177.121] -- 0:00:35
440000 -- [-1179.562] (-1178.774) (-1178.522) (-1175.814) * [-1177.810] (-1178.264) (-1179.783) (-1179.137) -- 0:00:35
Average standard deviation of split frequencies: 0.012302
440500 -- (-1179.205) [-1178.832] (-1176.676) (-1183.693) * (-1176.389) (-1182.019) (-1179.222) [-1179.599] -- 0:00:35
441000 -- (-1181.889) [-1177.547] (-1175.920) (-1178.385) * (-1176.828) (-1178.268) (-1177.800) [-1179.777] -- 0:00:35
441500 -- (-1181.311) (-1177.828) (-1175.883) [-1175.712] * (-1178.778) [-1178.146] (-1178.350) (-1178.361) -- 0:00:35
442000 -- (-1178.420) (-1177.401) [-1177.265] (-1175.996) * (-1177.284) (-1179.561) [-1184.221] (-1177.337) -- 0:00:35
442500 -- (-1176.485) (-1181.980) (-1177.077) [-1178.083] * (-1178.152) [-1179.411] (-1179.645) (-1176.785) -- 0:00:35
443000 -- [-1176.536] (-1179.754) (-1175.692) (-1178.448) * (-1179.142) (-1177.075) [-1178.369] (-1176.219) -- 0:00:35
443500 -- (-1176.588) (-1178.785) [-1175.596] (-1176.729) * (-1179.227) (-1176.009) (-1177.604) [-1176.121] -- 0:00:35
444000 -- [-1175.552] (-1178.375) (-1176.274) (-1176.602) * (-1176.250) (-1177.115) (-1175.795) [-1178.665] -- 0:00:35
444500 -- (-1175.568) (-1176.908) (-1177.061) [-1175.892] * (-1176.626) (-1177.253) (-1180.850) [-1176.451] -- 0:00:34
445000 -- [-1176.509] (-1176.479) (-1182.063) (-1176.179) * (-1177.041) (-1177.232) (-1177.354) [-1175.696] -- 0:00:34
Average standard deviation of split frequencies: 0.012684
445500 -- (-1176.205) [-1177.432] (-1181.629) (-1176.314) * [-1175.663] (-1179.342) (-1177.091) (-1176.842) -- 0:00:34
446000 -- (-1177.558) [-1176.829] (-1178.223) (-1176.573) * (-1177.465) [-1176.190] (-1177.217) (-1175.688) -- 0:00:34
446500 -- [-1175.610] (-1179.532) (-1177.058) (-1180.553) * [-1178.268] (-1175.765) (-1183.505) (-1179.119) -- 0:00:34
447000 -- (-1177.296) (-1177.724) (-1175.977) [-1176.630] * (-1177.131) [-1176.291] (-1183.753) (-1177.851) -- 0:00:34
447500 -- (-1176.385) (-1178.530) [-1177.403] (-1175.580) * (-1177.913) (-1177.936) [-1177.281] (-1177.210) -- 0:00:34
448000 -- (-1180.146) (-1175.828) (-1176.434) [-1175.675] * (-1177.509) (-1177.818) [-1176.634] (-1178.337) -- 0:00:34
448500 -- (-1177.594) (-1176.238) [-1178.673] (-1179.978) * (-1178.936) [-1180.545] (-1176.550) (-1178.414) -- 0:00:34
449000 -- (-1180.726) [-1177.671] (-1177.234) (-1178.366) * [-1180.191] (-1176.928) (-1175.668) (-1177.686) -- 0:00:34
449500 -- (-1177.449) [-1175.716] (-1177.965) (-1178.360) * (-1177.089) (-1179.341) [-1176.045] (-1178.321) -- 0:00:34
450000 -- (-1176.969) [-1178.199] (-1178.229) (-1175.962) * (-1176.163) (-1177.179) (-1178.384) [-1177.295] -- 0:00:34
Average standard deviation of split frequencies: 0.012879
450500 -- (-1178.361) (-1177.211) (-1178.526) [-1176.643] * (-1176.757) (-1177.477) (-1176.785) [-1176.627] -- 0:00:34
451000 -- [-1176.416] (-1175.891) (-1178.574) (-1175.998) * (-1175.896) [-1176.466] (-1181.271) (-1177.723) -- 0:00:34
451500 -- (-1179.940) [-1176.837] (-1177.908) (-1177.755) * (-1175.832) [-1176.898] (-1175.920) (-1182.476) -- 0:00:34
452000 -- (-1179.333) [-1177.119] (-1180.176) (-1176.399) * [-1176.211] (-1180.141) (-1176.480) (-1180.226) -- 0:00:35
452500 -- [-1176.229] (-1176.384) (-1177.963) (-1176.093) * (-1176.733) [-1180.253] (-1176.869) (-1179.446) -- 0:00:35
453000 -- (-1176.122) (-1179.280) [-1175.391] (-1176.726) * (-1176.155) (-1180.167) (-1177.860) [-1184.084] -- 0:00:35
453500 -- (-1179.465) (-1179.699) (-1179.392) [-1177.356] * [-1178.839] (-1176.740) (-1176.424) (-1183.452) -- 0:00:34
454000 -- (-1176.947) (-1175.430) (-1176.311) [-1179.483] * (-1178.524) (-1179.064) (-1176.536) [-1182.961] -- 0:00:34
454500 -- (-1178.462) (-1178.024) [-1179.064] (-1176.738) * (-1179.492) [-1176.935] (-1177.269) (-1181.830) -- 0:00:34
455000 -- (-1179.169) [-1175.356] (-1184.272) (-1177.758) * [-1179.089] (-1175.558) (-1176.202) (-1182.533) -- 0:00:34
Average standard deviation of split frequencies: 0.012728
455500 -- [-1179.442] (-1176.638) (-1178.047) (-1178.411) * [-1177.824] (-1177.031) (-1181.751) (-1178.448) -- 0:00:34
456000 -- (-1176.604) (-1176.070) [-1175.612] (-1180.722) * [-1178.226] (-1177.041) (-1180.394) (-1176.831) -- 0:00:34
456500 -- (-1178.274) (-1176.281) [-1175.684] (-1177.173) * [-1176.217] (-1177.041) (-1176.988) (-1177.644) -- 0:00:34
457000 -- (-1177.945) [-1176.081] (-1178.542) (-1177.403) * [-1175.344] (-1180.087) (-1180.602) (-1177.894) -- 0:00:34
457500 -- [-1178.503] (-1177.080) (-1176.874) (-1177.285) * (-1177.026) [-1176.903] (-1177.147) (-1175.960) -- 0:00:34
458000 -- [-1176.765] (-1177.188) (-1177.534) (-1176.975) * (-1176.785) (-1177.524) (-1181.417) [-1177.660] -- 0:00:34
458500 -- (-1179.198) (-1178.360) (-1179.989) [-1177.306] * (-1176.330) [-1176.112] (-1185.918) (-1176.528) -- 0:00:34
459000 -- [-1175.781] (-1182.209) (-1176.170) (-1178.879) * [-1179.446] (-1176.651) (-1176.226) (-1177.667) -- 0:00:34
459500 -- (-1176.442) (-1186.874) (-1176.524) [-1177.567] * (-1178.141) (-1176.479) (-1176.180) [-1175.790] -- 0:00:34
460000 -- (-1176.436) [-1178.104] (-1178.291) (-1178.232) * [-1177.997] (-1177.492) (-1177.023) (-1176.928) -- 0:00:34
Average standard deviation of split frequencies: 0.012344
460500 -- [-1175.264] (-1185.800) (-1177.594) (-1179.003) * (-1177.145) (-1177.512) (-1178.738) [-1176.703] -- 0:00:33
461000 -- (-1181.661) (-1183.962) (-1180.577) [-1180.318] * (-1180.553) (-1178.369) (-1184.356) [-1175.606] -- 0:00:33
461500 -- [-1178.554] (-1185.697) (-1176.538) (-1176.642) * (-1184.330) (-1178.180) [-1176.846] (-1175.437) -- 0:00:33
462000 -- [-1176.421] (-1177.872) (-1178.271) (-1181.882) * (-1179.350) (-1178.060) (-1176.382) [-1175.261] -- 0:00:33
462500 -- (-1176.689) (-1175.716) (-1180.382) [-1177.673] * (-1176.391) (-1177.436) [-1180.590] (-1176.013) -- 0:00:33
463000 -- [-1178.304] (-1178.255) (-1178.294) (-1179.212) * (-1182.346) (-1177.610) (-1179.610) [-1176.492] -- 0:00:33
463500 -- [-1177.401] (-1177.228) (-1175.891) (-1178.592) * (-1180.211) [-1177.192] (-1177.519) (-1177.836) -- 0:00:33
464000 -- [-1175.798] (-1180.874) (-1177.762) (-1175.915) * (-1175.737) (-1182.626) (-1177.973) [-1179.716] -- 0:00:33
464500 -- (-1176.414) [-1175.459] (-1176.052) (-1179.355) * [-1176.580] (-1177.917) (-1177.257) (-1182.398) -- 0:00:33
465000 -- (-1177.365) (-1178.729) (-1179.093) [-1179.327] * (-1177.981) [-1176.494] (-1179.431) (-1177.414) -- 0:00:33
Average standard deviation of split frequencies: 0.011823
465500 -- (-1176.738) [-1178.028] (-1178.080) (-1179.503) * [-1179.552] (-1178.891) (-1178.862) (-1176.197) -- 0:00:33
466000 -- [-1177.996] (-1175.705) (-1178.314) (-1177.275) * (-1179.073) (-1177.479) (-1175.983) [-1176.369] -- 0:00:33
466500 -- (-1177.708) (-1181.110) (-1176.433) [-1180.487] * (-1179.750) [-1176.380] (-1175.916) (-1175.997) -- 0:00:33
467000 -- (-1177.329) (-1177.579) (-1178.046) [-1176.810] * (-1184.255) (-1178.689) (-1176.112) [-1176.085] -- 0:00:33
467500 -- (-1175.170) (-1175.807) (-1176.664) [-1176.950] * (-1183.799) (-1176.593) (-1178.338) [-1177.205] -- 0:00:33
468000 -- (-1176.720) [-1175.853] (-1177.128) (-1176.490) * (-1177.396) (-1175.540) (-1179.454) [-1175.590] -- 0:00:32
468500 -- (-1176.712) (-1177.015) (-1178.802) [-1179.805] * (-1176.108) [-1175.996] (-1179.055) (-1175.679) -- 0:00:34
469000 -- [-1177.943] (-1178.795) (-1177.358) (-1176.625) * (-1176.606) (-1175.996) (-1181.000) [-1176.531] -- 0:00:33
469500 -- (-1176.909) (-1177.340) [-1176.052] (-1176.918) * [-1175.882] (-1175.715) (-1178.403) (-1178.203) -- 0:00:33
470000 -- (-1177.089) [-1178.157] (-1176.329) (-1177.101) * (-1175.816) (-1176.833) (-1176.238) [-1176.491] -- 0:00:33
Average standard deviation of split frequencies: 0.011142
470500 -- (-1176.498) (-1177.934) [-1176.593] (-1177.120) * (-1177.778) [-1177.901] (-1179.186) (-1175.066) -- 0:00:33
471000 -- (-1178.298) [-1177.205] (-1178.015) (-1176.556) * (-1176.792) (-1175.855) (-1178.405) [-1176.069] -- 0:00:33
471500 -- (-1177.648) (-1178.283) [-1178.757] (-1175.977) * (-1177.194) (-1176.893) [-1177.244] (-1176.826) -- 0:00:33
472000 -- (-1178.070) [-1179.055] (-1177.471) (-1181.647) * (-1177.569) (-1176.386) [-1177.389] (-1176.153) -- 0:00:33
472500 -- (-1177.811) (-1177.141) [-1175.922] (-1176.457) * (-1176.212) [-1177.149] (-1177.049) (-1175.602) -- 0:00:33
473000 -- (-1177.336) (-1184.980) [-1176.210] (-1177.329) * (-1177.354) [-1176.476] (-1175.692) (-1181.948) -- 0:00:33
473500 -- (-1179.259) [-1178.563] (-1176.481) (-1179.238) * [-1178.716] (-1175.880) (-1175.906) (-1178.888) -- 0:00:33
474000 -- [-1177.880] (-1179.970) (-1179.254) (-1177.466) * (-1178.865) (-1178.375) (-1176.805) [-1177.591] -- 0:00:33
474500 -- (-1182.662) (-1178.136) [-1178.613] (-1179.097) * (-1180.193) [-1178.360] (-1176.025) (-1178.254) -- 0:00:33
475000 -- (-1177.469) [-1177.689] (-1177.031) (-1176.028) * [-1177.281] (-1181.361) (-1176.422) (-1178.939) -- 0:00:33
Average standard deviation of split frequencies: 0.011203
475500 -- (-1177.146) (-1179.185) [-1176.634] (-1176.013) * [-1177.468] (-1181.754) (-1175.674) (-1180.142) -- 0:00:33
476000 -- (-1177.143) (-1176.964) [-1177.200] (-1176.022) * (-1178.310) (-1176.783) [-1177.664] (-1182.648) -- 0:00:33
476500 -- (-1176.328) [-1177.247] (-1178.798) (-1175.675) * (-1178.305) (-1184.897) (-1178.946) [-1184.186] -- 0:00:32
477000 -- (-1175.656) (-1178.069) [-1179.838] (-1176.172) * (-1175.939) (-1177.374) (-1178.053) [-1176.766] -- 0:00:32
477500 -- (-1176.617) [-1176.260] (-1177.700) (-1177.009) * (-1181.221) (-1177.177) [-1176.782] (-1177.581) -- 0:00:32
478000 -- (-1179.688) [-1179.108] (-1181.840) (-1177.261) * (-1184.016) [-1179.167] (-1176.373) (-1176.038) -- 0:00:32
478500 -- (-1179.365) [-1178.863] (-1178.009) (-1175.499) * (-1178.548) (-1178.926) (-1175.405) [-1176.219] -- 0:00:32
479000 -- (-1180.366) [-1178.046] (-1180.121) (-1178.352) * (-1179.061) [-1179.573] (-1175.416) (-1178.125) -- 0:00:32
479500 -- (-1177.660) [-1178.285] (-1177.335) (-1177.449) * [-1181.782] (-1176.618) (-1178.685) (-1178.416) -- 0:00:32
480000 -- (-1176.616) [-1177.517] (-1178.164) (-1176.179) * [-1177.176] (-1176.819) (-1181.690) (-1177.006) -- 0:00:32
Average standard deviation of split frequencies: 0.011340
480500 -- [-1176.413] (-1177.843) (-1178.963) (-1177.972) * (-1178.220) (-1176.674) [-1177.631] (-1177.162) -- 0:00:32
481000 -- [-1177.151] (-1179.027) (-1181.536) (-1177.012) * (-1177.087) [-1175.121] (-1180.453) (-1182.893) -- 0:00:32
481500 -- [-1177.035] (-1180.259) (-1178.358) (-1176.939) * (-1176.149) [-1179.689] (-1178.753) (-1180.312) -- 0:00:32
482000 -- (-1178.488) (-1178.970) [-1177.822] (-1176.932) * (-1178.987) [-1177.375] (-1178.389) (-1176.610) -- 0:00:32
482500 -- [-1178.442] (-1175.688) (-1178.779) (-1177.266) * (-1180.764) (-1178.263) (-1178.598) [-1176.398] -- 0:00:32
483000 -- (-1176.298) [-1176.878] (-1179.153) (-1180.207) * [-1183.568] (-1178.936) (-1183.203) (-1176.990) -- 0:00:32
483500 -- [-1178.728] (-1177.644) (-1176.385) (-1178.016) * [-1179.829] (-1178.781) (-1183.794) (-1176.425) -- 0:00:32
484000 -- (-1180.618) (-1180.955) [-1177.259] (-1177.616) * (-1177.388) (-1176.371) [-1177.299] (-1175.970) -- 0:00:31
484500 -- (-1178.108) (-1175.633) [-1180.849] (-1175.838) * (-1177.393) (-1177.408) [-1177.129] (-1178.778) -- 0:00:31
485000 -- [-1178.510] (-1185.643) (-1178.629) (-1175.873) * (-1177.735) (-1180.244) (-1178.034) [-1177.395] -- 0:00:32
Average standard deviation of split frequencies: 0.011183
485500 -- [-1180.441] (-1181.839) (-1181.644) (-1177.995) * (-1176.530) [-1177.626] (-1175.561) (-1176.294) -- 0:00:32
486000 -- (-1179.599) (-1181.150) [-1177.738] (-1177.815) * [-1177.355] (-1180.647) (-1179.756) (-1179.275) -- 0:00:32
486500 -- [-1175.468] (-1179.202) (-1177.704) (-1177.894) * (-1178.756) [-1176.851] (-1176.755) (-1178.527) -- 0:00:32
487000 -- [-1176.675] (-1178.554) (-1177.389) (-1179.587) * (-1182.865) (-1177.029) (-1177.970) [-1177.808] -- 0:00:32
487500 -- (-1176.923) (-1177.806) [-1177.516] (-1176.716) * [-1176.874] (-1177.642) (-1179.756) (-1177.746) -- 0:00:32
488000 -- [-1176.716] (-1176.852) (-1180.610) (-1179.939) * [-1178.610] (-1178.928) (-1176.854) (-1177.269) -- 0:00:32
488500 -- (-1176.548) (-1180.714) [-1176.627] (-1176.351) * (-1184.049) (-1176.166) [-1176.457] (-1180.329) -- 0:00:32
489000 -- (-1177.704) (-1177.933) (-1178.556) [-1175.839] * (-1179.492) [-1176.034] (-1176.278) (-1178.663) -- 0:00:32
489500 -- (-1177.135) (-1179.557) (-1181.355) [-1179.708] * (-1177.405) (-1176.269) [-1176.486] (-1177.517) -- 0:00:32
490000 -- (-1180.255) (-1178.153) [-1177.697] (-1179.526) * (-1177.599) [-1176.165] (-1183.872) (-1178.359) -- 0:00:32
Average standard deviation of split frequencies: 0.010328
490500 -- (-1177.396) (-1178.200) (-1176.904) [-1175.685] * (-1177.561) [-1176.615] (-1177.739) (-1178.088) -- 0:00:32
491000 -- (-1176.833) (-1177.067) (-1176.408) [-1176.742] * (-1176.208) (-1176.376) (-1177.832) [-1176.574] -- 0:00:32
491500 -- (-1178.989) (-1179.090) [-1175.847] (-1176.499) * [-1176.180] (-1176.807) (-1180.336) (-1179.633) -- 0:00:32
492000 -- (-1178.353) (-1182.242) (-1175.982) [-1176.804] * (-1178.906) (-1178.282) (-1177.176) [-1177.253] -- 0:00:32
492500 -- (-1177.310) (-1177.985) [-1176.989] (-1177.052) * (-1180.458) (-1180.544) [-1176.247] (-1175.298) -- 0:00:31
493000 -- (-1177.465) (-1178.692) [-1181.361] (-1179.382) * (-1178.064) (-1176.810) (-1176.159) [-1179.352] -- 0:00:31
493500 -- (-1177.497) (-1177.456) [-1176.822] (-1179.382) * (-1177.593) (-1176.958) (-1175.355) [-1177.816] -- 0:00:31
494000 -- (-1177.698) [-1175.863] (-1179.207) (-1179.282) * (-1179.420) [-1176.947] (-1175.963) (-1177.262) -- 0:00:31
494500 -- (-1176.512) (-1178.136) (-1176.537) [-1176.871] * (-1176.080) (-1176.684) [-1176.830] (-1175.546) -- 0:00:31
495000 -- (-1176.238) [-1179.851] (-1175.864) (-1176.387) * (-1178.916) (-1176.232) (-1177.142) [-1175.419] -- 0:00:31
Average standard deviation of split frequencies: 0.010692
495500 -- (-1178.405) (-1177.087) (-1177.383) [-1178.120] * (-1176.892) (-1178.535) (-1176.693) [-1176.568] -- 0:00:31
496000 -- (-1180.220) [-1181.163] (-1177.284) (-1175.951) * (-1175.255) (-1181.378) (-1181.612) [-1175.954] -- 0:00:31
496500 -- (-1177.220) (-1176.262) (-1179.945) [-1175.789] * [-1179.525] (-1179.902) (-1179.586) (-1179.186) -- 0:00:31
497000 -- (-1176.913) (-1177.033) [-1177.892] (-1182.287) * (-1175.965) [-1176.604] (-1177.332) (-1178.147) -- 0:00:31
497500 -- (-1179.201) (-1177.055) [-1176.029] (-1179.783) * (-1175.724) (-1178.558) (-1175.913) [-1175.876] -- 0:00:31
498000 -- (-1179.647) (-1177.571) (-1175.748) [-1176.758] * [-1175.992] (-1175.902) (-1176.237) (-1184.894) -- 0:00:31
498500 -- (-1176.716) (-1176.888) [-1177.210] (-1177.335) * (-1175.859) (-1179.704) [-1176.166] (-1177.634) -- 0:00:31
499000 -- (-1177.379) (-1177.841) [-1176.263] (-1178.809) * (-1178.890) (-1175.582) [-1177.259] (-1180.213) -- 0:00:31
499500 -- (-1176.343) (-1176.684) (-1178.763) [-1178.116] * (-1178.919) (-1179.497) [-1178.093] (-1176.969) -- 0:00:31
500000 -- [-1175.839] (-1175.917) (-1176.987) (-1175.625) * [-1180.666] (-1182.309) (-1177.399) (-1175.671) -- 0:00:31
Average standard deviation of split frequencies: 0.011181
500500 -- [-1176.013] (-1176.038) (-1179.704) (-1175.929) * (-1177.682) [-1178.907] (-1176.517) (-1178.200) -- 0:00:30
501000 -- [-1177.537] (-1176.668) (-1180.745) (-1176.170) * [-1178.271] (-1177.385) (-1177.107) (-1178.748) -- 0:00:30
501500 -- (-1177.788) (-1175.389) [-1177.845] (-1177.757) * [-1177.146] (-1182.196) (-1175.504) (-1178.263) -- 0:00:31
502000 -- [-1177.016] (-1179.382) (-1179.130) (-1179.152) * (-1175.992) (-1178.003) [-1177.368] (-1178.783) -- 0:00:31
502500 -- (-1176.509) (-1181.130) [-1177.189] (-1179.574) * (-1176.495) (-1182.688) [-1178.413] (-1176.904) -- 0:00:31
503000 -- (-1178.696) [-1178.890] (-1176.122) (-1179.666) * [-1176.565] (-1179.928) (-1180.759) (-1176.701) -- 0:00:31
503500 -- (-1176.601) (-1178.925) [-1176.226] (-1177.955) * (-1175.832) [-1177.268] (-1176.437) (-1182.061) -- 0:00:31
504000 -- (-1176.565) [-1178.691] (-1177.220) (-1175.980) * (-1176.526) (-1177.182) (-1179.049) [-1178.441] -- 0:00:31
504500 -- (-1176.968) (-1180.819) (-1177.968) [-1176.916] * (-1177.394) [-1178.755] (-1178.878) (-1178.859) -- 0:00:31
505000 -- (-1176.572) (-1185.589) (-1175.799) [-1178.921] * [-1178.136] (-1179.925) (-1181.319) (-1176.594) -- 0:00:31
Average standard deviation of split frequencies: 0.011180
505500 -- (-1175.737) (-1177.377) (-1176.561) [-1176.413] * (-1182.024) (-1179.458) (-1176.619) [-1176.761] -- 0:00:31
506000 -- (-1181.593) (-1177.941) (-1177.026) [-1175.775] * (-1175.557) (-1175.865) (-1176.560) [-1177.283] -- 0:00:31
506500 -- (-1181.783) [-1178.616] (-1178.983) (-1177.718) * (-1176.817) [-1176.641] (-1183.056) (-1177.085) -- 0:00:31
507000 -- (-1181.526) [-1177.968] (-1177.249) (-1178.365) * (-1175.273) (-1179.728) [-1176.379] (-1178.469) -- 0:00:31
507500 -- (-1177.086) [-1177.370] (-1175.413) (-1180.161) * [-1176.653] (-1177.123) (-1178.897) (-1177.681) -- 0:00:31
508000 -- (-1176.863) [-1179.974] (-1179.251) (-1182.365) * (-1177.730) [-1176.642] (-1177.382) (-1178.906) -- 0:00:30
508500 -- [-1178.122] (-1177.910) (-1179.035) (-1185.304) * [-1177.258] (-1178.909) (-1178.005) (-1178.551) -- 0:00:30
509000 -- (-1180.202) (-1177.604) [-1176.958] (-1176.939) * (-1176.716) (-1178.240) (-1178.425) [-1178.908] -- 0:00:30
509500 -- [-1178.042] (-1181.170) (-1178.715) (-1181.752) * [-1175.729] (-1177.224) (-1177.993) (-1180.451) -- 0:00:30
510000 -- (-1179.402) (-1181.195) [-1176.595] (-1178.503) * [-1176.041] (-1177.935) (-1179.186) (-1179.663) -- 0:00:30
Average standard deviation of split frequencies: 0.012058
510500 -- (-1180.534) (-1177.671) (-1177.967) [-1181.646] * (-1176.625) [-1177.329] (-1177.029) (-1179.588) -- 0:00:30
511000 -- (-1178.932) (-1177.773) (-1177.738) [-1177.854] * (-1176.625) [-1181.901] (-1177.098) (-1177.248) -- 0:00:30
511500 -- (-1178.045) (-1176.709) (-1177.614) [-1179.758] * (-1177.547) (-1178.203) (-1180.247) [-1180.968] -- 0:00:30
512000 -- (-1176.958) (-1177.269) [-1179.066] (-1179.275) * [-1178.034] (-1177.239) (-1177.174) (-1176.585) -- 0:00:30
512500 -- (-1176.383) (-1175.786) [-1180.362] (-1180.615) * (-1177.581) [-1178.036] (-1178.444) (-1177.751) -- 0:00:30
513000 -- [-1180.267] (-1180.436) (-1180.456) (-1177.895) * [-1177.627] (-1178.484) (-1176.219) (-1177.968) -- 0:00:30
513500 -- (-1178.496) (-1176.909) (-1184.094) [-1178.470] * [-1178.040] (-1175.782) (-1178.768) (-1177.597) -- 0:00:30
514000 -- [-1176.829] (-1180.906) (-1177.196) (-1181.332) * (-1179.611) (-1176.080) [-1179.318] (-1178.229) -- 0:00:30
514500 -- (-1175.516) [-1175.409] (-1177.326) (-1178.525) * [-1176.305] (-1177.680) (-1179.042) (-1180.062) -- 0:00:30
515000 -- (-1175.393) (-1175.664) (-1179.471) [-1176.431] * (-1179.425) (-1178.526) [-1178.968] (-1175.938) -- 0:00:30
Average standard deviation of split frequencies: 0.011819
515500 -- [-1175.580] (-1180.902) (-1178.814) (-1176.741) * (-1183.609) (-1176.047) [-1176.340] (-1176.384) -- 0:00:30
516000 -- (-1175.529) [-1181.196] (-1175.850) (-1176.542) * (-1178.078) [-1175.740] (-1179.695) (-1181.122) -- 0:00:30
516500 -- (-1176.657) (-1175.751) (-1177.244) [-1176.329] * (-1178.964) [-1176.556] (-1176.407) (-1178.727) -- 0:00:29
517000 -- (-1177.316) (-1178.935) (-1180.706) [-1176.360] * (-1176.409) (-1179.020) (-1176.758) [-1177.346] -- 0:00:29
517500 -- [-1179.981] (-1176.881) (-1179.827) (-1178.231) * (-1176.631) [-1176.382] (-1178.191) (-1179.325) -- 0:00:29
518000 -- [-1176.496] (-1176.957) (-1178.995) (-1178.187) * (-1175.674) (-1176.924) (-1181.448) [-1179.870] -- 0:00:30
518500 -- (-1179.793) [-1178.139] (-1176.546) (-1176.899) * [-1176.912] (-1176.675) (-1181.530) (-1178.516) -- 0:00:30
519000 -- (-1177.941) [-1180.109] (-1176.526) (-1178.922) * (-1179.683) [-1176.955] (-1178.425) (-1181.729) -- 0:00:30
519500 -- (-1175.480) (-1176.089) [-1176.173] (-1176.009) * [-1178.737] (-1176.867) (-1177.572) (-1177.091) -- 0:00:30
520000 -- (-1176.971) (-1176.789) (-1178.110) [-1175.760] * (-1177.308) (-1179.492) (-1176.383) [-1178.174] -- 0:00:30
Average standard deviation of split frequencies: 0.011431
520500 -- [-1176.660] (-1177.330) (-1177.268) (-1175.786) * (-1176.583) [-1176.625] (-1183.351) (-1179.690) -- 0:00:30
521000 -- (-1177.120) (-1176.670) [-1177.874] (-1175.377) * (-1179.009) (-1180.908) [-1178.721] (-1178.711) -- 0:00:30
521500 -- (-1176.713) [-1176.523] (-1177.742) (-1176.961) * (-1179.090) (-1177.390) [-1176.634] (-1177.948) -- 0:00:30
522000 -- [-1180.525] (-1176.675) (-1175.491) (-1175.462) * [-1176.369] (-1176.618) (-1176.963) (-1176.935) -- 0:00:30
522500 -- [-1178.146] (-1178.414) (-1176.487) (-1176.204) * [-1175.664] (-1175.522) (-1176.915) (-1178.368) -- 0:00:30
523000 -- (-1178.532) (-1178.671) [-1175.457] (-1179.025) * (-1178.036) (-1177.184) [-1177.600] (-1177.904) -- 0:00:30
523500 -- (-1178.888) (-1176.046) [-1176.079] (-1178.250) * [-1178.366] (-1175.866) (-1177.885) (-1176.933) -- 0:00:30
524000 -- [-1177.350] (-1177.067) (-1177.740) (-1176.843) * [-1175.726] (-1177.837) (-1176.613) (-1175.747) -- 0:00:29
524500 -- (-1177.656) [-1175.725] (-1177.775) (-1178.932) * (-1177.006) (-1176.933) [-1178.690] (-1175.473) -- 0:00:29
525000 -- (-1177.364) [-1175.769] (-1180.279) (-1178.174) * (-1178.570) (-1176.838) (-1178.043) [-1176.844] -- 0:00:29
Average standard deviation of split frequencies: 0.011371
525500 -- [-1181.094] (-1175.646) (-1179.935) (-1177.083) * (-1179.634) (-1175.413) [-1177.243] (-1177.459) -- 0:00:29
526000 -- (-1176.567) (-1175.699) [-1178.986] (-1178.357) * (-1177.457) (-1179.321) (-1175.371) [-1181.804] -- 0:00:29
526500 -- (-1180.186) [-1176.060] (-1178.976) (-1177.107) * (-1176.695) [-1179.922] (-1179.655) (-1177.369) -- 0:00:29
527000 -- (-1183.412) (-1176.073) (-1178.738) [-1178.613] * (-1182.296) [-1177.279] (-1178.009) (-1177.787) -- 0:00:29
527500 -- (-1180.272) (-1178.601) [-1178.521] (-1177.118) * [-1177.391] (-1177.097) (-1179.018) (-1176.507) -- 0:00:29
528000 -- (-1182.813) (-1178.026) [-1175.527] (-1177.247) * (-1175.940) (-1179.992) (-1176.656) [-1181.640] -- 0:00:29
528500 -- (-1181.009) (-1177.340) [-1176.971] (-1177.585) * (-1177.426) (-1177.811) (-1177.484) [-1175.354] -- 0:00:29
529000 -- (-1176.069) [-1179.391] (-1176.918) (-1176.994) * (-1177.578) [-1177.380] (-1175.871) (-1178.751) -- 0:00:29
529500 -- (-1178.144) (-1178.772) (-1177.490) [-1182.416] * (-1178.549) (-1178.295) [-1176.349] (-1178.193) -- 0:00:29
530000 -- (-1176.403) (-1176.665) [-1177.107] (-1175.983) * (-1178.469) (-1178.752) [-1175.860] (-1178.593) -- 0:00:29
Average standard deviation of split frequencies: 0.010493
530500 -- (-1179.560) [-1176.345] (-1175.714) (-1175.582) * (-1177.644) (-1177.809) (-1176.298) [-1178.200] -- 0:00:29
531000 -- (-1179.795) [-1179.525] (-1177.260) (-1176.360) * (-1176.925) (-1179.909) [-1175.924] (-1181.031) -- 0:00:29
531500 -- [-1178.059] (-1176.451) (-1178.433) (-1183.364) * (-1177.684) (-1175.906) [-1176.933] (-1178.777) -- 0:00:29
532000 -- [-1176.078] (-1176.707) (-1178.369) (-1178.568) * (-1180.966) (-1176.812) [-1178.293] (-1180.112) -- 0:00:29
532500 -- (-1178.535) (-1179.079) (-1177.165) [-1176.761] * (-1180.158) [-1176.715] (-1177.587) (-1176.410) -- 0:00:28
533000 -- (-1176.242) (-1178.763) (-1175.895) [-1178.251] * (-1178.130) (-1176.490) [-1177.765] (-1183.357) -- 0:00:28
533500 -- (-1175.818) (-1179.455) (-1178.789) [-1177.193] * (-1176.650) (-1176.620) (-1180.846) [-1176.897] -- 0:00:28
534000 -- [-1175.736] (-1177.161) (-1180.418) (-1176.058) * [-1175.887] (-1177.547) (-1182.502) (-1176.213) -- 0:00:28
534500 -- (-1176.648) (-1177.343) [-1180.912] (-1176.403) * (-1176.621) (-1180.049) [-1176.661] (-1178.153) -- 0:00:29
535000 -- (-1179.554) [-1176.327] (-1178.607) (-1176.566) * [-1176.316] (-1177.812) (-1184.527) (-1180.727) -- 0:00:29
Average standard deviation of split frequencies: 0.010609
535500 -- (-1177.159) (-1176.780) (-1183.388) [-1177.406] * [-1177.243] (-1177.420) (-1176.755) (-1177.243) -- 0:00:29
536000 -- (-1175.229) (-1177.115) [-1179.879] (-1181.751) * (-1176.991) (-1178.210) [-1177.680] (-1175.877) -- 0:00:29
536500 -- (-1175.540) (-1178.454) (-1179.677) [-1179.674] * (-1179.121) (-1179.300) [-1177.643] (-1176.843) -- 0:00:29
537000 -- [-1177.463] (-1177.301) (-1177.619) (-1180.464) * (-1179.867) (-1177.325) [-1176.154] (-1176.663) -- 0:00:29
537500 -- [-1177.698] (-1179.634) (-1176.887) (-1176.676) * (-1181.918) [-1178.862] (-1175.572) (-1177.446) -- 0:00:29
538000 -- (-1180.679) (-1176.660) [-1176.110] (-1175.714) * (-1180.259) (-1177.313) [-1175.413] (-1180.554) -- 0:00:29
538500 -- (-1180.067) (-1176.803) (-1177.502) [-1177.556] * (-1176.063) [-1179.225] (-1176.753) (-1179.298) -- 0:00:29
539000 -- (-1180.777) [-1175.684] (-1176.442) (-1181.763) * (-1177.138) (-1176.875) [-1178.434] (-1176.680) -- 0:00:29
539500 -- (-1177.259) [-1176.637] (-1176.354) (-1179.824) * (-1178.413) (-1176.754) (-1176.123) [-1178.011] -- 0:00:29
540000 -- (-1175.460) (-1176.404) [-1177.720] (-1179.403) * (-1179.262) (-1178.756) [-1179.639] (-1177.425) -- 0:00:28
Average standard deviation of split frequencies: 0.010081
540500 -- (-1176.321) [-1179.096] (-1177.287) (-1176.341) * [-1178.847] (-1179.886) (-1177.210) (-1175.745) -- 0:00:28
541000 -- (-1175.790) (-1178.693) [-1177.782] (-1175.848) * (-1177.791) (-1177.876) [-1176.876] (-1176.200) -- 0:00:28
541500 -- [-1177.808] (-1177.231) (-1175.534) (-1175.658) * [-1178.476] (-1176.194) (-1176.324) (-1175.790) -- 0:00:28
542000 -- (-1178.459) (-1177.348) [-1177.906] (-1175.783) * (-1178.584) (-1176.990) (-1182.483) [-1176.052] -- 0:00:28
542500 -- (-1176.054) (-1179.051) (-1176.691) [-1176.466] * (-1177.871) (-1176.750) [-1178.439] (-1175.904) -- 0:00:28
543000 -- (-1181.053) (-1179.998) [-1176.284] (-1178.446) * (-1177.198) [-1175.272] (-1179.450) (-1176.676) -- 0:00:28
543500 -- (-1176.186) (-1178.562) (-1176.181) [-1176.738] * [-1182.299] (-1181.416) (-1176.995) (-1181.659) -- 0:00:28
544000 -- (-1176.344) (-1180.312) [-1180.878] (-1177.710) * (-1177.205) (-1176.258) (-1176.792) [-1177.394] -- 0:00:28
544500 -- (-1181.774) (-1176.653) (-1176.907) [-1179.949] * (-1181.287) (-1175.863) [-1178.472] (-1178.525) -- 0:00:28
545000 -- (-1175.846) (-1180.075) (-1177.371) [-1177.246] * (-1179.131) (-1175.912) (-1176.839) [-1175.512] -- 0:00:28
Average standard deviation of split frequencies: 0.009605
545500 -- (-1175.828) [-1177.627] (-1176.463) (-1176.972) * (-1177.731) (-1180.183) (-1177.371) [-1176.479] -- 0:00:28
546000 -- (-1176.063) [-1177.478] (-1176.590) (-1177.347) * (-1178.264) (-1177.250) [-1177.619] (-1179.577) -- 0:00:28
546500 -- (-1176.202) (-1177.337) [-1176.458] (-1177.287) * [-1177.862] (-1177.553) (-1177.293) (-1178.636) -- 0:00:28
547000 -- [-1175.820] (-1177.213) (-1176.812) (-1176.809) * (-1175.677) (-1177.232) (-1175.521) [-1176.051] -- 0:00:28
547500 -- (-1176.165) [-1177.544] (-1177.426) (-1177.104) * [-1178.123] (-1178.432) (-1179.476) (-1176.332) -- 0:00:28
548000 -- (-1177.692) [-1176.450] (-1177.839) (-1178.168) * (-1181.118) (-1175.866) [-1176.381] (-1178.821) -- 0:00:28
548500 -- (-1178.391) [-1176.704] (-1178.449) (-1176.884) * [-1176.089] (-1176.282) (-1175.821) (-1179.423) -- 0:00:27
549000 -- (-1181.073) [-1177.438] (-1178.633) (-1180.756) * (-1176.666) (-1175.672) (-1175.822) [-1179.825] -- 0:00:27
549500 -- (-1175.744) (-1176.280) (-1177.013) [-1177.200] * [-1175.924] (-1176.494) (-1176.052) (-1177.760) -- 0:00:27
550000 -- (-1175.618) (-1177.823) (-1176.935) [-1177.251] * [-1175.348] (-1175.979) (-1175.764) (-1179.403) -- 0:00:27
Average standard deviation of split frequencies: 0.009719
550500 -- [-1176.833] (-1177.135) (-1177.472) (-1177.753) * (-1176.117) [-1176.913] (-1176.949) (-1180.466) -- 0:00:27
551000 -- [-1176.253] (-1179.310) (-1177.055) (-1177.753) * (-1176.154) (-1177.531) (-1176.093) [-1177.760] -- 0:00:28
551500 -- [-1175.586] (-1176.395) (-1177.109) (-1178.501) * [-1175.558] (-1176.210) (-1178.166) (-1176.606) -- 0:00:28
552000 -- (-1176.774) (-1177.917) (-1176.164) [-1179.860] * (-1180.339) (-1177.463) [-1175.972] (-1176.765) -- 0:00:28
552500 -- [-1176.837] (-1176.799) (-1176.164) (-1176.025) * (-1177.253) [-1178.449] (-1176.926) (-1177.040) -- 0:00:28
553000 -- (-1177.170) (-1177.399) (-1176.868) [-1178.598] * [-1176.123] (-1177.934) (-1177.419) (-1176.867) -- 0:00:28
553500 -- (-1180.396) [-1177.736] (-1181.901) (-1178.467) * (-1181.270) [-1178.158] (-1177.522) (-1176.459) -- 0:00:28
554000 -- (-1179.843) [-1178.013] (-1184.302) (-1177.589) * (-1179.327) (-1176.560) (-1177.638) [-1176.785] -- 0:00:28
554500 -- [-1180.153] (-1178.487) (-1177.499) (-1179.284) * (-1179.678) [-1177.011] (-1177.422) (-1176.018) -- 0:00:28
555000 -- (-1181.443) [-1176.469] (-1180.973) (-1179.270) * (-1180.843) (-1178.702) (-1178.380) [-1177.420] -- 0:00:28
Average standard deviation of split frequencies: 0.009775
555500 -- (-1183.618) [-1177.120] (-1179.878) (-1176.923) * [-1176.524] (-1178.686) (-1177.966) (-1179.317) -- 0:00:28
556000 -- (-1178.715) [-1177.697] (-1178.537) (-1175.625) * [-1179.690] (-1176.380) (-1176.424) (-1176.457) -- 0:00:27
556500 -- [-1176.696] (-1177.716) (-1175.818) (-1178.461) * (-1178.576) (-1176.021) (-1177.447) [-1179.036] -- 0:00:27
557000 -- (-1175.924) [-1176.978] (-1177.947) (-1177.324) * (-1180.557) (-1180.137) (-1175.549) [-1179.926] -- 0:00:27
557500 -- [-1179.985] (-1178.427) (-1177.945) (-1176.941) * (-1176.648) [-1178.436] (-1176.192) (-1178.309) -- 0:00:27
558000 -- (-1178.729) (-1179.344) [-1177.364] (-1176.885) * (-1177.520) (-1175.880) [-1176.053] (-1177.823) -- 0:00:27
558500 -- (-1177.996) (-1177.361) (-1176.264) [-1178.184] * (-1177.707) [-1177.102] (-1176.407) (-1176.638) -- 0:00:27
559000 -- (-1176.691) (-1176.251) [-1177.457] (-1180.456) * (-1178.003) (-1176.348) [-1175.924] (-1177.888) -- 0:00:27
559500 -- [-1177.709] (-1176.902) (-1176.251) (-1181.228) * (-1178.992) [-1176.854] (-1175.513) (-1176.198) -- 0:00:27
560000 -- (-1178.466) (-1176.770) (-1180.743) [-1177.763] * (-1177.967) [-1177.252] (-1175.728) (-1177.371) -- 0:00:27
Average standard deviation of split frequencies: 0.010300
560500 -- [-1177.176] (-1178.713) (-1177.107) (-1178.709) * [-1175.954] (-1176.277) (-1179.337) (-1180.361) -- 0:00:27
561000 -- (-1177.440) [-1177.485] (-1176.281) (-1177.260) * (-1179.308) (-1175.242) (-1178.104) [-1176.269] -- 0:00:27
561500 -- (-1175.925) [-1176.979] (-1177.450) (-1176.493) * (-1183.942) [-1175.110] (-1178.770) (-1180.372) -- 0:00:27
562000 -- (-1177.818) [-1176.940] (-1176.893) (-1177.071) * (-1178.867) (-1177.228) [-1179.020] (-1180.423) -- 0:00:27
562500 -- (-1179.870) (-1178.994) (-1176.104) [-1176.538] * [-1176.227] (-1179.600) (-1180.670) (-1178.238) -- 0:00:27
563000 -- (-1176.105) (-1176.276) [-1179.715] (-1181.109) * (-1176.071) (-1183.476) (-1181.752) [-1179.201] -- 0:00:27
563500 -- [-1176.062] (-1177.990) (-1176.973) (-1182.271) * (-1175.918) [-1177.308] (-1177.846) (-1180.374) -- 0:00:27
564000 -- [-1177.233] (-1178.079) (-1176.091) (-1179.235) * (-1180.361) (-1180.059) (-1177.283) [-1176.173] -- 0:00:27
564500 -- (-1178.384) (-1181.199) (-1176.670) [-1175.926] * (-1183.356) (-1176.732) [-1176.489] (-1176.513) -- 0:00:27
565000 -- (-1179.881) (-1179.627) (-1179.641) [-1179.273] * (-1175.898) (-1178.485) (-1179.110) [-1176.828] -- 0:00:26
Average standard deviation of split frequencies: 0.009847
565500 -- (-1178.289) (-1176.356) (-1177.408) [-1180.182] * (-1178.388) (-1177.829) (-1176.438) [-1176.475] -- 0:00:26
566000 -- (-1178.612) (-1177.248) (-1177.346) [-1178.501] * (-1176.915) (-1177.454) (-1182.866) [-1178.552] -- 0:00:26
566500 -- [-1178.522] (-1178.911) (-1175.996) (-1177.519) * (-1176.986) (-1175.770) (-1177.251) [-1178.538] -- 0:00:26
567000 -- (-1179.509) [-1175.969] (-1178.023) (-1177.390) * [-1175.127] (-1176.823) (-1177.566) (-1181.466) -- 0:00:27
567500 -- (-1184.098) (-1178.424) (-1179.355) [-1177.707] * (-1176.084) [-1177.802] (-1177.608) (-1182.797) -- 0:00:27
568000 -- [-1177.813] (-1176.374) (-1176.164) (-1177.881) * (-1176.598) (-1178.594) [-1177.335] (-1177.465) -- 0:00:27
568500 -- (-1178.149) (-1176.372) [-1175.672] (-1176.808) * (-1178.550) (-1176.742) [-1178.134] (-1179.538) -- 0:00:27
569000 -- (-1176.899) [-1175.393] (-1177.052) (-1180.268) * (-1175.601) (-1178.903) (-1179.156) [-1179.387] -- 0:00:27
569500 -- [-1175.317] (-1176.944) (-1178.024) (-1177.126) * (-1177.367) [-1175.613] (-1179.766) (-1180.609) -- 0:00:27
570000 -- (-1175.329) (-1176.191) [-1176.770] (-1179.197) * (-1176.333) (-1176.069) [-1180.646] (-1178.149) -- 0:00:27
Average standard deviation of split frequencies: 0.010107
570500 -- (-1175.329) (-1178.534) (-1176.791) [-1178.401] * [-1176.537] (-1177.936) (-1179.539) (-1176.821) -- 0:00:27
571000 -- (-1175.674) [-1179.432] (-1175.594) (-1177.388) * (-1177.288) [-1178.044] (-1179.089) (-1176.506) -- 0:00:27
571500 -- (-1175.990) [-1178.376] (-1176.294) (-1179.163) * (-1179.984) [-1175.456] (-1177.439) (-1176.681) -- 0:00:26
572000 -- (-1179.809) (-1177.965) (-1178.394) [-1176.786] * (-1177.546) (-1177.967) (-1177.275) [-1176.574] -- 0:00:26
572500 -- (-1182.608) (-1177.410) (-1175.459) [-1177.512] * (-1177.920) (-1175.405) [-1175.482] (-1177.068) -- 0:00:26
573000 -- [-1175.473] (-1177.080) (-1175.766) (-1177.526) * (-1176.279) (-1176.639) [-1175.660] (-1178.721) -- 0:00:26
573500 -- [-1177.515] (-1176.043) (-1177.506) (-1176.487) * (-1179.262) (-1178.775) (-1175.526) [-1178.411] -- 0:00:26
574000 -- (-1179.969) (-1175.924) [-1176.612] (-1177.445) * [-1175.980] (-1176.311) (-1176.420) (-1176.798) -- 0:00:26
574500 -- (-1177.700) (-1178.175) (-1177.232) [-1175.805] * (-1176.394) (-1178.121) [-1175.929] (-1177.551) -- 0:00:26
575000 -- (-1177.899) (-1180.624) (-1177.406) [-1177.940] * (-1176.077) (-1178.971) [-1175.181] (-1180.110) -- 0:00:26
Average standard deviation of split frequencies: 0.010302
575500 -- (-1175.939) [-1178.476] (-1178.752) (-1180.060) * (-1176.310) [-1182.082] (-1179.845) (-1180.453) -- 0:00:26
576000 -- [-1177.742] (-1177.188) (-1178.611) (-1178.474) * (-1177.513) (-1178.973) [-1180.137] (-1179.011) -- 0:00:26
576500 -- (-1176.582) [-1177.623] (-1177.172) (-1181.165) * (-1177.288) (-1181.402) [-1180.176] (-1177.864) -- 0:00:26
577000 -- (-1176.726) [-1177.341] (-1178.198) (-1176.889) * (-1177.242) (-1178.147) (-1176.309) [-1177.630] -- 0:00:26
577500 -- [-1175.715] (-1179.236) (-1178.342) (-1179.391) * (-1176.288) (-1180.135) (-1177.658) [-1179.813] -- 0:00:26
578000 -- (-1180.423) (-1176.986) [-1176.465] (-1181.120) * (-1180.566) [-1178.070] (-1175.426) (-1178.181) -- 0:00:26
578500 -- (-1175.695) (-1179.224) (-1178.536) [-1176.195] * (-1181.101) (-1178.620) [-1178.294] (-1178.205) -- 0:00:26
579000 -- [-1178.437] (-1179.003) (-1176.821) (-1176.880) * (-1179.485) (-1176.196) [-1180.577] (-1176.233) -- 0:00:26
579500 -- (-1177.296) (-1182.486) (-1179.017) [-1180.183] * (-1176.627) [-1176.086] (-1178.141) (-1175.793) -- 0:00:26
580000 -- (-1178.131) (-1179.545) [-1177.419] (-1175.898) * (-1175.854) [-1175.495] (-1182.674) (-1181.107) -- 0:00:26
Average standard deviation of split frequencies: 0.010351
580500 -- (-1177.079) (-1182.831) [-1180.087] (-1176.453) * (-1184.971) (-1178.507) (-1181.939) [-1176.175] -- 0:00:26
581000 -- [-1176.980] (-1181.759) (-1175.931) (-1177.249) * (-1179.785) (-1178.397) [-1181.652] (-1176.297) -- 0:00:25
581500 -- (-1177.356) (-1178.158) [-1175.670] (-1176.484) * (-1178.967) [-1177.042] (-1180.256) (-1177.644) -- 0:00:25
582000 -- (-1177.356) (-1181.400) [-1175.959] (-1179.137) * [-1181.441] (-1177.634) (-1177.209) (-1179.987) -- 0:00:25
582500 -- (-1177.847) (-1179.917) (-1176.248) [-1176.919] * (-1177.608) (-1181.065) [-1177.172] (-1178.943) -- 0:00:25
583000 -- (-1178.061) (-1179.694) (-1176.321) [-1177.542] * (-1177.380) (-1178.923) [-1177.232] (-1177.198) -- 0:00:25
583500 -- (-1178.683) (-1180.886) [-1176.913] (-1177.996) * (-1176.623) (-1178.784) [-1176.938] (-1176.881) -- 0:00:26
584000 -- [-1177.131] (-1176.159) (-1178.199) (-1176.003) * (-1178.210) (-1177.371) (-1179.536) [-1177.391] -- 0:00:26
584500 -- (-1178.496) (-1180.104) (-1176.605) [-1176.061] * [-1176.485] (-1177.306) (-1176.203) (-1179.088) -- 0:00:26
585000 -- (-1177.826) (-1179.918) (-1176.629) [-1178.596] * (-1176.731) [-1177.963] (-1176.138) (-1179.128) -- 0:00:26
Average standard deviation of split frequencies: 0.010307
585500 -- [-1176.755] (-1177.958) (-1179.626) (-1178.243) * (-1181.515) [-1177.785] (-1176.493) (-1175.937) -- 0:00:26
586000 -- [-1177.308] (-1176.953) (-1178.971) (-1182.444) * (-1178.915) (-1176.213) [-1178.033] (-1176.232) -- 0:00:26
586500 -- (-1177.240) (-1175.756) [-1179.114] (-1178.593) * (-1179.767) [-1177.329] (-1176.709) (-1178.623) -- 0:00:26
587000 -- (-1177.470) [-1180.031] (-1175.571) (-1177.193) * (-1178.778) (-1177.528) (-1181.201) [-1176.565] -- 0:00:26
587500 -- [-1176.371] (-1178.152) (-1177.287) (-1181.728) * [-1175.666] (-1177.936) (-1177.087) (-1175.426) -- 0:00:25
588000 -- [-1179.080] (-1177.590) (-1178.077) (-1177.196) * (-1176.717) (-1180.167) (-1178.577) [-1176.361] -- 0:00:25
588500 -- (-1178.731) (-1178.653) (-1179.441) [-1177.749] * (-1177.636) [-1176.196] (-1178.092) (-1181.563) -- 0:00:25
589000 -- (-1178.893) [-1176.353] (-1179.357) (-1178.032) * [-1178.295] (-1180.969) (-1176.001) (-1183.562) -- 0:00:25
589500 -- (-1177.719) (-1178.499) (-1179.475) [-1177.037] * (-1178.768) (-1178.441) (-1179.837) [-1180.654] -- 0:00:25
590000 -- (-1176.742) (-1181.398) (-1177.053) [-1176.079] * (-1175.508) (-1178.756) [-1177.491] (-1179.393) -- 0:00:25
Average standard deviation of split frequencies: 0.011024
590500 -- (-1177.632) (-1180.115) (-1176.990) [-1177.151] * (-1180.600) (-1175.829) (-1179.649) [-1178.940] -- 0:00:25
591000 -- (-1177.560) (-1179.178) (-1179.928) [-1177.478] * (-1181.846) (-1180.855) (-1180.863) [-1176.718] -- 0:00:25
591500 -- [-1181.139] (-1178.081) (-1179.196) (-1176.750) * (-1175.401) (-1181.598) (-1180.888) [-1178.811] -- 0:00:25
592000 -- (-1176.375) [-1179.465] (-1176.687) (-1176.501) * (-1175.999) (-1183.356) (-1179.259) [-1182.309] -- 0:00:25
592500 -- (-1175.525) (-1184.474) [-1175.468] (-1177.241) * (-1177.322) (-1182.436) [-1179.719] (-1178.434) -- 0:00:25
593000 -- (-1175.553) (-1183.758) [-1176.276] (-1181.142) * (-1176.925) [-1178.361] (-1176.399) (-1177.026) -- 0:00:25
593500 -- (-1178.016) [-1176.127] (-1183.074) (-1178.797) * [-1176.639] (-1177.321) (-1176.441) (-1176.147) -- 0:00:25
594000 -- (-1178.528) (-1176.228) (-1176.802) [-1176.713] * (-1177.049) (-1176.965) (-1178.992) [-1177.562] -- 0:00:25
594500 -- (-1177.894) (-1176.003) (-1175.636) [-1176.849] * (-1180.086) [-1177.897] (-1176.786) (-1176.141) -- 0:00:25
595000 -- (-1176.722) (-1175.694) [-1176.050] (-1179.002) * (-1176.350) (-1178.570) [-1178.146] (-1176.480) -- 0:00:25
Average standard deviation of split frequencies: 0.010777
595500 -- (-1177.577) (-1176.467) [-1180.099] (-1176.977) * (-1178.149) (-1179.334) (-1180.844) [-1177.971] -- 0:00:25
596000 -- (-1179.772) [-1175.476] (-1178.714) (-1177.633) * (-1178.376) [-1180.721] (-1180.942) (-1179.483) -- 0:00:25
596500 -- (-1179.731) (-1180.891) (-1176.458) [-1176.804] * (-1176.526) (-1176.671) [-1179.059] (-1176.341) -- 0:00:25
597000 -- (-1175.714) (-1177.718) (-1175.473) [-1175.782] * (-1178.588) (-1177.644) [-1177.165] (-1177.000) -- 0:00:24
597500 -- (-1176.584) (-1178.379) (-1175.613) [-1176.720] * [-1182.431] (-1178.986) (-1183.660) (-1177.413) -- 0:00:24
598000 -- (-1178.101) [-1175.481] (-1178.705) (-1177.384) * (-1175.911) [-1177.019] (-1176.465) (-1176.266) -- 0:00:24
598500 -- (-1177.996) [-1175.796] (-1176.872) (-1180.944) * (-1177.191) [-1176.117] (-1178.123) (-1179.142) -- 0:00:24
599000 -- (-1179.558) (-1181.861) (-1179.577) [-1176.640] * (-1176.267) (-1176.486) [-1180.132] (-1176.070) -- 0:00:24
599500 -- (-1177.699) [-1185.651] (-1175.820) (-1175.465) * (-1175.778) [-1176.423] (-1178.592) (-1177.723) -- 0:00:24
600000 -- [-1175.917] (-1180.701) (-1178.979) (-1175.975) * (-1176.809) (-1178.603) (-1176.781) [-1177.743] -- 0:00:24
Average standard deviation of split frequencies: 0.011877
600500 -- [-1176.785] (-1176.507) (-1178.201) (-1180.678) * (-1176.084) (-1182.031) (-1177.065) [-1177.279] -- 0:00:25
601000 -- (-1179.907) [-1177.121] (-1177.182) (-1178.942) * (-1177.564) (-1175.666) (-1180.018) [-1177.580] -- 0:00:25
601500 -- (-1178.145) (-1178.654) [-1178.132] (-1180.128) * [-1178.464] (-1176.902) (-1176.483) (-1176.968) -- 0:00:25
602000 -- (-1181.146) [-1179.074] (-1179.621) (-1176.625) * [-1175.864] (-1181.164) (-1177.573) (-1178.436) -- 0:00:25
602500 -- (-1176.696) (-1176.308) (-1177.447) [-1177.514] * (-1183.803) [-1179.324] (-1183.424) (-1176.497) -- 0:00:25
603000 -- [-1176.799] (-1177.995) (-1177.206) (-1178.008) * (-1177.744) (-1179.264) (-1178.695) [-1176.266] -- 0:00:25
603500 -- (-1176.654) (-1180.992) (-1177.075) [-1176.365] * (-1175.717) [-1177.463] (-1181.220) (-1175.509) -- 0:00:24
604000 -- (-1180.142) (-1180.825) [-1179.252] (-1176.737) * (-1175.458) [-1177.808] (-1178.504) (-1177.338) -- 0:00:24
604500 -- (-1177.316) (-1179.102) [-1181.219] (-1177.955) * (-1175.190) (-1177.939) (-1176.899) [-1177.985] -- 0:00:24
605000 -- (-1178.064) (-1176.156) [-1180.185] (-1179.130) * (-1178.666) (-1180.227) [-1178.143] (-1177.516) -- 0:00:24
Average standard deviation of split frequencies: 0.012592
605500 -- (-1177.414) (-1176.127) (-1177.184) [-1177.869] * (-1176.397) (-1183.165) (-1175.426) [-1176.755] -- 0:00:24
606000 -- [-1176.450] (-1176.575) (-1178.711) (-1181.201) * (-1177.426) [-1177.814] (-1176.164) (-1176.671) -- 0:00:24
606500 -- (-1175.882) [-1176.135] (-1178.550) (-1180.272) * (-1177.321) (-1178.485) [-1175.890] (-1176.670) -- 0:00:24
607000 -- (-1178.487) (-1186.382) (-1176.093) [-1175.368] * (-1176.713) [-1179.128] (-1178.209) (-1180.167) -- 0:00:24
607500 -- (-1178.031) [-1179.116] (-1177.973) (-1178.999) * [-1176.435] (-1176.889) (-1176.829) (-1180.258) -- 0:00:24
608000 -- [-1177.692] (-1181.113) (-1175.860) (-1175.709) * (-1178.534) (-1177.290) (-1177.371) [-1182.554] -- 0:00:24
608500 -- (-1179.848) [-1178.367] (-1177.084) (-1175.415) * (-1179.045) [-1179.367] (-1176.871) (-1179.002) -- 0:00:24
609000 -- (-1177.588) [-1177.378] (-1176.856) (-1177.245) * (-1180.594) [-1178.578] (-1177.194) (-1181.771) -- 0:00:24
609500 -- (-1177.502) [-1177.835] (-1175.797) (-1178.155) * (-1178.095) (-1177.232) (-1176.094) [-1182.712] -- 0:00:24
610000 -- [-1177.741] (-1182.548) (-1176.805) (-1181.231) * [-1176.468] (-1176.223) (-1176.906) (-1186.377) -- 0:00:24
Average standard deviation of split frequencies: 0.011631
610500 -- (-1176.331) (-1179.984) [-1176.685] (-1182.289) * (-1176.292) [-1177.908] (-1177.280) (-1179.258) -- 0:00:24
611000 -- [-1175.963] (-1179.897) (-1176.633) (-1178.893) * (-1177.107) (-1177.698) [-1177.890] (-1179.112) -- 0:00:24
611500 -- (-1176.659) (-1179.256) [-1177.475] (-1176.195) * [-1179.168] (-1178.206) (-1176.682) (-1178.493) -- 0:00:24
612000 -- (-1177.195) [-1181.394] (-1177.528) (-1178.879) * (-1183.295) (-1181.340) [-1182.569] (-1175.662) -- 0:00:24
612500 -- [-1178.648] (-1177.667) (-1175.834) (-1175.967) * [-1177.487] (-1179.803) (-1176.927) (-1176.624) -- 0:00:24
613000 -- (-1178.912) (-1181.487) (-1181.372) [-1178.233] * [-1177.051] (-1176.539) (-1176.069) (-1177.753) -- 0:00:23
613500 -- (-1176.703) (-1182.534) [-1178.628] (-1177.005) * (-1176.475) [-1178.153] (-1178.965) (-1180.187) -- 0:00:23
614000 -- (-1180.774) [-1182.543] (-1177.243) (-1176.015) * (-1181.098) (-1180.563) [-1175.882] (-1176.508) -- 0:00:23
614500 -- [-1177.656] (-1182.710) (-1179.054) (-1175.891) * (-1177.925) (-1183.311) (-1175.787) [-1176.309] -- 0:00:23
615000 -- (-1177.266) (-1176.246) (-1178.235) [-1176.610] * [-1176.909] (-1176.108) (-1176.130) (-1176.150) -- 0:00:23
Average standard deviation of split frequencies: 0.011785
615500 -- (-1178.108) (-1176.318) [-1176.856] (-1176.556) * (-1178.502) [-1176.223] (-1176.369) (-1177.532) -- 0:00:23
616000 -- (-1178.392) (-1175.954) (-1176.330) [-1177.832] * (-1176.356) (-1175.898) (-1176.041) [-1181.198] -- 0:00:23
616500 -- (-1180.481) (-1176.015) (-1176.384) [-1175.220] * (-1176.835) (-1175.706) [-1177.188] (-1178.733) -- 0:00:24
617000 -- (-1178.600) [-1177.171] (-1177.327) (-1176.486) * (-1176.642) [-1178.814] (-1175.666) (-1178.916) -- 0:00:24
617500 -- (-1178.877) [-1177.468] (-1177.723) (-1176.322) * (-1175.723) [-1177.098] (-1179.182) (-1177.245) -- 0:00:24
618000 -- (-1177.311) (-1181.067) [-1179.590] (-1179.399) * (-1177.657) [-1176.803] (-1176.396) (-1176.021) -- 0:00:24
618500 -- (-1183.243) (-1176.841) (-1177.815) [-1177.013] * (-1176.904) (-1178.358) [-1175.617] (-1181.145) -- 0:00:24
619000 -- (-1178.402) [-1175.988] (-1176.178) (-1176.530) * (-1176.807) (-1178.576) [-1175.447] (-1176.787) -- 0:00:24
619500 -- [-1177.083] (-1175.518) (-1175.670) (-1177.127) * (-1176.550) (-1178.729) [-1176.942] (-1176.752) -- 0:00:23
620000 -- [-1177.433] (-1175.534) (-1182.103) (-1177.626) * [-1177.811] (-1177.454) (-1176.408) (-1175.730) -- 0:00:23
Average standard deviation of split frequencies: 0.012152
620500 -- (-1178.014) (-1176.108) [-1178.288] (-1177.256) * [-1176.851] (-1178.392) (-1177.509) (-1176.956) -- 0:00:23
621000 -- (-1177.609) (-1177.357) [-1176.449] (-1178.584) * (-1177.403) [-1176.712] (-1178.391) (-1178.329) -- 0:00:23
621500 -- [-1178.399] (-1181.324) (-1176.116) (-1178.876) * [-1179.977] (-1180.125) (-1177.612) (-1177.238) -- 0:00:23
622000 -- (-1177.038) (-1184.270) [-1177.597] (-1179.466) * (-1176.845) (-1182.139) [-1178.151] (-1177.247) -- 0:00:23
622500 -- [-1176.926] (-1178.216) (-1177.151) (-1183.382) * (-1177.264) (-1178.306) (-1177.713) [-1175.739] -- 0:00:23
623000 -- (-1179.020) (-1177.776) (-1176.998) [-1179.263] * (-1176.267) (-1183.437) [-1176.626] (-1175.941) -- 0:00:23
623500 -- (-1180.878) [-1180.187] (-1176.320) (-1179.803) * (-1177.604) (-1176.155) [-1177.642] (-1176.307) -- 0:00:23
624000 -- (-1178.186) (-1177.845) [-1175.909] (-1178.040) * (-1176.767) [-1178.266] (-1176.284) (-1178.606) -- 0:00:23
624500 -- (-1177.803) (-1180.116) (-1181.415) [-1175.738] * [-1175.341] (-1176.188) (-1177.781) (-1176.351) -- 0:00:23
625000 -- [-1175.914] (-1179.953) (-1177.324) (-1176.798) * (-1175.272) [-1178.927] (-1179.903) (-1175.450) -- 0:00:23
Average standard deviation of split frequencies: 0.012284
625500 -- (-1179.195) (-1175.922) (-1175.949) [-1176.674] * (-1177.752) [-1179.324] (-1176.267) (-1175.606) -- 0:00:23
626000 -- (-1179.175) (-1178.281) [-1179.971] (-1176.054) * (-1178.091) (-1178.600) [-1177.322] (-1175.618) -- 0:00:23
626500 -- [-1176.649] (-1177.430) (-1184.676) (-1178.200) * [-1176.155] (-1181.013) (-1176.042) (-1179.138) -- 0:00:23
627000 -- (-1180.654) (-1175.918) [-1179.865] (-1177.058) * (-1178.173) (-1182.943) (-1178.899) [-1179.427] -- 0:00:23
627500 -- [-1177.427] (-1180.104) (-1180.564) (-1178.807) * (-1178.773) (-1178.369) [-1182.391] (-1177.310) -- 0:00:23
628000 -- (-1178.658) (-1184.754) [-1178.374] (-1177.063) * (-1179.934) (-1182.859) (-1179.463) [-1178.154] -- 0:00:23
628500 -- (-1175.735) (-1176.340) [-1178.482] (-1179.670) * (-1177.004) (-1177.461) (-1177.503) [-1178.301] -- 0:00:23
629000 -- (-1179.268) (-1181.055) [-1176.749] (-1177.852) * (-1176.568) [-1176.138] (-1181.645) (-1177.058) -- 0:00:23
629500 -- [-1177.933] (-1180.215) (-1177.823) (-1177.784) * (-1176.227) [-1175.780] (-1176.971) (-1177.327) -- 0:00:22
630000 -- (-1177.303) [-1177.621] (-1175.803) (-1177.140) * (-1179.583) [-1177.841] (-1177.245) (-1176.627) -- 0:00:22
Average standard deviation of split frequencies: 0.013174
630500 -- (-1176.336) [-1181.413] (-1175.825) (-1176.115) * (-1179.225) [-1177.138] (-1176.512) (-1179.479) -- 0:00:22
631000 -- (-1176.306) (-1178.234) [-1177.023] (-1176.483) * (-1177.285) (-1178.287) (-1176.698) [-1176.826] -- 0:00:22
631500 -- (-1177.143) [-1180.367] (-1180.342) (-1176.647) * [-1176.375] (-1183.155) (-1177.115) (-1177.063) -- 0:00:22
632000 -- (-1178.329) [-1175.217] (-1178.041) (-1176.066) * (-1184.465) (-1178.468) [-1179.170] (-1177.393) -- 0:00:22
632500 -- [-1178.621] (-1176.659) (-1175.816) (-1177.721) * (-1177.082) (-1179.250) (-1176.167) [-1177.501] -- 0:00:23
633000 -- [-1175.943] (-1177.669) (-1179.283) (-1179.380) * (-1175.605) [-1178.647] (-1181.196) (-1178.263) -- 0:00:23
633500 -- (-1176.027) [-1175.714] (-1177.949) (-1177.099) * (-1176.569) (-1178.400) [-1178.050] (-1175.784) -- 0:00:23
634000 -- [-1176.046] (-1176.228) (-1178.424) (-1177.878) * (-1178.197) (-1177.393) (-1177.976) [-1175.779] -- 0:00:23
634500 -- (-1175.926) [-1178.571] (-1178.076) (-1180.411) * (-1176.788) [-1182.325] (-1176.503) (-1175.968) -- 0:00:23
635000 -- (-1175.869) [-1177.302] (-1179.696) (-1175.947) * (-1177.007) (-1184.810) (-1178.609) [-1176.350] -- 0:00:22
Average standard deviation of split frequencies: 0.013388
635500 -- (-1176.589) [-1176.001] (-1177.549) (-1179.177) * (-1182.369) (-1175.456) [-1177.733] (-1175.833) -- 0:00:22
636000 -- (-1177.405) (-1175.446) (-1181.684) [-1176.896] * (-1178.032) [-1177.024] (-1176.617) (-1176.702) -- 0:00:22
636500 -- (-1177.104) (-1178.568) (-1177.160) [-1176.305] * [-1179.575] (-1176.865) (-1177.555) (-1175.988) -- 0:00:22
637000 -- [-1176.345] (-1179.027) (-1177.193) (-1179.377) * (-1177.932) (-1181.892) (-1175.752) [-1176.790] -- 0:00:22
637500 -- (-1179.124) [-1177.969] (-1179.074) (-1179.828) * (-1177.341) (-1184.175) [-1175.872] (-1175.299) -- 0:00:22
638000 -- [-1179.464] (-1182.365) (-1177.073) (-1176.005) * [-1178.107] (-1181.834) (-1176.253) (-1181.063) -- 0:00:22
638500 -- (-1178.115) [-1180.362] (-1176.929) (-1177.741) * (-1176.817) [-1178.936] (-1180.367) (-1177.720) -- 0:00:22
639000 -- (-1179.923) (-1179.539) [-1177.223] (-1176.675) * [-1176.496] (-1182.999) (-1180.376) (-1176.231) -- 0:00:22
639500 -- [-1176.755] (-1176.820) (-1179.951) (-1179.432) * (-1177.579) [-1177.248] (-1182.275) (-1175.924) -- 0:00:22
640000 -- [-1177.329] (-1177.500) (-1175.719) (-1182.309) * (-1176.716) (-1176.160) (-1177.586) [-1177.809] -- 0:00:22
Average standard deviation of split frequencies: 0.013750
640500 -- (-1176.833) (-1180.626) [-1179.273] (-1181.015) * (-1177.687) (-1178.668) [-1175.915] (-1177.020) -- 0:00:22
641000 -- [-1177.211] (-1176.576) (-1177.495) (-1177.046) * [-1176.511] (-1180.662) (-1177.234) (-1176.703) -- 0:00:22
641500 -- (-1176.010) (-1177.757) [-1176.611] (-1175.983) * (-1177.306) (-1180.200) (-1176.625) [-1175.299] -- 0:00:22
642000 -- [-1175.923] (-1176.637) (-1176.757) (-1176.961) * [-1175.628] (-1177.373) (-1176.827) (-1176.485) -- 0:00:22
642500 -- [-1178.875] (-1176.901) (-1176.097) (-1179.616) * (-1177.098) [-1179.114] (-1177.429) (-1180.171) -- 0:00:22
643000 -- [-1176.870] (-1178.260) (-1180.921) (-1179.166) * (-1180.401) (-1181.879) [-1175.782] (-1178.928) -- 0:00:22
643500 -- [-1178.511] (-1177.119) (-1176.469) (-1176.125) * (-1182.056) (-1180.721) [-1178.906] (-1180.947) -- 0:00:22
644000 -- [-1180.135] (-1177.230) (-1180.417) (-1175.931) * (-1178.070) (-1177.234) [-1177.423] (-1179.423) -- 0:00:22
644500 -- [-1178.853] (-1177.604) (-1177.883) (-1177.101) * (-1176.458) (-1175.766) (-1176.589) [-1178.835] -- 0:00:22
645000 -- (-1179.485) [-1176.111] (-1178.572) (-1179.306) * [-1175.964] (-1175.451) (-1177.774) (-1177.338) -- 0:00:22
Average standard deviation of split frequencies: 0.012907
645500 -- (-1178.614) (-1176.690) [-1179.702] (-1177.892) * (-1178.464) (-1176.954) [-1176.771] (-1179.473) -- 0:00:21
646000 -- (-1176.775) [-1177.725] (-1176.537) (-1179.631) * (-1176.468) [-1176.089] (-1176.303) (-1180.736) -- 0:00:21
646500 -- [-1176.422] (-1180.165) (-1180.081) (-1180.059) * (-1176.866) (-1176.150) (-1175.928) [-1175.757] -- 0:00:21
647000 -- (-1178.200) (-1178.157) (-1180.429) [-1176.847] * (-1180.854) (-1178.179) [-1177.258] (-1179.976) -- 0:00:21
647500 -- (-1179.979) (-1177.110) (-1176.029) [-1178.507] * (-1181.302) [-1178.418] (-1176.599) (-1176.633) -- 0:00:21
648000 -- (-1177.844) [-1176.883] (-1178.608) (-1177.100) * [-1180.094] (-1177.975) (-1175.855) (-1178.061) -- 0:00:21
648500 -- (-1177.600) (-1182.951) [-1175.928] (-1177.814) * (-1180.470) (-1175.411) (-1175.964) [-1176.501] -- 0:00:21
649000 -- [-1177.412] (-1177.170) (-1176.698) (-1176.838) * (-1176.286) (-1180.227) [-1177.848] (-1175.499) -- 0:00:22
649500 -- (-1179.796) (-1176.974) (-1178.226) [-1178.814] * (-1178.549) [-1175.587] (-1179.867) (-1179.886) -- 0:00:22
650000 -- (-1178.481) [-1176.360] (-1176.555) (-1176.940) * (-1180.712) (-1176.495) [-1176.540] (-1178.477) -- 0:00:22
Average standard deviation of split frequencies: 0.012679
650500 -- (-1178.280) (-1179.264) [-1177.003] (-1176.852) * (-1177.370) (-1175.667) [-1177.122] (-1179.841) -- 0:00:22
651000 -- (-1178.064) [-1176.187] (-1179.113) (-1179.683) * (-1177.863) (-1176.967) [-1179.242] (-1179.083) -- 0:00:21
651500 -- (-1178.647) (-1176.569) (-1177.936) [-1181.344] * (-1176.705) (-1176.769) [-1176.579] (-1179.301) -- 0:00:21
652000 -- (-1178.496) [-1175.817] (-1176.288) (-1180.550) * (-1176.955) (-1176.232) [-1177.338] (-1179.614) -- 0:00:21
652500 -- (-1180.085) (-1181.970) [-1176.685] (-1182.586) * [-1178.082] (-1179.631) (-1176.770) (-1179.380) -- 0:00:21
653000 -- [-1178.532] (-1175.867) (-1178.293) (-1176.441) * (-1180.531) (-1175.494) (-1177.159) [-1176.925] -- 0:00:21
653500 -- (-1175.599) (-1180.040) [-1177.854] (-1176.880) * (-1176.072) [-1176.818] (-1176.979) (-1176.004) -- 0:00:21
654000 -- (-1179.545) (-1181.680) (-1175.869) [-1177.771] * (-1179.986) (-1177.456) (-1175.942) [-1178.061] -- 0:00:21
654500 -- [-1182.908] (-1181.727) (-1178.345) (-1183.007) * (-1180.164) (-1177.926) [-1183.471] (-1181.796) -- 0:00:21
655000 -- (-1176.272) [-1179.288] (-1181.611) (-1180.768) * (-1178.505) (-1181.579) (-1179.737) [-1175.679] -- 0:00:21
Average standard deviation of split frequencies: 0.012351
655500 -- (-1176.301) (-1179.818) (-1179.444) [-1176.822] * (-1177.087) [-1180.396] (-1178.868) (-1175.776) -- 0:00:21
656000 -- (-1177.765) (-1176.793) (-1182.270) [-1176.838] * (-1182.051) (-1177.075) [-1178.598] (-1175.682) -- 0:00:21
656500 -- (-1181.630) (-1175.879) (-1179.321) [-1177.747] * (-1177.559) (-1180.117) (-1176.885) [-1175.673] -- 0:00:21
657000 -- (-1181.707) (-1177.697) [-1178.772] (-1177.522) * (-1177.731) [-1178.053] (-1178.255) (-1175.577) -- 0:00:21
657500 -- [-1178.617] (-1175.805) (-1178.402) (-1176.810) * (-1178.535) [-1181.010] (-1181.993) (-1178.242) -- 0:00:21
658000 -- (-1175.390) (-1179.138) (-1178.007) [-1177.093] * (-1178.800) [-1177.959] (-1181.794) (-1176.330) -- 0:00:21
658500 -- (-1176.011) (-1181.417) [-1176.827] (-1179.355) * (-1179.971) (-1177.388) (-1176.316) [-1176.377] -- 0:00:21
659000 -- [-1176.083] (-1181.193) (-1176.710) (-1180.236) * (-1178.290) (-1179.228) [-1176.475] (-1175.672) -- 0:00:21
659500 -- [-1176.278] (-1175.707) (-1177.885) (-1175.963) * (-1181.389) (-1178.612) (-1176.650) [-1175.593] -- 0:00:21
660000 -- (-1178.871) [-1178.850] (-1177.871) (-1179.031) * (-1177.441) (-1182.099) (-1177.083) [-1175.582] -- 0:00:21
Average standard deviation of split frequencies: 0.012710
660500 -- (-1180.922) [-1176.801] (-1177.433) (-1176.060) * (-1179.856) (-1179.707) (-1176.411) [-1177.399] -- 0:00:21
661000 -- [-1177.871] (-1176.914) (-1177.431) (-1176.635) * (-1176.933) (-1182.567) (-1181.676) [-1178.086] -- 0:00:21
661500 -- (-1178.650) [-1177.293] (-1176.415) (-1177.706) * (-1177.148) (-1176.127) [-1176.169] (-1176.204) -- 0:00:20
662000 -- [-1179.181] (-1177.375) (-1181.439) (-1176.828) * (-1175.552) (-1177.853) [-1176.786] (-1176.445) -- 0:00:20
662500 -- (-1175.471) (-1178.524) [-1182.592] (-1175.703) * (-1180.489) [-1180.031] (-1177.585) (-1179.125) -- 0:00:20
663000 -- (-1177.275) (-1182.396) [-1176.987] (-1175.656) * (-1178.359) (-1180.192) [-1175.978] (-1178.680) -- 0:00:20
663500 -- (-1177.510) (-1180.106) [-1177.030] (-1177.589) * (-1175.480) [-1176.862] (-1177.174) (-1179.614) -- 0:00:20
664000 -- (-1177.797) (-1176.998) (-1181.262) [-1177.235] * (-1176.865) (-1182.142) (-1178.146) [-1176.582] -- 0:00:20
664500 -- (-1176.676) [-1175.557] (-1177.598) (-1177.752) * (-1177.324) (-1178.590) (-1176.897) [-1175.623] -- 0:00:20
665000 -- (-1181.942) (-1176.069) [-1176.463] (-1176.204) * (-1179.798) (-1176.407) (-1176.712) [-1175.767] -- 0:00:20
Average standard deviation of split frequencies: 0.012475
665500 -- [-1176.974] (-1175.577) (-1176.196) (-1176.854) * (-1177.085) (-1178.429) (-1176.554) [-1178.831] -- 0:00:21
666000 -- [-1175.715] (-1176.413) (-1178.954) (-1179.447) * (-1178.682) (-1175.350) (-1177.156) [-1175.917] -- 0:00:21
666500 -- (-1177.739) [-1176.134] (-1178.700) (-1177.468) * (-1177.351) (-1176.477) (-1176.688) [-1175.395] -- 0:00:21
667000 -- [-1177.857] (-1176.268) (-1177.614) (-1177.118) * (-1179.180) (-1177.123) (-1178.570) [-1177.599] -- 0:00:20
667500 -- (-1178.196) (-1180.688) [-1177.856] (-1177.369) * (-1179.479) [-1177.551] (-1181.932) (-1175.302) -- 0:00:20
668000 -- [-1177.210] (-1177.742) (-1178.484) (-1181.601) * (-1175.682) (-1177.381) (-1177.090) [-1176.187] -- 0:00:20
668500 -- (-1176.258) [-1179.137] (-1177.682) (-1175.820) * (-1176.149) (-1176.129) (-1176.397) [-1177.675] -- 0:00:20
669000 -- (-1177.356) (-1179.247) [-1176.726] (-1178.824) * (-1181.540) (-1175.670) [-1176.859] (-1181.277) -- 0:00:20
669500 -- (-1175.878) (-1178.142) (-1175.784) [-1181.736] * (-1179.087) (-1177.735) [-1177.001] (-1179.178) -- 0:00:20
670000 -- [-1177.484] (-1177.047) (-1177.415) (-1177.576) * (-1179.494) (-1177.548) [-1177.948] (-1177.653) -- 0:00:20
Average standard deviation of split frequencies: 0.012081
670500 -- (-1182.356) [-1175.780] (-1176.889) (-1178.440) * (-1177.647) (-1180.426) (-1177.972) [-1176.259] -- 0:00:20
671000 -- (-1177.683) (-1177.912) (-1176.522) [-1177.878] * (-1176.942) (-1177.352) (-1177.673) [-1175.271] -- 0:00:20
671500 -- (-1185.506) (-1177.762) (-1178.746) [-1177.092] * (-1177.963) (-1177.537) (-1176.624) [-1175.513] -- 0:00:20
672000 -- (-1175.960) (-1181.935) [-1181.618] (-1176.927) * (-1179.129) (-1178.215) [-1181.267] (-1176.746) -- 0:00:20
672500 -- (-1178.648) [-1175.843] (-1177.428) (-1177.978) * (-1181.593) [-1180.102] (-1178.536) (-1176.409) -- 0:00:20
673000 -- (-1177.180) [-1175.923] (-1177.858) (-1179.656) * (-1182.428) [-1179.214] (-1177.960) (-1177.065) -- 0:00:20
673500 -- (-1177.978) (-1177.115) [-1176.848] (-1178.025) * [-1175.615] (-1177.058) (-1175.921) (-1180.135) -- 0:00:20
674000 -- [-1177.266] (-1176.990) (-1177.036) (-1176.723) * (-1176.456) (-1177.766) (-1178.530) [-1178.048] -- 0:00:20
674500 -- (-1177.887) (-1178.679) [-1179.067] (-1177.583) * (-1175.776) (-1178.083) (-1177.239) [-1178.433] -- 0:00:20
675000 -- (-1177.498) (-1176.130) (-1179.535) [-1178.302] * (-1178.178) (-1176.142) [-1182.268] (-1176.605) -- 0:00:20
Average standard deviation of split frequencies: 0.011855
675500 -- (-1176.444) [-1175.579] (-1177.723) (-1177.438) * (-1182.153) (-1178.193) (-1179.805) [-1177.940] -- 0:00:20
676000 -- (-1180.031) [-1176.011] (-1180.020) (-1177.986) * [-1176.772] (-1180.633) (-1178.680) (-1180.004) -- 0:00:20
676500 -- (-1180.170) [-1176.680] (-1178.925) (-1178.280) * (-1175.974) [-1181.673] (-1178.480) (-1180.160) -- 0:00:20
677000 -- (-1178.259) (-1180.523) (-1176.627) [-1177.344] * (-1176.183) [-1177.038] (-1181.697) (-1177.812) -- 0:00:20
677500 -- (-1175.836) (-1176.759) (-1175.188) [-1177.085] * (-1176.182) (-1177.720) (-1179.615) [-1175.868] -- 0:00:19
678000 -- (-1175.824) (-1176.812) (-1179.063) [-1176.848] * (-1176.345) (-1176.042) [-1177.007] (-1182.150) -- 0:00:19
678500 -- [-1175.474] (-1180.197) (-1178.459) (-1177.059) * (-1181.798) (-1177.647) (-1176.411) [-1177.376] -- 0:00:19
679000 -- (-1176.118) (-1178.400) (-1177.943) [-1178.633] * [-1177.284] (-1175.353) (-1176.385) (-1177.006) -- 0:00:19
679500 -- [-1175.857] (-1176.502) (-1178.980) (-1178.152) * (-1176.914) [-1175.270] (-1177.209) (-1176.844) -- 0:00:19
680000 -- [-1177.304] (-1177.746) (-1180.011) (-1177.493) * [-1181.125] (-1177.271) (-1178.507) (-1176.207) -- 0:00:19
Average standard deviation of split frequencies: 0.011040
680500 -- [-1177.480] (-1178.794) (-1178.760) (-1178.756) * [-1176.976] (-1175.588) (-1177.739) (-1180.325) -- 0:00:19
681000 -- [-1176.401] (-1176.309) (-1178.058) (-1177.229) * (-1176.048) (-1176.215) (-1178.658) [-1176.800] -- 0:00:19
681500 -- (-1176.253) [-1180.289] (-1176.554) (-1177.581) * (-1175.879) [-1177.027] (-1177.480) (-1179.914) -- 0:00:19
682000 -- [-1178.703] (-1175.642) (-1177.970) (-1175.493) * (-1177.530) (-1176.694) (-1178.067) [-1176.836] -- 0:00:20
682500 -- (-1176.851) [-1178.362] (-1177.680) (-1179.914) * (-1175.611) (-1178.576) (-1178.834) [-1176.161] -- 0:00:20
683000 -- [-1175.702] (-1176.114) (-1178.499) (-1178.713) * [-1176.702] (-1180.500) (-1180.210) (-1176.654) -- 0:00:19
683500 -- [-1175.681] (-1178.267) (-1175.871) (-1179.438) * (-1177.009) (-1180.306) [-1175.307] (-1179.969) -- 0:00:19
684000 -- [-1178.198] (-1176.375) (-1179.369) (-1177.009) * (-1178.633) [-1178.620] (-1178.431) (-1178.742) -- 0:00:19
684500 -- (-1176.955) (-1177.604) [-1179.126] (-1177.717) * (-1176.859) (-1178.585) [-1177.423] (-1177.347) -- 0:00:19
685000 -- (-1176.377) (-1176.939) (-1179.505) [-1177.000] * [-1176.671] (-1178.695) (-1177.253) (-1177.218) -- 0:00:19
Average standard deviation of split frequencies: 0.011157
685500 -- (-1180.170) [-1177.640] (-1178.387) (-1178.146) * [-1178.267] (-1175.848) (-1177.663) (-1175.936) -- 0:00:19
686000 -- (-1176.122) (-1177.711) [-1176.981] (-1176.949) * [-1177.898] (-1175.806) (-1177.596) (-1176.606) -- 0:00:19
686500 -- (-1179.466) (-1175.880) (-1179.838) [-1181.830] * (-1176.514) [-1175.656] (-1176.457) (-1176.236) -- 0:00:19
687000 -- (-1177.311) [-1180.053] (-1178.064) (-1177.039) * (-1177.593) [-1175.563] (-1177.058) (-1176.209) -- 0:00:19
687500 -- [-1176.718] (-1177.220) (-1179.175) (-1176.880) * (-1178.077) [-1176.319] (-1178.497) (-1176.760) -- 0:00:19
688000 -- (-1176.273) [-1178.273] (-1177.082) (-1179.081) * [-1176.639] (-1181.465) (-1177.396) (-1177.130) -- 0:00:19
688500 -- (-1179.197) (-1176.147) [-1176.902] (-1177.427) * [-1178.185] (-1177.105) (-1175.648) (-1176.789) -- 0:00:19
689000 -- (-1180.528) (-1175.656) [-1176.508] (-1176.893) * (-1176.016) (-1176.648) [-1177.609] (-1176.775) -- 0:00:19
689500 -- [-1179.294] (-1178.354) (-1176.215) (-1177.542) * [-1176.222] (-1177.446) (-1177.217) (-1179.783) -- 0:00:19
690000 -- (-1177.492) [-1175.653] (-1178.284) (-1178.164) * [-1179.109] (-1180.395) (-1176.874) (-1177.886) -- 0:00:19
Average standard deviation of split frequencies: 0.011322
690500 -- [-1176.056] (-1176.640) (-1179.173) (-1175.893) * (-1179.593) (-1178.502) [-1178.486] (-1179.046) -- 0:00:19
691000 -- (-1176.040) [-1179.364] (-1179.092) (-1175.522) * (-1176.505) [-1176.051] (-1179.906) (-1177.861) -- 0:00:19
691500 -- (-1176.560) [-1177.509] (-1179.351) (-1180.496) * (-1175.867) (-1178.498) (-1178.462) [-1176.171] -- 0:00:19
692000 -- [-1176.252] (-1176.869) (-1177.942) (-1186.050) * (-1177.423) (-1182.736) [-1176.802] (-1177.951) -- 0:00:19
692500 -- (-1176.826) [-1176.337] (-1179.513) (-1178.126) * [-1177.669] (-1180.675) (-1177.109) (-1178.877) -- 0:00:19
693000 -- (-1176.565) [-1177.856] (-1178.509) (-1178.251) * (-1179.485) (-1177.314) [-1177.307] (-1177.484) -- 0:00:19
693500 -- (-1178.679) (-1175.342) (-1178.720) [-1177.396] * (-1178.724) (-1176.833) (-1177.989) [-1176.360] -- 0:00:19
694000 -- (-1180.725) (-1177.932) (-1179.461) [-1175.353] * (-1177.446) (-1176.839) [-1176.735] (-1181.150) -- 0:00:18
694500 -- [-1177.812] (-1175.569) (-1176.748) (-1177.543) * (-1180.737) [-1179.560] (-1178.970) (-1180.797) -- 0:00:18
695000 -- (-1182.968) (-1177.071) (-1177.995) [-1178.661] * (-1177.329) (-1181.336) (-1178.994) [-1180.971] -- 0:00:18
Average standard deviation of split frequencies: 0.010996
695500 -- (-1180.962) (-1180.231) [-1176.571] (-1178.272) * (-1176.031) [-1182.576] (-1180.391) (-1180.822) -- 0:00:18
696000 -- (-1178.384) (-1177.753) (-1175.872) [-1177.283] * (-1176.712) (-1177.659) (-1178.763) [-1176.719] -- 0:00:18
696500 -- (-1183.386) (-1177.933) [-1178.374] (-1175.770) * (-1176.380) [-1179.343] (-1177.906) (-1177.867) -- 0:00:18
697000 -- [-1177.460] (-1177.365) (-1176.141) (-1176.925) * (-1176.228) (-1178.720) [-1178.106] (-1176.275) -- 0:00:18
697500 -- (-1177.614) (-1175.898) [-1177.744] (-1177.360) * (-1177.245) (-1179.862) (-1179.583) [-1175.701] -- 0:00:18
698000 -- (-1178.237) (-1177.193) (-1177.669) [-1176.176] * [-1175.968] (-1178.885) (-1181.353) (-1177.740) -- 0:00:18
698500 -- (-1176.406) [-1179.660] (-1177.288) (-1176.200) * (-1176.910) [-1181.716] (-1182.737) (-1175.942) -- 0:00:18
699000 -- (-1177.117) (-1181.453) [-1177.011] (-1181.605) * [-1176.226] (-1177.362) (-1179.192) (-1179.884) -- 0:00:18
699500 -- (-1177.202) (-1178.030) (-1176.688) [-1181.341] * (-1176.022) (-1175.879) [-1179.856] (-1175.546) -- 0:00:18
700000 -- (-1179.298) (-1176.779) (-1178.189) [-1181.396] * (-1176.817) [-1180.625] (-1176.119) (-1176.342) -- 0:00:18
Average standard deviation of split frequencies: 0.010302
700500 -- (-1176.535) (-1176.817) [-1176.436] (-1178.103) * (-1185.064) [-1185.100] (-1181.151) (-1176.180) -- 0:00:18
701000 -- [-1177.053] (-1176.110) (-1176.157) (-1178.356) * (-1180.171) (-1180.410) [-1179.679] (-1177.994) -- 0:00:18
701500 -- (-1178.202) (-1176.478) (-1179.278) [-1179.520] * (-1181.269) (-1181.007) [-1178.844] (-1181.200) -- 0:00:18
702000 -- [-1177.378] (-1175.501) (-1178.159) (-1183.034) * (-1178.912) [-1177.748] (-1179.575) (-1176.085) -- 0:00:18
702500 -- (-1178.989) [-1184.336] (-1180.502) (-1181.736) * (-1178.546) (-1180.150) (-1180.490) [-1178.862] -- 0:00:18
703000 -- (-1177.432) (-1179.963) [-1179.026] (-1175.611) * (-1178.571) [-1178.017] (-1179.010) (-1178.421) -- 0:00:18
703500 -- (-1177.051) (-1178.238) [-1176.594] (-1177.505) * (-1176.048) [-1175.367] (-1177.786) (-1179.940) -- 0:00:18
704000 -- (-1176.252) (-1178.101) (-1179.530) [-1181.357] * [-1177.696] (-1175.616) (-1176.118) (-1178.413) -- 0:00:18
704500 -- (-1177.792) (-1178.869) [-1178.206] (-1180.355) * (-1176.694) (-1175.745) [-1178.361] (-1179.617) -- 0:00:18
705000 -- [-1179.155] (-1177.715) (-1179.717) (-1177.778) * [-1176.330] (-1177.551) (-1178.517) (-1176.641) -- 0:00:18
Average standard deviation of split frequencies: 0.010408
705500 -- (-1178.769) [-1177.033] (-1180.211) (-1176.584) * (-1177.660) (-1175.279) [-1179.829] (-1175.695) -- 0:00:18
706000 -- (-1181.626) [-1176.832] (-1178.112) (-1176.993) * (-1178.517) [-1176.716] (-1176.215) (-1175.427) -- 0:00:18
706500 -- [-1178.871] (-1185.839) (-1177.120) (-1176.978) * (-1177.455) (-1176.160) [-1176.946] (-1175.483) -- 0:00:18
707000 -- [-1178.421] (-1177.081) (-1175.656) (-1176.873) * (-1178.794) (-1179.409) (-1179.267) [-1176.850] -- 0:00:18
707500 -- [-1178.278] (-1176.863) (-1177.184) (-1178.993) * (-1179.026) [-1175.734] (-1185.201) (-1176.624) -- 0:00:18
708000 -- (-1178.177) (-1177.435) (-1185.216) [-1175.701] * (-1176.253) [-1177.230] (-1175.856) (-1177.983) -- 0:00:18
708500 -- (-1184.164) [-1178.283] (-1176.052) (-1178.548) * (-1176.050) (-1176.869) [-1177.154] (-1178.542) -- 0:00:18
709000 -- (-1180.563) (-1177.464) [-1176.808] (-1178.030) * (-1177.637) (-1175.655) [-1177.684] (-1178.402) -- 0:00:18
709500 -- (-1177.065) (-1177.342) [-1176.264] (-1175.287) * (-1182.238) (-1178.204) (-1177.622) [-1179.522] -- 0:00:18
710000 -- (-1182.445) (-1176.691) [-1177.542] (-1177.534) * (-1179.275) (-1181.679) (-1177.257) [-1178.944] -- 0:00:17
Average standard deviation of split frequencies: 0.010262
710500 -- [-1178.330] (-1175.397) (-1177.752) (-1175.852) * (-1176.677) (-1182.552) [-1178.099] (-1178.322) -- 0:00:17
711000 -- (-1179.385) [-1177.152] (-1177.272) (-1177.907) * [-1176.989] (-1177.147) (-1178.552) (-1177.826) -- 0:00:17
711500 -- (-1178.362) (-1179.189) (-1179.388) [-1180.785] * (-1176.961) (-1176.428) (-1180.154) [-1176.969] -- 0:00:17
712000 -- (-1177.155) (-1176.638) (-1179.293) [-1176.994] * (-1176.882) [-1181.140] (-1177.287) (-1181.263) -- 0:00:17
712500 -- (-1176.784) (-1176.015) [-1178.282] (-1176.938) * (-1181.359) (-1178.606) [-1176.472] (-1175.413) -- 0:00:17
713000 -- [-1180.000] (-1177.710) (-1183.033) (-1176.120) * (-1180.997) (-1178.890) (-1178.762) [-1175.221] -- 0:00:17
713500 -- (-1175.871) (-1181.100) (-1183.207) [-1179.036] * (-1184.980) (-1180.968) (-1178.461) [-1179.487] -- 0:00:17
714000 -- [-1176.840] (-1180.287) (-1180.066) (-1178.134) * (-1177.001) (-1179.054) [-1178.691] (-1175.999) -- 0:00:17
714500 -- (-1180.728) (-1175.154) [-1180.257] (-1176.518) * [-1176.210] (-1180.047) (-1179.277) (-1176.957) -- 0:00:17
715000 -- (-1176.276) (-1176.417) (-1180.792) [-1175.812] * (-1176.290) [-1176.718] (-1178.601) (-1177.538) -- 0:00:17
Average standard deviation of split frequencies: 0.009835
715500 -- [-1175.831] (-1176.159) (-1177.481) (-1176.947) * (-1175.733) (-1181.510) (-1178.677) [-1176.269] -- 0:00:17
716000 -- (-1176.967) [-1176.718] (-1176.077) (-1177.152) * (-1182.561) (-1175.698) (-1178.745) [-1177.368] -- 0:00:17
716500 -- (-1178.445) (-1177.164) [-1177.261] (-1175.953) * (-1177.885) [-1176.007] (-1179.412) (-1181.125) -- 0:00:17
717000 -- (-1177.192) (-1178.992) (-1177.427) [-1177.766] * (-1175.433) (-1177.827) (-1177.397) [-1179.319] -- 0:00:17
717500 -- (-1176.812) [-1176.861] (-1182.413) (-1177.692) * (-1176.111) [-1176.646] (-1177.220) (-1177.830) -- 0:00:17
718000 -- (-1175.878) (-1178.091) [-1176.776] (-1176.585) * [-1176.700] (-1176.619) (-1178.958) (-1178.675) -- 0:00:17
718500 -- (-1178.817) (-1179.368) [-1177.585] (-1176.136) * (-1175.838) (-1176.892) [-1177.727] (-1179.479) -- 0:00:17
719000 -- (-1183.342) (-1176.834) [-1175.911] (-1176.978) * (-1178.767) (-1177.112) [-1176.644] (-1176.339) -- 0:00:17
719500 -- [-1176.531] (-1177.439) (-1177.860) (-1175.490) * [-1181.915] (-1178.892) (-1175.547) (-1178.102) -- 0:00:17
720000 -- (-1176.315) (-1177.228) (-1179.852) [-1178.259] * (-1175.802) (-1176.639) [-1179.582] (-1178.553) -- 0:00:17
Average standard deviation of split frequencies: 0.010384
720500 -- (-1177.568) [-1176.559] (-1177.552) (-1179.693) * (-1175.798) (-1177.370) [-1176.546] (-1176.017) -- 0:00:17
721000 -- (-1176.611) (-1176.536) [-1176.358] (-1181.316) * (-1175.693) (-1176.847) (-1175.851) [-1180.357] -- 0:00:17
721500 -- [-1179.029] (-1176.559) (-1176.126) (-1184.478) * [-1178.228] (-1178.510) (-1178.221) (-1181.512) -- 0:00:17
722000 -- (-1176.116) (-1176.513) (-1175.218) [-1179.306] * (-1179.053) (-1177.996) (-1175.897) [-1181.183] -- 0:00:17
722500 -- (-1178.576) (-1177.866) [-1175.787] (-1176.932) * (-1176.513) [-1177.963] (-1176.397) (-1176.657) -- 0:00:17
723000 -- (-1181.275) [-1177.445] (-1177.644) (-1177.864) * [-1177.829] (-1177.052) (-1176.525) (-1176.582) -- 0:00:17
723500 -- (-1180.279) [-1176.118] (-1178.390) (-1177.366) * (-1181.829) [-1176.777] (-1176.963) (-1177.739) -- 0:00:17
724000 -- (-1182.906) (-1176.514) (-1180.914) [-1178.484] * (-1180.291) (-1178.213) [-1176.866] (-1180.324) -- 0:00:17
724500 -- (-1181.736) [-1177.862] (-1180.991) (-1180.644) * [-1181.210] (-1178.218) (-1176.212) (-1177.068) -- 0:00:17
725000 -- (-1177.696) [-1177.127] (-1177.964) (-1177.921) * (-1178.906) (-1175.471) (-1176.496) [-1179.070] -- 0:00:17
Average standard deviation of split frequencies: 0.010962
725500 -- [-1183.611] (-1175.918) (-1176.159) (-1177.841) * (-1176.717) (-1175.760) (-1180.989) [-1176.123] -- 0:00:17
726000 -- (-1180.715) [-1178.787] (-1176.451) (-1176.013) * (-1181.300) [-1176.729] (-1180.058) (-1179.797) -- 0:00:16
726500 -- (-1178.375) (-1176.129) [-1176.144] (-1177.331) * (-1179.799) (-1176.425) (-1178.010) [-1180.399] -- 0:00:16
727000 -- [-1175.771] (-1176.054) (-1175.513) (-1177.832) * (-1175.704) (-1176.891) (-1180.066) [-1177.084] -- 0:00:16
727500 -- (-1181.904) (-1178.409) (-1175.577) [-1177.229] * [-1179.130] (-1175.538) (-1175.805) (-1176.577) -- 0:00:16
728000 -- (-1179.736) (-1178.522) [-1178.354] (-1177.926) * (-1176.450) (-1177.105) [-1179.191] (-1177.509) -- 0:00:16
728500 -- (-1181.854) (-1177.642) [-1177.716] (-1178.314) * [-1177.510] (-1176.456) (-1176.586) (-1176.327) -- 0:00:16
729000 -- [-1176.308] (-1179.956) (-1177.366) (-1175.508) * (-1176.461) (-1179.127) (-1177.317) [-1176.918] -- 0:00:16
729500 -- (-1175.900) [-1177.991] (-1178.591) (-1177.939) * [-1178.877] (-1176.295) (-1180.354) (-1179.387) -- 0:00:16
730000 -- (-1175.865) [-1175.218] (-1177.444) (-1176.870) * (-1176.210) [-1178.198] (-1179.141) (-1176.693) -- 0:00:16
Average standard deviation of split frequencies: 0.010588
730500 -- (-1178.232) (-1177.609) [-1175.446] (-1176.529) * [-1178.508] (-1178.513) (-1178.259) (-1177.192) -- 0:00:16
731000 -- [-1176.766] (-1177.868) (-1180.424) (-1178.140) * [-1176.454] (-1177.395) (-1176.199) (-1179.941) -- 0:00:16
731500 -- [-1180.338] (-1179.892) (-1176.383) (-1180.018) * (-1179.787) (-1177.026) [-1176.780] (-1179.111) -- 0:00:16
732000 -- (-1179.500) [-1176.963] (-1179.613) (-1180.661) * (-1179.838) [-1177.052] (-1176.729) (-1177.277) -- 0:00:16
732500 -- (-1175.688) [-1176.814] (-1179.635) (-1177.856) * (-1181.373) (-1180.107) [-1176.678] (-1176.489) -- 0:00:16
733000 -- (-1178.926) [-1181.384] (-1175.545) (-1179.126) * (-1175.286) (-1178.276) (-1176.690) [-1177.256] -- 0:00:16
733500 -- (-1179.409) [-1176.133] (-1175.692) (-1178.390) * [-1178.213] (-1176.140) (-1177.497) (-1180.812) -- 0:00:16
734000 -- (-1177.576) (-1179.881) [-1177.739] (-1176.876) * (-1176.281) (-1176.066) [-1178.231] (-1178.325) -- 0:00:16
734500 -- (-1177.794) (-1179.057) (-1178.885) [-1177.492] * (-1177.900) (-1177.002) (-1176.340) [-1177.593] -- 0:00:16
735000 -- (-1177.963) [-1178.319] (-1178.402) (-1177.895) * (-1180.339) [-1175.958] (-1178.771) (-1178.050) -- 0:00:16
Average standard deviation of split frequencies: 0.010008
735500 -- (-1175.406) (-1179.917) [-1179.163] (-1176.054) * (-1177.364) [-1178.835] (-1180.664) (-1178.405) -- 0:00:16
736000 -- (-1175.666) (-1177.818) [-1178.019] (-1176.416) * [-1176.655] (-1177.606) (-1176.613) (-1184.236) -- 0:00:16
736500 -- [-1177.201] (-1176.771) (-1177.869) (-1177.641) * [-1175.759] (-1180.003) (-1176.679) (-1182.505) -- 0:00:16
737000 -- (-1178.700) (-1177.650) (-1175.931) [-1179.933] * [-1175.552] (-1177.431) (-1177.129) (-1177.924) -- 0:00:16
737500 -- (-1179.005) [-1176.142] (-1175.999) (-1179.866) * [-1177.911] (-1177.820) (-1176.516) (-1175.619) -- 0:00:16
738000 -- [-1180.001] (-1179.908) (-1176.620) (-1185.538) * (-1179.459) (-1178.574) (-1180.966) [-1177.487] -- 0:00:16
738500 -- [-1175.576] (-1176.612) (-1182.508) (-1177.660) * (-1176.244) (-1180.079) (-1177.159) [-1176.329] -- 0:00:16
739000 -- (-1176.587) (-1176.792) (-1181.688) [-1179.383] * (-1177.050) (-1178.602) (-1177.627) [-1177.883] -- 0:00:16
739500 -- (-1175.618) (-1177.657) (-1177.286) [-1176.605] * (-1176.090) (-1179.839) (-1177.568) [-1175.698] -- 0:00:16
740000 -- [-1175.728] (-1180.388) (-1177.280) (-1177.378) * [-1177.345] (-1177.777) (-1178.454) (-1177.808) -- 0:00:16
Average standard deviation of split frequencies: 0.010371
740500 -- (-1179.460) [-1180.982] (-1177.783) (-1176.940) * [-1176.963] (-1177.296) (-1176.770) (-1177.705) -- 0:00:16
741000 -- [-1177.481] (-1183.506) (-1178.858) (-1178.571) * (-1179.482) (-1177.226) [-1178.293] (-1179.113) -- 0:00:16
741500 -- (-1176.781) (-1182.272) (-1177.813) [-1179.805] * (-1177.725) [-1177.010] (-1177.886) (-1178.669) -- 0:00:16
742000 -- (-1176.767) [-1181.991] (-1180.633) (-1181.491) * (-1179.176) (-1178.924) [-1177.999] (-1178.268) -- 0:00:15
742500 -- (-1178.138) [-1176.964] (-1180.696) (-1179.300) * (-1177.269) (-1178.832) (-1177.543) [-1180.630] -- 0:00:15
743000 -- (-1177.727) [-1179.554] (-1178.347) (-1177.792) * [-1177.651] (-1177.725) (-1175.654) (-1177.117) -- 0:00:15
743500 -- (-1175.624) (-1179.727) [-1175.618] (-1177.070) * (-1177.445) (-1178.847) (-1177.956) [-1177.355] -- 0:00:15
744000 -- [-1176.917] (-1177.744) (-1176.064) (-1176.896) * (-1177.248) (-1175.991) [-1179.437] (-1177.643) -- 0:00:15
744500 -- [-1178.124] (-1176.632) (-1180.087) (-1177.851) * [-1176.233] (-1175.655) (-1181.664) (-1180.374) -- 0:00:15
745000 -- [-1179.126] (-1178.305) (-1176.335) (-1175.878) * (-1175.736) (-1175.904) [-1177.484] (-1176.528) -- 0:00:15
Average standard deviation of split frequencies: 0.010408
745500 -- [-1176.465] (-1178.608) (-1175.944) (-1177.024) * (-1176.676) [-1175.509] (-1176.815) (-1176.632) -- 0:00:15
746000 -- (-1177.688) (-1178.210) (-1176.868) [-1177.424] * (-1176.783) (-1175.409) [-1176.815] (-1176.187) -- 0:00:15
746500 -- [-1177.036] (-1180.795) (-1176.653) (-1178.889) * (-1178.698) [-1177.161] (-1176.872) (-1175.749) -- 0:00:15
747000 -- (-1177.103) (-1177.672) [-1175.825] (-1179.971) * (-1178.247) [-1177.277] (-1175.741) (-1176.531) -- 0:00:15
747500 -- (-1176.132) [-1178.448] (-1181.175) (-1175.503) * (-1181.128) (-1177.477) (-1177.729) [-1176.598] -- 0:00:15
748000 -- [-1175.291] (-1180.163) (-1178.141) (-1176.328) * [-1175.827] (-1176.178) (-1177.728) (-1176.892) -- 0:00:15
748500 -- (-1178.471) (-1180.954) (-1176.576) [-1176.188] * (-1176.656) (-1176.133) [-1175.682] (-1178.705) -- 0:00:15
749000 -- (-1178.779) (-1178.171) [-1177.929] (-1178.881) * (-1177.338) (-1178.938) [-1176.100] (-1176.985) -- 0:00:15
749500 -- (-1176.486) [-1178.532] (-1177.891) (-1185.958) * (-1178.972) (-1182.428) [-1176.662] (-1176.923) -- 0:00:15
750000 -- (-1177.330) (-1177.212) [-1175.968] (-1181.804) * (-1176.578) (-1177.944) [-1177.763] (-1178.427) -- 0:00:15
Average standard deviation of split frequencies: 0.010491
750500 -- (-1177.320) (-1176.067) [-1179.902] (-1178.355) * (-1178.231) (-1175.816) (-1177.396) [-1181.439] -- 0:00:15
751000 -- [-1175.702] (-1176.277) (-1180.402) (-1177.391) * (-1176.684) [-1175.973] (-1176.476) (-1178.895) -- 0:00:15
751500 -- (-1177.750) (-1177.446) (-1175.230) [-1177.376] * (-1177.317) (-1176.059) (-1175.454) [-1176.055] -- 0:00:15
752000 -- (-1178.043) (-1182.314) (-1178.276) [-1178.914] * (-1180.047) (-1175.307) (-1178.678) [-1176.110] -- 0:00:15
752500 -- (-1179.434) [-1176.701] (-1180.080) (-1178.260) * [-1176.827] (-1175.489) (-1177.456) (-1177.380) -- 0:00:15
753000 -- [-1177.811] (-1176.519) (-1180.021) (-1176.839) * (-1176.670) [-1176.046] (-1178.556) (-1176.305) -- 0:00:15
753500 -- (-1178.450) (-1177.832) [-1176.628] (-1176.048) * (-1177.172) (-1176.348) (-1175.777) [-1176.364] -- 0:00:15
754000 -- (-1177.662) (-1178.067) (-1176.018) [-1178.759] * (-1183.106) [-1177.716] (-1177.138) (-1175.618) -- 0:00:15
754500 -- (-1175.849) [-1177.856] (-1181.358) (-1179.035) * (-1177.879) [-1177.422] (-1181.086) (-1178.269) -- 0:00:15
755000 -- (-1178.951) (-1179.389) [-1178.021] (-1179.461) * [-1177.026] (-1177.845) (-1179.437) (-1177.285) -- 0:00:15
Average standard deviation of split frequencies: 0.010307
755500 -- [-1177.560] (-1182.748) (-1178.888) (-1176.553) * (-1179.874) (-1176.131) (-1177.951) [-1177.144] -- 0:00:15
756000 -- (-1176.912) (-1184.479) [-1176.444] (-1178.655) * (-1176.637) (-1176.729) [-1176.790] (-1176.203) -- 0:00:15
756500 -- (-1180.526) [-1177.649] (-1176.884) (-1179.059) * [-1180.608] (-1175.591) (-1179.656) (-1176.393) -- 0:00:15
757000 -- (-1177.171) (-1177.932) (-1177.222) [-1176.287] * (-1179.405) (-1176.137) (-1178.205) [-1179.101] -- 0:00:15
757500 -- (-1176.609) (-1179.386) (-1175.651) [-1177.044] * (-1177.800) [-1177.347] (-1180.893) (-1182.623) -- 0:00:15
758000 -- (-1179.118) (-1178.546) (-1175.986) [-1176.259] * [-1176.855] (-1175.852) (-1179.339) (-1178.978) -- 0:00:15
758500 -- (-1175.807) (-1181.822) [-1175.895] (-1178.782) * (-1177.917) (-1175.855) (-1179.772) [-1179.313] -- 0:00:14
759000 -- (-1176.803) [-1180.387] (-1176.040) (-1178.193) * (-1176.887) (-1179.289) [-1179.384] (-1178.624) -- 0:00:14
759500 -- (-1176.272) (-1177.808) [-1175.277] (-1175.562) * [-1177.681] (-1178.309) (-1179.927) (-1177.467) -- 0:00:14
760000 -- (-1179.356) (-1177.158) [-1176.488] (-1177.291) * [-1177.223] (-1176.548) (-1181.509) (-1178.098) -- 0:00:14
Average standard deviation of split frequencies: 0.010317
760500 -- (-1178.729) [-1178.865] (-1175.827) (-1175.669) * [-1177.986] (-1178.769) (-1177.586) (-1178.814) -- 0:00:14
761000 -- (-1176.810) (-1178.814) [-1176.438] (-1175.886) * (-1178.676) (-1178.399) (-1175.294) [-1176.430] -- 0:00:14
761500 -- [-1176.291] (-1178.390) (-1176.308) (-1176.073) * (-1176.546) (-1177.181) (-1175.204) [-1179.434] -- 0:00:14
762000 -- (-1177.162) (-1179.503) (-1179.655) [-1176.788] * (-1177.476) [-1176.898] (-1177.325) (-1177.515) -- 0:00:14
762500 -- (-1182.387) (-1178.027) [-1179.945] (-1176.139) * (-1175.669) (-1176.542) [-1177.734] (-1178.310) -- 0:00:14
763000 -- (-1178.300) [-1177.632] (-1178.603) (-1175.645) * (-1176.895) (-1175.829) (-1178.548) [-1176.138] -- 0:00:14
763500 -- [-1177.981] (-1178.440) (-1175.860) (-1175.706) * (-1177.055) (-1177.000) [-1177.134] (-1176.272) -- 0:00:14
764000 -- (-1177.562) [-1176.592] (-1178.187) (-1178.170) * (-1177.198) [-1176.697] (-1176.608) (-1180.377) -- 0:00:14
764500 -- (-1179.713) (-1175.252) (-1177.172) [-1176.809] * [-1176.151] (-1176.164) (-1176.597) (-1176.156) -- 0:00:14
765000 -- (-1176.930) [-1175.541] (-1180.667) (-1178.382) * [-1177.743] (-1179.291) (-1181.502) (-1177.060) -- 0:00:14
Average standard deviation of split frequencies: 0.010353
765500 -- (-1179.569) (-1178.003) [-1181.868] (-1177.704) * (-1177.771) [-1177.093] (-1178.638) (-1175.721) -- 0:00:14
766000 -- (-1176.271) (-1177.600) [-1175.489] (-1176.470) * (-1179.604) [-1176.878] (-1177.866) (-1176.021) -- 0:00:14
766500 -- [-1177.286] (-1181.188) (-1177.132) (-1176.799) * (-1177.099) (-1178.726) (-1180.974) [-1176.918] -- 0:00:14
767000 -- [-1177.574] (-1177.180) (-1176.999) (-1178.731) * (-1179.715) [-1179.660] (-1177.178) (-1176.217) -- 0:00:14
767500 -- (-1182.710) (-1179.642) [-1176.617] (-1176.084) * [-1180.043] (-1180.611) (-1176.210) (-1177.837) -- 0:00:14
768000 -- (-1181.537) (-1180.291) (-1176.253) [-1175.903] * (-1181.039) [-1177.657] (-1178.098) (-1179.087) -- 0:00:14
768500 -- [-1178.813] (-1179.765) (-1177.097) (-1182.720) * (-1179.210) (-1176.135) [-1176.189] (-1177.588) -- 0:00:14
769000 -- (-1177.567) (-1181.612) (-1177.582) [-1176.635] * (-1176.422) (-1178.634) (-1176.559) [-1175.834] -- 0:00:14
769500 -- [-1175.585] (-1177.566) (-1175.876) (-1178.812) * (-1177.659) (-1176.292) (-1176.973) [-1179.143] -- 0:00:14
770000 -- (-1176.854) (-1177.081) (-1177.700) [-1178.036] * [-1177.165] (-1176.024) (-1178.495) (-1176.262) -- 0:00:14
Average standard deviation of split frequencies: 0.010219
770500 -- [-1176.765] (-1176.811) (-1176.786) (-1176.813) * (-1176.884) (-1182.743) [-1178.006] (-1177.313) -- 0:00:14
771000 -- (-1177.104) (-1176.795) (-1178.380) [-1180.895] * (-1176.776) (-1177.533) [-1178.298] (-1178.804) -- 0:00:14
771500 -- (-1177.952) [-1176.994] (-1176.814) (-1179.612) * (-1179.359) (-1176.188) [-1177.505] (-1180.715) -- 0:00:14
772000 -- (-1176.743) (-1176.237) [-1175.563] (-1179.562) * (-1178.634) (-1180.174) [-1176.895] (-1179.108) -- 0:00:14
772500 -- [-1176.394] (-1175.376) (-1176.816) (-1178.333) * (-1175.970) (-1177.634) (-1175.998) [-1177.115] -- 0:00:14
773000 -- (-1177.877) (-1176.988) [-1176.013] (-1178.167) * (-1175.665) (-1181.566) (-1179.004) [-1178.036] -- 0:00:14
773500 -- (-1177.784) (-1179.531) (-1176.336) [-1179.455] * [-1176.743] (-1177.026) (-1180.497) (-1175.748) -- 0:00:14
774000 -- (-1177.817) [-1176.705] (-1177.254) (-1178.431) * [-1176.451] (-1176.050) (-1176.998) (-1178.234) -- 0:00:14
774500 -- [-1177.246] (-1177.557) (-1178.817) (-1181.121) * (-1176.446) (-1178.591) (-1175.950) [-1178.144] -- 0:00:13
775000 -- (-1177.469) (-1177.829) [-1177.203] (-1176.729) * (-1175.537) (-1177.233) (-1176.545) [-1179.081] -- 0:00:13
Average standard deviation of split frequencies: 0.010256
775500 -- (-1177.416) (-1175.633) [-1179.722] (-1178.695) * (-1180.820) (-1177.311) [-1179.535] (-1177.912) -- 0:00:13
776000 -- (-1178.281) [-1177.733] (-1175.894) (-1179.496) * (-1179.382) (-1176.602) (-1180.129) [-1176.469] -- 0:00:13
776500 -- (-1175.933) (-1176.429) [-1177.333] (-1179.488) * [-1177.312] (-1176.867) (-1177.772) (-1177.965) -- 0:00:13
777000 -- (-1176.132) (-1176.333) (-1177.199) [-1184.216] * (-1186.538) [-1180.372] (-1176.143) (-1177.857) -- 0:00:13
777500 -- [-1178.564] (-1177.008) (-1180.471) (-1184.290) * (-1179.183) (-1179.553) (-1176.794) [-1175.983] -- 0:00:13
778000 -- (-1177.803) (-1177.598) (-1178.401) [-1177.168] * [-1177.472] (-1179.573) (-1179.270) (-1177.199) -- 0:00:13
778500 -- [-1175.996] (-1176.811) (-1176.693) (-1175.803) * [-1178.173] (-1177.320) (-1178.529) (-1177.568) -- 0:00:13
779000 -- (-1180.824) (-1176.120) (-1177.927) [-1177.031] * [-1175.530] (-1176.736) (-1179.327) (-1178.615) -- 0:00:13
779500 -- [-1175.481] (-1178.999) (-1176.758) (-1176.738) * (-1179.088) (-1177.627) (-1175.604) [-1179.494] -- 0:00:13
780000 -- (-1179.502) (-1178.334) [-1176.899] (-1180.528) * [-1176.806] (-1175.506) (-1176.785) (-1178.621) -- 0:00:13
Average standard deviation of split frequencies: 0.010077
780500 -- (-1177.480) (-1181.999) [-1176.057] (-1178.155) * (-1177.458) (-1176.652) (-1177.750) [-1178.329] -- 0:00:13
781000 -- (-1176.869) (-1176.773) [-1176.659] (-1180.153) * (-1179.314) [-1176.486] (-1175.235) (-1182.314) -- 0:00:13
781500 -- (-1178.100) (-1177.363) [-1176.617] (-1180.488) * (-1178.409) (-1178.052) [-1175.682] (-1175.666) -- 0:00:13
782000 -- (-1180.450) (-1176.259) (-1176.527) [-1176.978] * (-1177.121) (-1180.967) [-1177.154] (-1180.860) -- 0:00:13
782500 -- [-1178.224] (-1180.541) (-1175.984) (-1177.430) * [-1179.641] (-1182.463) (-1177.798) (-1177.433) -- 0:00:13
783000 -- [-1177.213] (-1176.336) (-1175.589) (-1175.844) * (-1178.738) (-1177.692) (-1179.397) [-1177.655] -- 0:00:13
783500 -- (-1177.917) (-1180.159) (-1176.560) [-1176.443] * (-1178.474) [-1179.326] (-1177.772) (-1177.867) -- 0:00:13
784000 -- [-1176.053] (-1178.737) (-1178.858) (-1177.631) * (-1177.281) (-1178.855) [-1175.998] (-1180.291) -- 0:00:13
784500 -- (-1177.684) (-1176.566) [-1177.755] (-1178.233) * (-1176.020) (-1180.133) (-1178.798) [-1180.273] -- 0:00:13
785000 -- (-1178.372) [-1176.928] (-1176.156) (-1181.860) * (-1176.591) (-1177.729) (-1179.732) [-1176.449] -- 0:00:13
Average standard deviation of split frequencies: 0.010196
785500 -- [-1175.870] (-1177.002) (-1180.262) (-1180.023) * (-1175.430) (-1176.648) [-1177.116] (-1176.429) -- 0:00:13
786000 -- (-1176.322) (-1177.793) [-1177.731] (-1180.606) * (-1176.332) (-1176.987) (-1177.956) [-1176.245] -- 0:00:13
786500 -- [-1176.381] (-1176.540) (-1178.886) (-1181.607) * (-1178.451) (-1176.788) [-1177.191] (-1177.309) -- 0:00:13
787000 -- [-1180.282] (-1175.853) (-1176.776) (-1176.706) * (-1178.590) [-1176.119] (-1176.521) (-1178.179) -- 0:00:13
787500 -- [-1178.107] (-1175.904) (-1176.799) (-1179.694) * [-1176.505] (-1178.039) (-1176.732) (-1177.755) -- 0:00:13
788000 -- (-1180.698) (-1178.317) (-1177.237) [-1179.374] * [-1178.214] (-1176.292) (-1177.077) (-1177.931) -- 0:00:13
788500 -- [-1177.770] (-1181.820) (-1176.817) (-1182.024) * (-1175.935) (-1177.431) [-1176.105] (-1179.546) -- 0:00:13
789000 -- (-1177.742) (-1178.579) (-1177.110) [-1178.368] * (-1177.671) (-1177.149) (-1175.968) [-1182.491] -- 0:00:13
789500 -- (-1182.647) (-1179.215) [-1176.812] (-1178.714) * (-1184.047) (-1175.443) (-1177.384) [-1180.053] -- 0:00:13
790000 -- (-1179.111) [-1178.535] (-1176.819) (-1177.868) * (-1179.621) (-1177.687) [-1175.833] (-1176.554) -- 0:00:13
Average standard deviation of split frequencies: 0.010322
790500 -- (-1176.203) [-1176.447] (-1178.118) (-1177.014) * (-1180.082) (-1178.296) (-1180.124) [-1176.864] -- 0:00:12
791000 -- (-1178.066) (-1175.461) [-1178.625] (-1177.263) * [-1179.296] (-1181.872) (-1177.171) (-1177.799) -- 0:00:12
791500 -- [-1180.347] (-1175.420) (-1176.496) (-1176.564) * (-1178.522) (-1177.078) (-1180.421) [-1176.899] -- 0:00:12
792000 -- [-1182.843] (-1175.929) (-1175.991) (-1176.548) * [-1179.223] (-1177.636) (-1179.581) (-1176.164) -- 0:00:12
792500 -- (-1185.398) (-1177.658) (-1177.183) [-1176.214] * (-1177.952) (-1176.815) (-1182.079) [-1178.446] -- 0:00:12
793000 -- [-1179.140] (-1176.401) (-1177.049) (-1175.220) * (-1176.187) [-1184.028] (-1178.978) (-1178.563) -- 0:00:12
793500 -- [-1177.910] (-1176.423) (-1176.510) (-1177.735) * (-1176.446) [-1178.568] (-1177.687) (-1178.700) -- 0:00:12
794000 -- (-1176.339) (-1176.643) [-1176.112] (-1179.049) * [-1176.344] (-1180.519) (-1178.651) (-1176.257) -- 0:00:12
794500 -- (-1179.261) [-1177.836] (-1176.654) (-1177.753) * (-1183.535) (-1180.994) [-1180.512] (-1175.308) -- 0:00:12
795000 -- [-1175.424] (-1178.089) (-1177.012) (-1182.533) * [-1177.314] (-1179.418) (-1178.473) (-1179.304) -- 0:00:12
Average standard deviation of split frequencies: 0.010031
795500 -- (-1176.180) [-1177.025] (-1177.003) (-1177.035) * (-1176.351) (-1178.025) [-1179.000] (-1179.608) -- 0:00:12
796000 -- [-1180.199] (-1176.583) (-1177.851) (-1180.361) * [-1176.797] (-1180.976) (-1175.693) (-1176.878) -- 0:00:12
796500 -- (-1177.352) (-1176.363) [-1176.995] (-1178.344) * [-1178.261] (-1178.713) (-1176.177) (-1176.628) -- 0:00:12
797000 -- [-1178.162] (-1177.515) (-1176.087) (-1182.498) * (-1179.107) (-1183.688) [-1176.920] (-1180.165) -- 0:00:12
797500 -- [-1175.474] (-1177.617) (-1179.212) (-1176.820) * (-1176.811) (-1182.429) (-1177.572) [-1176.988] -- 0:00:12
798000 -- (-1177.065) (-1180.530) [-1176.865] (-1175.815) * (-1178.447) (-1180.943) (-1176.376) [-1176.471] -- 0:00:12
798500 -- (-1180.047) (-1178.929) (-1177.217) [-1177.916] * (-1178.663) (-1181.182) [-1177.525] (-1177.277) -- 0:00:12
799000 -- [-1175.660] (-1175.564) (-1176.793) (-1178.601) * (-1177.919) (-1181.235) (-1177.259) [-1178.218] -- 0:00:12
799500 -- [-1178.710] (-1176.125) (-1176.559) (-1179.471) * (-1177.798) (-1176.412) (-1176.328) [-1176.198] -- 0:00:12
800000 -- (-1176.384) [-1176.033] (-1176.342) (-1178.519) * (-1177.647) [-1176.635] (-1176.079) (-1183.462) -- 0:00:12
Average standard deviation of split frequencies: 0.009825
800500 -- (-1178.377) (-1175.997) (-1178.661) [-1182.499] * (-1178.550) [-1176.668] (-1178.760) (-1175.136) -- 0:00:12
801000 -- (-1176.957) (-1178.999) (-1176.789) [-1175.642] * (-1177.892) (-1176.422) [-1177.030] (-1175.167) -- 0:00:12
801500 -- [-1177.912] (-1178.480) (-1176.668) (-1180.232) * (-1176.432) (-1177.689) (-1185.690) [-1177.926] -- 0:00:12
802000 -- [-1176.154] (-1175.810) (-1176.569) (-1176.426) * (-1178.664) [-1175.724] (-1178.912) (-1177.828) -- 0:00:12
802500 -- [-1177.275] (-1176.579) (-1178.428) (-1175.912) * (-1177.909) (-1177.598) [-1176.462] (-1179.571) -- 0:00:12
803000 -- (-1177.981) (-1177.341) [-1176.810] (-1176.321) * (-1179.126) (-1177.379) [-1176.621] (-1179.169) -- 0:00:12
803500 -- (-1176.520) [-1176.954] (-1177.404) (-1177.521) * [-1178.730] (-1177.967) (-1177.669) (-1178.479) -- 0:00:12
804000 -- [-1178.410] (-1178.086) (-1180.695) (-1176.916) * (-1178.196) (-1178.312) (-1176.371) [-1177.759] -- 0:00:12
804500 -- (-1176.126) (-1179.633) (-1181.229) [-1175.730] * (-1178.579) [-1177.398] (-1176.506) (-1179.808) -- 0:00:12
805000 -- (-1176.075) (-1177.546) [-1176.380] (-1177.944) * (-1177.856) (-1178.053) [-1176.208] (-1180.164) -- 0:00:12
Average standard deviation of split frequencies: 0.009541
805500 -- (-1176.534) [-1177.943] (-1178.141) (-1175.776) * [-1178.222] (-1182.059) (-1176.195) (-1178.794) -- 0:00:12
806000 -- (-1176.489) (-1178.066) (-1177.456) [-1178.185] * (-1175.629) (-1177.668) [-1177.967] (-1180.798) -- 0:00:12
806500 -- (-1179.520) (-1184.843) (-1184.616) [-1176.608] * [-1178.606] (-1177.457) (-1176.158) (-1178.854) -- 0:00:11
807000 -- [-1178.135] (-1180.806) (-1181.479) (-1177.635) * (-1176.246) [-1176.277] (-1179.601) (-1175.365) -- 0:00:11
807500 -- [-1177.466] (-1177.678) (-1178.471) (-1177.962) * [-1176.656] (-1176.177) (-1175.789) (-1176.330) -- 0:00:11
808000 -- (-1175.433) (-1176.979) [-1176.181] (-1177.890) * [-1177.163] (-1176.225) (-1179.272) (-1176.272) -- 0:00:11
808500 -- (-1175.733) [-1176.825] (-1176.569) (-1177.796) * (-1179.363) (-1176.330) (-1176.397) [-1181.414] -- 0:00:11
809000 -- (-1177.823) (-1177.454) [-1177.959] (-1180.326) * (-1182.029) [-1176.371] (-1179.161) (-1177.824) -- 0:00:11
809500 -- [-1177.198] (-1176.034) (-1179.333) (-1177.536) * (-1177.763) [-1176.100] (-1179.107) (-1176.675) -- 0:00:11
810000 -- (-1176.829) [-1176.927] (-1180.351) (-1177.473) * (-1175.963) (-1178.120) [-1179.027] (-1178.054) -- 0:00:11
Average standard deviation of split frequencies: 0.009558
810500 -- (-1181.743) [-1176.643] (-1179.277) (-1175.823) * (-1177.584) (-1176.574) [-1179.458] (-1178.247) -- 0:00:11
811000 -- (-1177.619) [-1177.106] (-1176.507) (-1176.843) * (-1175.614) [-1177.217] (-1178.048) (-1178.419) -- 0:00:11
811500 -- [-1176.558] (-1183.424) (-1177.659) (-1179.405) * (-1178.625) (-1178.388) (-1176.038) [-1176.249] -- 0:00:11
812000 -- (-1176.162) (-1178.252) (-1177.379) [-1181.522] * [-1176.680] (-1175.972) (-1178.088) (-1176.536) -- 0:00:11
812500 -- (-1175.703) (-1175.798) [-1181.545] (-1175.914) * [-1177.078] (-1179.081) (-1183.638) (-1179.058) -- 0:00:11
813000 -- (-1178.403) [-1176.659] (-1178.089) (-1176.325) * [-1175.537] (-1178.222) (-1177.068) (-1177.560) -- 0:00:11
813500 -- [-1176.639] (-1178.240) (-1175.649) (-1177.763) * (-1181.756) [-1178.685] (-1177.345) (-1178.114) -- 0:00:11
814000 -- (-1177.833) (-1177.405) (-1176.622) [-1175.443] * (-1182.208) (-1177.745) [-1176.759] (-1178.289) -- 0:00:11
814500 -- [-1176.188] (-1176.914) (-1176.684) (-1175.369) * (-1177.914) (-1178.035) (-1176.977) [-1177.654] -- 0:00:11
815000 -- (-1176.387) [-1177.042] (-1180.139) (-1176.520) * [-1180.865] (-1177.225) (-1179.224) (-1176.208) -- 0:00:11
Average standard deviation of split frequencies: 0.009677
815500 -- (-1176.852) [-1176.143] (-1181.152) (-1178.562) * [-1179.945] (-1176.026) (-1178.561) (-1177.065) -- 0:00:11
816000 -- [-1175.509] (-1177.163) (-1175.524) (-1176.602) * [-1177.903] (-1183.161) (-1177.968) (-1176.519) -- 0:00:11
816500 -- [-1175.215] (-1178.503) (-1179.546) (-1176.069) * (-1176.331) [-1179.353] (-1179.754) (-1175.699) -- 0:00:11
817000 -- [-1178.047] (-1177.198) (-1177.693) (-1178.400) * (-1175.309) [-1179.137] (-1180.926) (-1177.963) -- 0:00:11
817500 -- (-1178.046) [-1177.399] (-1180.108) (-1176.472) * (-1177.072) [-1182.572] (-1181.320) (-1178.844) -- 0:00:11
818000 -- (-1177.217) (-1177.677) [-1176.849] (-1179.345) * [-1178.768] (-1178.151) (-1180.075) (-1177.602) -- 0:00:11
818500 -- [-1177.230] (-1178.092) (-1179.213) (-1184.911) * (-1178.177) (-1177.597) (-1179.189) [-1176.769] -- 0:00:11
819000 -- (-1176.279) (-1178.453) [-1177.636] (-1178.278) * (-1177.815) (-1178.512) (-1176.378) [-1179.958] -- 0:00:11
819500 -- (-1177.806) [-1178.026] (-1177.031) (-1175.688) * (-1177.382) (-1179.437) (-1181.500) [-1176.159] -- 0:00:11
820000 -- [-1177.707] (-1177.552) (-1180.488) (-1177.573) * [-1176.770] (-1178.178) (-1177.144) (-1176.490) -- 0:00:11
Average standard deviation of split frequencies: 0.009693
820500 -- [-1178.653] (-1179.923) (-1176.070) (-1177.792) * (-1176.083) (-1177.928) (-1180.556) [-1177.830] -- 0:00:11
821000 -- [-1178.450] (-1176.842) (-1175.531) (-1177.187) * [-1176.081] (-1181.263) (-1179.570) (-1177.283) -- 0:00:11
821500 -- (-1178.234) [-1175.719] (-1179.250) (-1176.716) * (-1177.449) [-1176.419] (-1176.371) (-1176.689) -- 0:00:11
822000 -- [-1176.900] (-1177.417) (-1179.251) (-1179.601) * [-1178.804] (-1178.062) (-1175.606) (-1176.941) -- 0:00:11
822500 -- (-1177.443) (-1177.408) [-1180.211] (-1177.736) * (-1178.556) [-1177.011] (-1176.969) (-1176.323) -- 0:00:11
823000 -- (-1178.432) (-1176.797) (-1181.296) [-1177.526] * [-1175.319] (-1179.288) (-1181.359) (-1177.447) -- 0:00:10
823500 -- (-1177.217) (-1178.421) (-1182.222) [-1177.075] * [-1179.245] (-1176.680) (-1175.986) (-1181.838) -- 0:00:10
824000 -- [-1176.883] (-1179.501) (-1177.897) (-1177.833) * (-1180.503) [-1181.501] (-1179.314) (-1181.344) -- 0:00:10
824500 -- [-1176.567] (-1181.659) (-1175.914) (-1180.942) * (-1178.215) [-1177.979] (-1177.938) (-1176.025) -- 0:00:10
825000 -- [-1175.969] (-1181.489) (-1177.776) (-1176.122) * (-1178.974) (-1176.670) (-1178.012) [-1177.455] -- 0:00:10
Average standard deviation of split frequencies: 0.009381
825500 -- [-1178.816] (-1176.955) (-1176.568) (-1176.579) * (-1177.243) (-1176.237) (-1180.218) [-1179.407] -- 0:00:10
826000 -- [-1176.329] (-1176.268) (-1177.072) (-1179.146) * (-1177.250) [-1178.703] (-1176.549) (-1178.425) -- 0:00:10
826500 -- (-1177.253) (-1175.352) (-1175.699) [-1178.466] * [-1175.478] (-1176.947) (-1177.032) (-1175.946) -- 0:00:10
827000 -- [-1178.767] (-1175.606) (-1177.114) (-1177.658) * (-1176.049) [-1178.070] (-1177.541) (-1179.472) -- 0:00:10
827500 -- (-1176.042) (-1181.127) [-1176.274] (-1178.371) * (-1176.609) (-1177.916) [-1177.760] (-1178.612) -- 0:00:10
828000 -- [-1180.517] (-1178.771) (-1180.329) (-1179.343) * (-1176.131) (-1176.827) [-1176.475] (-1178.304) -- 0:00:10
828500 -- (-1177.741) [-1177.015] (-1178.830) (-1177.711) * [-1177.072] (-1175.855) (-1176.265) (-1177.196) -- 0:00:10
829000 -- [-1176.787] (-1177.088) (-1186.534) (-1177.435) * [-1177.742] (-1176.174) (-1177.344) (-1177.232) -- 0:00:10
829500 -- (-1177.461) (-1179.394) [-1180.172] (-1176.078) * (-1179.565) (-1177.926) (-1176.591) [-1176.439] -- 0:00:10
830000 -- (-1177.133) [-1179.373] (-1181.134) (-1179.325) * [-1179.241] (-1176.222) (-1178.838) (-1178.589) -- 0:00:10
Average standard deviation of split frequencies: 0.009754
830500 -- (-1177.153) (-1177.619) (-1178.089) [-1177.335] * (-1178.874) (-1178.455) [-1178.188] (-1178.472) -- 0:00:10
831000 -- (-1177.521) [-1176.741] (-1180.713) (-1177.139) * (-1177.029) (-1180.764) (-1177.223) [-1178.313] -- 0:00:10
831500 -- (-1176.052) (-1175.620) (-1179.485) [-1176.128] * (-1178.129) (-1177.802) (-1178.534) [-1177.300] -- 0:00:10
832000 -- (-1175.280) [-1176.825] (-1176.405) (-1178.103) * (-1176.707) (-1175.856) [-1176.580] (-1176.982) -- 0:00:10
832500 -- [-1177.958] (-1177.710) (-1183.619) (-1176.309) * [-1175.201] (-1179.773) (-1175.851) (-1179.984) -- 0:00:10
833000 -- (-1176.595) (-1177.949) [-1178.417] (-1176.473) * [-1175.439] (-1179.441) (-1182.333) (-1179.351) -- 0:00:10
833500 -- (-1177.927) (-1177.308) (-1177.256) [-1176.476] * (-1175.751) [-1176.383] (-1179.690) (-1180.904) -- 0:00:10
834000 -- (-1180.154) (-1175.600) (-1179.111) [-1176.086] * (-1176.837) (-1180.656) (-1178.055) [-1178.090] -- 0:00:10
834500 -- [-1181.317] (-1181.061) (-1177.810) (-1175.982) * (-1179.444) [-1177.675] (-1176.765) (-1177.476) -- 0:00:10
835000 -- (-1177.295) (-1177.861) [-1176.223] (-1176.735) * (-1176.213) (-1177.711) (-1183.760) [-1177.345] -- 0:00:10
Average standard deviation of split frequencies: 0.009586
835500 -- (-1182.266) [-1175.825] (-1181.517) (-1178.275) * (-1177.504) (-1178.068) [-1177.928] (-1177.398) -- 0:00:10
836000 -- (-1178.541) (-1177.125) [-1178.231] (-1178.456) * (-1178.532) [-1179.447] (-1175.232) (-1179.565) -- 0:00:10
836500 -- (-1179.000) [-1181.810] (-1179.042) (-1177.326) * [-1179.001] (-1176.300) (-1179.206) (-1176.318) -- 0:00:10
837000 -- [-1177.150] (-1178.181) (-1179.576) (-1175.708) * (-1176.748) (-1179.352) (-1178.305) [-1175.834] -- 0:00:10
837500 -- [-1176.326] (-1179.423) (-1183.576) (-1177.420) * (-1175.979) (-1175.319) [-1176.675] (-1176.836) -- 0:00:10
838000 -- (-1177.516) (-1176.145) [-1177.423] (-1176.381) * (-1175.764) (-1177.475) [-1179.168] (-1176.343) -- 0:00:10
838500 -- [-1175.617] (-1179.863) (-1177.672) (-1178.449) * (-1180.429) (-1177.346) [-1177.196] (-1176.599) -- 0:00:10
839000 -- (-1177.206) (-1178.093) (-1178.530) [-1177.325] * [-1177.059] (-1175.699) (-1178.543) (-1178.139) -- 0:00:09
839500 -- [-1176.014] (-1180.033) (-1176.772) (-1178.867) * (-1176.752) (-1181.117) (-1176.613) [-1176.660] -- 0:00:09
840000 -- (-1176.783) [-1176.355] (-1177.314) (-1177.794) * (-1180.323) (-1175.661) (-1179.397) [-1176.573] -- 0:00:09
Average standard deviation of split frequencies: 0.009302
840500 -- (-1177.200) [-1176.647] (-1176.864) (-1180.274) * (-1177.114) (-1177.857) [-1175.501] (-1176.312) -- 0:00:09
841000 -- (-1180.261) (-1180.927) [-1179.801] (-1176.010) * (-1178.029) (-1175.909) (-1175.603) [-1177.317] -- 0:00:09
841500 -- (-1176.062) (-1175.951) (-1177.519) [-1180.620] * [-1177.537] (-1176.358) (-1177.513) (-1177.815) -- 0:00:09
842000 -- (-1179.270) (-1178.232) [-1177.159] (-1177.650) * [-1177.872] (-1176.382) (-1180.852) (-1176.905) -- 0:00:09
842500 -- (-1180.117) (-1177.521) (-1177.430) [-1176.879] * (-1180.102) (-1176.598) (-1177.317) [-1178.077] -- 0:00:09
843000 -- (-1179.008) (-1175.353) [-1176.208] (-1177.451) * (-1183.690) (-1178.335) (-1179.992) [-1177.732] -- 0:00:09
843500 -- (-1175.653) [-1181.799] (-1178.988) (-1176.158) * (-1184.274) (-1180.671) (-1186.389) [-1178.095] -- 0:00:09
844000 -- [-1177.603] (-1179.378) (-1175.864) (-1176.140) * (-1182.232) (-1175.861) (-1177.267) [-1176.435] -- 0:00:09
844500 -- (-1176.295) (-1178.421) (-1185.753) [-1175.155] * (-1176.647) (-1178.596) (-1180.468) [-1177.607] -- 0:00:09
845000 -- (-1180.588) [-1178.410] (-1183.025) (-1176.067) * (-1179.828) (-1176.190) [-1177.217] (-1177.699) -- 0:00:09
Average standard deviation of split frequencies: 0.009735
845500 -- (-1179.263) [-1177.932] (-1181.756) (-1178.499) * (-1175.960) (-1176.913) (-1177.151) [-1177.415] -- 0:00:09
846000 -- (-1177.466) (-1176.774) [-1177.337] (-1176.321) * (-1176.331) (-1178.437) (-1179.538) [-1176.784] -- 0:00:09
846500 -- [-1175.786] (-1179.614) (-1175.742) (-1179.136) * (-1175.545) (-1181.236) (-1179.528) [-1175.507] -- 0:00:09
847000 -- (-1178.367) (-1176.100) (-1175.502) [-1182.754] * (-1178.775) (-1180.437) (-1179.289) [-1178.084] -- 0:00:09
847500 -- (-1178.962) [-1181.365] (-1176.164) (-1178.773) * (-1178.095) [-1176.142] (-1182.983) (-1177.158) -- 0:00:09
848000 -- (-1179.228) (-1179.310) (-1176.696) [-1177.855] * [-1175.658] (-1178.391) (-1178.654) (-1176.858) -- 0:00:09
848500 -- (-1177.069) [-1179.274] (-1176.037) (-1176.018) * [-1177.180] (-1178.062) (-1178.844) (-1176.938) -- 0:00:09
849000 -- [-1178.505] (-1177.542) (-1176.472) (-1179.407) * [-1180.378] (-1176.519) (-1176.620) (-1178.308) -- 0:00:09
849500 -- (-1176.395) [-1178.308] (-1179.765) (-1176.142) * (-1177.043) (-1176.647) (-1179.619) [-1176.561] -- 0:00:09
850000 -- (-1181.526) (-1176.656) [-1178.000] (-1178.857) * (-1178.417) [-1178.016] (-1179.631) (-1176.542) -- 0:00:09
Average standard deviation of split frequencies: 0.010040
850500 -- (-1179.334) (-1179.971) (-1177.811) [-1176.927] * (-1176.292) (-1176.382) [-1176.911] (-1177.216) -- 0:00:09
851000 -- (-1177.387) (-1179.041) (-1178.106) [-1176.393] * (-1180.316) (-1176.890) (-1176.949) [-1176.052] -- 0:00:09
851500 -- (-1177.302) (-1178.366) (-1176.670) [-1175.797] * (-1177.372) (-1176.944) [-1176.821] (-1176.545) -- 0:00:09
852000 -- (-1177.650) (-1181.014) [-1176.062] (-1175.880) * (-1178.464) (-1176.915) (-1177.806) [-1179.798] -- 0:00:09
852500 -- (-1180.457) (-1176.905) (-1176.540) [-1181.468] * (-1180.722) (-1184.812) [-1177.177] (-1175.652) -- 0:00:09
853000 -- (-1179.564) (-1179.005) (-1176.922) [-1175.565] * (-1179.324) (-1178.851) [-1177.554] (-1181.284) -- 0:00:09
853500 -- (-1175.088) (-1176.936) (-1178.514) [-1178.771] * (-1177.331) (-1176.567) [-1176.575] (-1184.793) -- 0:00:09
854000 -- [-1177.342] (-1175.915) (-1175.920) (-1180.157) * (-1176.772) (-1176.348) (-1176.643) [-1177.023] -- 0:00:09
854500 -- (-1178.850) (-1178.155) [-1177.055] (-1177.681) * (-1176.149) (-1179.950) [-1177.296] (-1177.560) -- 0:00:09
855000 -- [-1177.508] (-1180.488) (-1180.510) (-1184.508) * (-1177.471) (-1175.456) [-1177.403] (-1177.656) -- 0:00:08
Average standard deviation of split frequencies: 0.009880
855500 -- (-1177.081) [-1175.966] (-1177.831) (-1186.451) * [-1177.997] (-1175.845) (-1178.792) (-1176.949) -- 0:00:08
856000 -- (-1178.551) (-1178.263) [-1176.273] (-1179.278) * [-1178.915] (-1178.319) (-1181.398) (-1178.463) -- 0:00:08
856500 -- [-1178.908] (-1177.583) (-1180.620) (-1175.793) * (-1179.172) (-1176.709) [-1177.640] (-1180.616) -- 0:00:08
857000 -- [-1175.985] (-1176.276) (-1177.271) (-1179.133) * (-1179.069) (-1177.615) (-1179.556) [-1177.154] -- 0:00:08
857500 -- (-1175.567) [-1176.718] (-1176.099) (-1181.677) * (-1178.144) (-1176.441) (-1180.243) [-1177.966] -- 0:00:08
858000 -- (-1175.779) (-1181.137) (-1177.044) [-1182.563] * (-1180.272) [-1175.916] (-1177.828) (-1178.572) -- 0:00:08
858500 -- [-1178.379] (-1178.725) (-1176.025) (-1185.648) * [-1175.940] (-1176.343) (-1176.886) (-1178.604) -- 0:00:08
859000 -- (-1175.997) [-1182.960] (-1178.299) (-1180.131) * (-1177.400) [-1177.163] (-1179.727) (-1176.157) -- 0:00:08
859500 -- [-1176.726] (-1179.194) (-1177.882) (-1179.849) * (-1177.893) (-1178.536) [-1176.607] (-1175.541) -- 0:00:08
860000 -- (-1177.941) (-1176.808) (-1177.956) [-1176.821] * (-1182.958) [-1177.428] (-1175.934) (-1176.881) -- 0:00:08
Average standard deviation of split frequencies: 0.009698
860500 -- (-1181.763) (-1175.315) [-1177.971] (-1178.219) * [-1181.103] (-1178.581) (-1177.966) (-1175.089) -- 0:00:08
861000 -- [-1176.955] (-1175.555) (-1177.554) (-1180.722) * [-1179.332] (-1177.265) (-1177.987) (-1178.286) -- 0:00:08
861500 -- [-1178.020] (-1176.083) (-1180.901) (-1179.524) * [-1180.181] (-1175.821) (-1177.214) (-1178.092) -- 0:00:08
862000 -- (-1175.591) [-1176.063] (-1175.388) (-1180.817) * (-1183.098) [-1175.262] (-1178.520) (-1175.385) -- 0:00:08
862500 -- (-1176.871) [-1176.067] (-1178.396) (-1176.883) * (-1176.012) (-1179.583) [-1182.044] (-1175.422) -- 0:00:08
863000 -- (-1175.687) [-1175.601] (-1179.296) (-1182.182) * (-1176.970) (-1176.604) [-1176.828] (-1176.414) -- 0:00:08
863500 -- [-1176.005] (-1175.377) (-1179.781) (-1182.577) * [-1175.554] (-1177.424) (-1176.970) (-1176.807) -- 0:00:08
864000 -- (-1180.830) (-1175.716) (-1181.619) [-1179.570] * (-1175.554) (-1176.229) [-1182.100] (-1176.307) -- 0:00:08
864500 -- (-1179.016) (-1176.529) [-1179.166] (-1181.199) * [-1177.887] (-1177.030) (-1179.619) (-1176.081) -- 0:00:08
865000 -- (-1180.127) (-1176.725) [-1178.139] (-1180.328) * (-1180.019) (-1182.022) [-1175.420] (-1180.247) -- 0:00:08
Average standard deviation of split frequencies: 0.009190
865500 -- [-1175.343] (-1184.229) (-1180.456) (-1185.893) * (-1178.948) (-1176.249) (-1179.375) [-1177.489] -- 0:00:08
866000 -- (-1180.838) [-1177.234] (-1177.127) (-1176.440) * [-1176.926] (-1177.026) (-1177.383) (-1180.720) -- 0:00:08
866500 -- [-1175.684] (-1177.579) (-1177.651) (-1178.146) * [-1176.545] (-1180.539) (-1180.400) (-1176.518) -- 0:00:08
867000 -- (-1176.650) (-1176.563) (-1176.184) [-1178.954] * (-1176.190) (-1176.191) [-1180.882] (-1176.328) -- 0:00:08
867500 -- (-1179.964) (-1176.893) (-1176.923) [-1176.591] * (-1177.771) (-1177.162) [-1184.438] (-1178.241) -- 0:00:08
868000 -- (-1175.602) (-1177.028) (-1176.453) [-1175.934] * (-1178.028) (-1178.311) [-1183.144] (-1179.736) -- 0:00:08
868500 -- (-1178.314) (-1177.218) [-1180.333] (-1176.459) * (-1178.721) (-1182.530) [-1178.146] (-1179.912) -- 0:00:08
869000 -- (-1175.897) [-1176.311] (-1181.470) (-1177.236) * [-1176.494] (-1178.103) (-1177.276) (-1177.581) -- 0:00:08
869500 -- [-1175.462] (-1177.006) (-1177.009) (-1176.409) * (-1177.343) (-1177.732) (-1176.563) [-1178.822] -- 0:00:08
870000 -- [-1178.025] (-1176.876) (-1175.918) (-1176.613) * (-1179.512) [-1176.505] (-1175.718) (-1178.481) -- 0:00:08
Average standard deviation of split frequencies: 0.009555
870500 -- (-1175.698) (-1179.418) [-1176.356] (-1176.113) * (-1181.493) (-1176.603) [-1176.153] (-1179.200) -- 0:00:08
871000 -- (-1177.385) (-1179.787) (-1177.022) [-1176.416] * (-1179.793) (-1178.424) [-1175.594] (-1178.158) -- 0:00:07
871500 -- (-1178.162) (-1179.860) (-1178.596) [-1180.565] * (-1175.882) (-1176.126) (-1176.089) [-1176.046] -- 0:00:07
872000 -- [-1177.585] (-1177.456) (-1177.296) (-1178.676) * (-1176.270) [-1177.072] (-1177.716) (-1176.325) -- 0:00:07
872500 -- (-1177.259) [-1176.254] (-1176.641) (-1180.261) * (-1176.951) [-1176.731] (-1178.658) (-1175.640) -- 0:00:07
873000 -- (-1175.906) (-1176.712) (-1176.265) [-1179.792] * (-1177.599) [-1180.443] (-1176.620) (-1175.640) -- 0:00:07
873500 -- (-1177.092) (-1177.087) (-1178.441) [-1178.954] * (-1178.007) [-1175.426] (-1178.386) (-1183.980) -- 0:00:07
874000 -- [-1178.444] (-1178.723) (-1178.635) (-1177.113) * [-1178.729] (-1178.840) (-1177.838) (-1182.502) -- 0:00:07
874500 -- (-1177.587) (-1176.978) [-1177.826] (-1178.307) * (-1176.318) (-1181.773) (-1176.539) [-1180.928] -- 0:00:07
875000 -- (-1177.464) (-1175.850) [-1175.416] (-1179.071) * (-1175.838) (-1180.000) (-1175.936) [-1175.880] -- 0:00:07
Average standard deviation of split frequencies: 0.009496
875500 -- [-1180.817] (-1175.847) (-1176.288) (-1182.683) * [-1177.247] (-1181.126) (-1177.856) (-1178.340) -- 0:00:07
876000 -- (-1175.620) (-1175.925) [-1175.748] (-1180.723) * (-1179.377) (-1178.035) (-1179.031) [-1178.410] -- 0:00:07
876500 -- (-1177.765) (-1176.458) [-1177.061] (-1178.077) * [-1178.084] (-1177.008) (-1180.737) (-1179.026) -- 0:00:07
877000 -- (-1177.632) [-1176.291] (-1175.869) (-1176.499) * (-1182.966) (-1177.120) (-1182.220) [-1177.786] -- 0:00:07
877500 -- [-1177.669] (-1176.622) (-1179.764) (-1176.550) * (-1183.570) [-1176.442] (-1181.288) (-1176.922) -- 0:00:07
878000 -- (-1177.575) [-1176.856] (-1176.445) (-1176.567) * (-1177.638) (-1175.364) (-1177.133) [-1175.506] -- 0:00:07
878500 -- [-1176.520] (-1177.091) (-1175.625) (-1180.026) * (-1180.020) (-1176.305) (-1177.147) [-1177.277] -- 0:00:07
879000 -- (-1176.161) (-1177.188) [-1176.541] (-1177.490) * (-1179.496) (-1177.380) (-1182.490) [-1178.941] -- 0:00:07
879500 -- (-1176.632) (-1182.635) [-1175.902] (-1176.049) * (-1181.365) [-1176.891] (-1181.269) (-1176.965) -- 0:00:07
880000 -- (-1177.318) (-1176.500) (-1176.098) [-1176.446] * (-1177.474) (-1177.791) (-1178.688) [-1177.211] -- 0:00:07
Average standard deviation of split frequencies: 0.009415
880500 -- [-1180.685] (-1176.908) (-1177.611) (-1176.868) * (-1181.172) (-1178.061) (-1176.999) [-1178.179] -- 0:00:07
881000 -- [-1176.730] (-1178.566) (-1176.893) (-1176.845) * (-1181.047) (-1176.086) (-1175.759) [-1175.711] -- 0:00:07
881500 -- (-1178.159) (-1178.942) [-1176.113] (-1176.717) * (-1183.553) [-1176.529] (-1181.222) (-1176.386) -- 0:00:07
882000 -- (-1177.786) (-1177.202) [-1178.159] (-1180.916) * [-1183.411] (-1176.170) (-1177.381) (-1176.033) -- 0:00:07
882500 -- (-1176.256) [-1177.210] (-1181.324) (-1180.093) * [-1177.988] (-1182.597) (-1178.707) (-1175.942) -- 0:00:07
883000 -- (-1175.993) (-1179.216) [-1176.340] (-1175.612) * (-1175.982) [-1181.379] (-1177.485) (-1180.028) -- 0:00:07
883500 -- [-1176.071] (-1179.534) (-1176.569) (-1178.559) * [-1181.851] (-1182.975) (-1180.502) (-1178.144) -- 0:00:07
884000 -- (-1182.173) (-1181.724) (-1176.007) [-1176.966] * (-1179.865) (-1177.925) [-1176.075] (-1181.473) -- 0:00:07
884500 -- (-1177.191) (-1176.354) [-1175.730] (-1183.435) * (-1177.269) (-1176.097) (-1178.690) [-1181.131] -- 0:00:07
885000 -- (-1175.653) (-1177.250) [-1175.717] (-1178.894) * (-1177.216) (-1177.051) [-1175.951] (-1184.874) -- 0:00:07
Average standard deviation of split frequencies: 0.009163
885500 -- (-1175.584) (-1178.658) [-1177.817] (-1176.783) * [-1177.679] (-1175.674) (-1177.300) (-1176.013) -- 0:00:07
886000 -- (-1176.065) (-1176.560) [-1176.350] (-1176.426) * (-1177.217) (-1179.461) (-1175.365) [-1175.903] -- 0:00:07
886500 -- (-1178.246) [-1176.444] (-1175.764) (-1179.764) * (-1178.357) [-1176.066] (-1175.569) (-1176.659) -- 0:00:07
887000 -- (-1179.299) (-1177.168) (-1175.978) [-1176.881] * [-1175.948] (-1176.409) (-1176.602) (-1179.341) -- 0:00:07
887500 -- (-1176.738) [-1176.064] (-1175.787) (-1176.959) * (-1176.102) (-1176.607) [-1177.223] (-1178.966) -- 0:00:06
888000 -- (-1177.717) (-1179.058) (-1176.550) [-1178.069] * [-1176.880] (-1179.857) (-1176.391) (-1175.275) -- 0:00:06
888500 -- (-1187.216) (-1181.806) [-1177.619] (-1177.397) * (-1177.528) (-1176.362) [-1178.691] (-1175.369) -- 0:00:06
889000 -- (-1181.504) [-1178.942] (-1176.566) (-1176.616) * (-1179.821) [-1179.221] (-1177.734) (-1176.007) -- 0:00:06
889500 -- (-1183.032) (-1178.187) [-1177.986] (-1177.872) * [-1178.016] (-1176.513) (-1177.654) (-1176.841) -- 0:00:06
890000 -- (-1180.939) (-1180.212) (-1178.700) [-1177.991] * (-1178.358) (-1176.353) (-1176.251) [-1177.945] -- 0:00:06
Average standard deviation of split frequencies: 0.009674
890500 -- (-1178.391) (-1179.711) [-1180.147] (-1177.241) * (-1179.674) (-1180.707) (-1177.174) [-1175.810] -- 0:00:06
891000 -- (-1178.488) (-1179.610) [-1176.687] (-1177.359) * (-1178.969) (-1178.150) [-1177.354] (-1177.555) -- 0:00:06
891500 -- (-1178.668) (-1180.359) (-1175.592) [-1178.849] * [-1176.705] (-1176.536) (-1178.772) (-1176.783) -- 0:00:06
892000 -- (-1181.765) (-1176.111) (-1175.973) [-1176.522] * [-1178.382] (-1176.953) (-1183.908) (-1176.889) -- 0:00:06
892500 -- (-1175.314) (-1175.819) (-1175.524) [-1177.266] * (-1180.430) (-1177.262) (-1182.563) [-1178.241] -- 0:00:06
893000 -- (-1177.387) [-1176.138] (-1178.507) (-1176.022) * (-1184.053) (-1177.292) [-1177.153] (-1181.310) -- 0:00:06
893500 -- [-1179.755] (-1177.228) (-1178.339) (-1176.630) * [-1176.403] (-1178.398) (-1176.200) (-1177.274) -- 0:00:06
894000 -- (-1180.503) (-1179.244) (-1177.157) [-1177.092] * (-1177.013) (-1179.053) [-1175.965] (-1181.319) -- 0:00:06
894500 -- (-1179.022) [-1179.921] (-1179.454) (-1176.741) * (-1178.977) [-1177.862] (-1175.965) (-1178.649) -- 0:00:06
895000 -- (-1178.260) (-1176.491) [-1175.750] (-1177.637) * (-1177.555) [-1180.484] (-1177.463) (-1176.516) -- 0:00:06
Average standard deviation of split frequencies: 0.009792
895500 -- (-1178.704) [-1177.690] (-1179.012) (-1175.801) * (-1180.396) (-1176.039) [-1178.754] (-1180.888) -- 0:00:06
896000 -- (-1184.557) (-1182.745) (-1183.109) [-1176.737] * (-1184.162) (-1176.756) [-1176.726] (-1176.947) -- 0:00:06
896500 -- [-1184.865] (-1178.522) (-1184.197) (-1176.275) * (-1185.006) [-1178.659] (-1176.173) (-1176.364) -- 0:00:06
897000 -- (-1177.606) [-1177.182] (-1180.932) (-1178.561) * (-1180.931) (-1180.359) [-1176.416] (-1183.385) -- 0:00:06
897500 -- (-1177.119) [-1176.299] (-1176.769) (-1180.198) * (-1177.139) (-1176.148) (-1177.132) [-1178.232] -- 0:00:06
898000 -- (-1178.127) (-1175.807) (-1176.042) [-1177.715] * (-1176.811) [-1177.868] (-1177.999) (-1178.699) -- 0:00:06
898500 -- (-1181.461) (-1179.245) (-1178.194) [-1176.218] * [-1178.695] (-1178.685) (-1176.254) (-1178.869) -- 0:00:06
899000 -- (-1185.273) [-1176.127] (-1176.731) (-1178.545) * (-1178.037) (-1179.860) [-1175.532] (-1177.506) -- 0:00:06
899500 -- (-1181.499) [-1176.570] (-1178.473) (-1178.724) * (-1176.487) (-1176.550) (-1175.937) [-1176.426] -- 0:00:06
900000 -- (-1179.397) (-1176.916) [-1177.657] (-1176.472) * (-1176.772) [-1176.785] (-1176.877) (-1178.621) -- 0:00:06
Average standard deviation of split frequencies: 0.010283
900500 -- (-1175.503) [-1176.429] (-1177.068) (-1176.761) * (-1178.524) [-1175.872] (-1176.688) (-1179.132) -- 0:00:06
901000 -- (-1177.562) (-1179.115) (-1177.642) [-1176.607] * [-1178.588] (-1178.076) (-1183.266) (-1177.880) -- 0:00:06
901500 -- (-1178.019) [-1175.802] (-1176.483) (-1177.120) * [-1175.585] (-1180.831) (-1178.085) (-1177.330) -- 0:00:06
902000 -- (-1177.332) (-1177.535) [-1179.954] (-1176.274) * (-1176.631) (-1180.326) (-1177.654) [-1176.820] -- 0:00:06
902500 -- (-1176.828) [-1176.625] (-1177.572) (-1176.978) * (-1176.999) [-1180.024] (-1177.096) (-1177.217) -- 0:00:06
903000 -- [-1176.963] (-1177.120) (-1176.830) (-1178.730) * (-1180.691) (-1176.406) (-1177.600) [-1180.224] -- 0:00:06
903500 -- (-1175.735) (-1178.277) [-1177.092] (-1176.001) * (-1184.661) (-1177.114) (-1177.333) [-1179.129] -- 0:00:05
904000 -- [-1176.714] (-1177.995) (-1180.192) (-1176.290) * (-1184.487) (-1176.788) (-1176.464) [-1178.523] -- 0:00:05
904500 -- [-1179.532] (-1179.257) (-1175.844) (-1179.039) * (-1180.531) (-1176.089) [-1177.856] (-1176.346) -- 0:00:05
905000 -- (-1177.702) (-1176.197) (-1180.183) [-1178.341] * (-1178.115) (-1175.326) (-1177.724) [-1178.988] -- 0:00:05
Average standard deviation of split frequencies: 0.010345
905500 -- (-1179.095) (-1176.529) [-1175.370] (-1176.981) * (-1178.689) (-1175.885) [-1178.411] (-1186.016) -- 0:00:05
906000 -- (-1175.389) [-1176.947] (-1176.126) (-1175.798) * (-1178.579) (-1177.193) [-1179.226] (-1179.836) -- 0:00:05
906500 -- (-1177.016) [-1177.018] (-1175.879) (-1175.919) * (-1178.824) (-1175.943) (-1179.044) [-1178.477] -- 0:00:05
907000 -- (-1177.185) [-1176.478] (-1181.277) (-1176.963) * (-1180.075) [-1176.579] (-1178.896) (-1180.457) -- 0:00:05
907500 -- (-1177.406) (-1175.468) [-1176.120] (-1176.925) * [-1177.851] (-1177.935) (-1179.334) (-1183.596) -- 0:00:05
908000 -- (-1175.439) (-1175.274) (-1180.812) [-1175.886] * (-1177.927) [-1176.071] (-1179.139) (-1180.314) -- 0:00:05
908500 -- (-1177.785) [-1176.861] (-1176.394) (-1175.730) * [-1175.364] (-1175.780) (-1178.182) (-1175.485) -- 0:00:05
909000 -- (-1180.203) (-1176.656) [-1176.256] (-1175.481) * (-1179.020) [-1176.986] (-1177.020) (-1176.089) -- 0:00:05
909500 -- (-1178.282) (-1177.161) (-1175.879) [-1177.017] * (-1176.010) [-1176.706] (-1177.226) (-1178.537) -- 0:00:05
910000 -- (-1177.622) (-1182.552) [-1177.883] (-1176.321) * (-1176.589) (-1180.532) [-1177.808] (-1178.904) -- 0:00:05
Average standard deviation of split frequencies: 0.010231
910500 -- (-1176.916) [-1176.125] (-1175.242) (-1179.427) * [-1176.680] (-1180.755) (-1177.939) (-1181.220) -- 0:00:05
911000 -- [-1175.622] (-1180.774) (-1176.314) (-1179.456) * (-1180.756) (-1178.421) [-1176.365] (-1177.506) -- 0:00:05
911500 -- (-1181.714) (-1176.388) (-1180.909) [-1178.081] * (-1176.862) (-1177.511) [-1178.629] (-1176.480) -- 0:00:05
912000 -- (-1178.670) (-1177.553) (-1181.820) [-1178.170] * (-1177.584) (-1177.991) (-1177.684) [-1178.327] -- 0:00:05
912500 -- (-1176.669) [-1175.909] (-1178.901) (-1177.732) * [-1179.765] (-1181.961) (-1179.080) (-1177.991) -- 0:00:05
913000 -- [-1176.755] (-1180.463) (-1177.747) (-1177.987) * [-1176.584] (-1177.332) (-1178.883) (-1178.486) -- 0:00:05
913500 -- (-1176.899) [-1176.867] (-1176.346) (-1177.193) * (-1176.172) (-1177.462) [-1177.194] (-1176.382) -- 0:00:05
914000 -- (-1176.421) (-1177.543) [-1177.380] (-1177.761) * (-1178.366) (-1181.433) (-1177.923) [-1175.546] -- 0:00:05
914500 -- (-1175.765) (-1177.038) [-1180.315] (-1175.730) * (-1182.064) (-1177.112) [-1177.967] (-1175.804) -- 0:00:05
915000 -- [-1177.223] (-1177.091) (-1178.207) (-1176.558) * (-1177.753) (-1175.881) [-1179.589] (-1177.343) -- 0:00:05
Average standard deviation of split frequencies: 0.010383
915500 -- (-1179.771) (-1176.096) [-1178.125] (-1178.815) * [-1175.936] (-1176.680) (-1177.278) (-1181.197) -- 0:00:05
916000 -- [-1177.454] (-1177.587) (-1179.664) (-1175.827) * (-1178.722) [-1178.692] (-1177.342) (-1177.736) -- 0:00:05
916500 -- (-1180.154) (-1178.659) [-1176.771] (-1176.345) * (-1179.540) (-1177.556) [-1177.075] (-1176.746) -- 0:00:05
917000 -- (-1175.386) [-1181.707] (-1178.041) (-1176.634) * (-1178.881) (-1180.089) (-1177.471) [-1175.938] -- 0:00:05
917500 -- [-1176.094] (-1180.417) (-1179.226) (-1175.685) * [-1177.911] (-1178.528) (-1177.718) (-1186.605) -- 0:00:05
918000 -- [-1178.804] (-1181.270) (-1177.469) (-1176.168) * (-1177.621) [-1178.185] (-1178.643) (-1182.909) -- 0:00:05
918500 -- [-1176.558] (-1180.073) (-1178.099) (-1176.091) * (-1176.982) (-1177.100) (-1178.778) [-1178.681] -- 0:00:05
919000 -- [-1178.543] (-1176.511) (-1175.562) (-1175.971) * [-1179.262] (-1176.374) (-1176.807) (-1182.143) -- 0:00:05
919500 -- (-1181.103) (-1175.970) (-1177.552) [-1175.618] * (-1176.604) (-1177.335) [-1176.060] (-1176.541) -- 0:00:04
920000 -- [-1184.956] (-1176.935) (-1180.145) (-1175.655) * (-1179.098) [-1177.731] (-1176.096) (-1178.408) -- 0:00:04
Average standard deviation of split frequencies: 0.010391
920500 -- (-1181.668) [-1182.482] (-1177.665) (-1175.669) * (-1176.858) [-1179.006] (-1175.702) (-1179.046) -- 0:00:04
921000 -- (-1175.844) (-1181.022) (-1184.305) [-1176.170] * (-1180.313) [-1176.408] (-1177.490) (-1176.729) -- 0:00:04
921500 -- [-1176.832] (-1177.316) (-1180.719) (-1176.205) * [-1177.050] (-1176.476) (-1178.301) (-1178.149) -- 0:00:04
922000 -- (-1177.774) (-1178.108) [-1175.421] (-1176.064) * (-1177.640) (-1178.643) [-1179.930] (-1180.628) -- 0:00:04
922500 -- (-1175.991) (-1176.475) [-1176.588] (-1176.889) * (-1178.031) (-1178.726) (-1177.481) [-1177.288] -- 0:00:04
923000 -- (-1178.441) (-1175.966) [-1176.503] (-1177.244) * (-1177.675) (-1178.425) (-1176.482) [-1178.343] -- 0:00:04
923500 -- [-1176.502] (-1176.307) (-1175.881) (-1177.099) * (-1176.855) (-1176.202) [-1175.371] (-1177.580) -- 0:00:04
924000 -- (-1177.745) [-1177.135] (-1178.019) (-1177.983) * (-1177.578) [-1177.570] (-1175.332) (-1178.532) -- 0:00:04
924500 -- (-1178.702) (-1178.666) (-1181.281) [-1178.129] * (-1177.221) (-1175.917) [-1177.567] (-1177.791) -- 0:00:04
925000 -- [-1177.676] (-1178.161) (-1177.263) (-1178.348) * (-1180.499) [-1177.703] (-1176.938) (-1176.728) -- 0:00:04
Average standard deviation of split frequencies: 0.010391
925500 -- [-1177.150] (-1175.749) (-1176.057) (-1176.464) * (-1176.059) (-1175.481) (-1176.619) [-1178.850] -- 0:00:04
926000 -- (-1180.381) (-1177.789) [-1176.481] (-1176.891) * (-1177.409) [-1180.131] (-1176.814) (-1178.715) -- 0:00:04
926500 -- (-1177.760) (-1180.469) [-1176.411] (-1176.883) * (-1176.801) (-1177.342) [-1177.327] (-1176.717) -- 0:00:04
927000 -- [-1178.807] (-1182.929) (-1175.944) (-1178.383) * (-1177.423) (-1175.602) [-1178.335] (-1175.801) -- 0:00:04
927500 -- (-1177.830) (-1175.826) (-1178.852) [-1176.700] * (-1176.521) (-1176.837) [-1178.031] (-1175.568) -- 0:00:04
928000 -- (-1178.277) [-1177.690] (-1180.169) (-1176.430) * (-1176.039) [-1176.112] (-1178.918) (-1175.551) -- 0:00:04
928500 -- (-1180.473) [-1179.231] (-1176.233) (-1180.452) * (-1176.039) [-1176.968] (-1176.457) (-1180.892) -- 0:00:04
929000 -- (-1177.995) [-1175.936] (-1176.549) (-1176.611) * (-1176.529) (-1177.169) [-1180.100] (-1178.583) -- 0:00:04
929500 -- (-1180.267) [-1176.513] (-1180.234) (-1176.159) * [-1176.090] (-1177.045) (-1176.841) (-1178.201) -- 0:00:04
930000 -- (-1177.142) [-1176.824] (-1178.729) (-1178.372) * (-1176.517) [-1176.869] (-1178.136) (-1178.689) -- 0:00:04
Average standard deviation of split frequencies: 0.010756
930500 -- [-1175.349] (-1177.246) (-1180.438) (-1176.958) * [-1179.231] (-1181.281) (-1177.256) (-1178.926) -- 0:00:04
931000 -- (-1176.033) [-1177.270] (-1179.529) (-1176.826) * (-1178.673) (-1179.012) [-1177.212] (-1178.279) -- 0:00:04
931500 -- (-1177.002) (-1177.940) [-1176.112] (-1177.314) * (-1177.871) [-1177.661] (-1180.273) (-1176.839) -- 0:00:04
932000 -- (-1176.885) (-1178.524) [-1176.685] (-1176.725) * (-1180.595) (-1179.064) (-1177.746) [-1176.084] -- 0:00:04
932500 -- (-1176.351) (-1178.654) [-1176.504] (-1176.756) * (-1180.332) (-1178.151) (-1176.793) [-1176.669] -- 0:00:04
933000 -- (-1179.805) (-1181.365) [-1181.042] (-1176.362) * (-1180.549) [-1176.400] (-1184.950) (-1176.241) -- 0:00:04
933500 -- (-1177.358) [-1179.595] (-1177.611) (-1177.024) * [-1179.888] (-1176.421) (-1182.715) (-1177.223) -- 0:00:04
934000 -- (-1179.053) (-1180.161) [-1178.632] (-1177.035) * (-1181.305) (-1176.390) [-1177.851] (-1177.828) -- 0:00:04
934500 -- [-1177.075] (-1177.786) (-1177.581) (-1176.866) * [-1175.678] (-1180.220) (-1180.086) (-1177.781) -- 0:00:04
935000 -- [-1177.608] (-1177.867) (-1178.187) (-1176.235) * (-1181.239) (-1176.858) [-1178.072] (-1182.262) -- 0:00:04
Average standard deviation of split frequencies: 0.010339
935500 -- [-1177.621] (-1180.329) (-1176.552) (-1177.485) * (-1176.597) (-1177.084) (-1177.278) [-1177.216] -- 0:00:03
936000 -- (-1178.942) (-1180.337) [-1179.140] (-1178.495) * (-1176.967) [-1175.922] (-1180.722) (-1176.567) -- 0:00:03
936500 -- (-1179.785) [-1180.288] (-1176.709) (-1177.005) * (-1176.944) (-1175.253) [-1179.817] (-1182.339) -- 0:00:03
937000 -- (-1179.064) (-1179.588) [-1175.563] (-1178.713) * (-1177.169) (-1177.639) [-1178.187] (-1176.305) -- 0:00:03
937500 -- (-1178.368) [-1177.987] (-1176.881) (-1178.774) * (-1175.561) (-1178.666) [-1177.699] (-1176.102) -- 0:00:03
938000 -- (-1180.586) (-1177.118) [-1180.079] (-1175.860) * (-1176.608) [-1177.711] (-1176.572) (-1175.905) -- 0:00:03
938500 -- (-1185.537) (-1176.010) [-1179.916] (-1175.787) * [-1176.070] (-1178.347) (-1175.640) (-1176.377) -- 0:00:03
939000 -- (-1178.778) [-1176.242] (-1180.393) (-1176.904) * (-1176.897) (-1178.250) (-1180.427) [-1179.027] -- 0:00:03
939500 -- [-1176.654] (-1176.109) (-1178.214) (-1178.389) * (-1178.195) (-1176.968) [-1176.455] (-1177.378) -- 0:00:03
940000 -- (-1176.006) [-1176.466] (-1177.401) (-1179.142) * (-1175.533) (-1177.439) [-1177.108] (-1175.911) -- 0:00:03
Average standard deviation of split frequencies: 0.010141
940500 -- (-1178.045) (-1180.475) [-1178.401] (-1180.002) * [-1177.638] (-1177.774) (-1176.737) (-1176.659) -- 0:00:03
941000 -- (-1177.392) (-1181.781) (-1177.215) [-1179.200] * (-1176.147) (-1175.799) (-1176.981) [-1179.895] -- 0:00:03
941500 -- (-1178.998) (-1178.464) (-1181.176) [-1178.300] * [-1178.469] (-1177.475) (-1178.411) (-1177.498) -- 0:00:03
942000 -- [-1179.784] (-1180.081) (-1175.619) (-1177.524) * [-1176.324] (-1178.151) (-1179.064) (-1183.330) -- 0:00:03
942500 -- (-1177.648) (-1177.345) [-1177.445] (-1176.714) * (-1176.348) [-1183.545] (-1177.780) (-1176.858) -- 0:00:03
943000 -- (-1179.302) (-1176.850) (-1176.388) [-1176.597] * (-1175.315) (-1181.501) [-1177.991] (-1178.419) -- 0:00:03
943500 -- (-1177.752) (-1181.055) (-1178.703) [-1177.824] * (-1176.138) [-1181.566] (-1177.952) (-1178.532) -- 0:00:03
944000 -- (-1176.459) [-1180.215] (-1179.688) (-1176.610) * (-1176.637) (-1178.471) (-1180.154) [-1177.295] -- 0:00:03
944500 -- (-1176.604) [-1177.331] (-1177.569) (-1177.325) * (-1175.867) [-1179.701] (-1175.906) (-1177.308) -- 0:00:03
945000 -- (-1176.967) (-1179.522) [-1178.891] (-1176.680) * [-1177.071] (-1177.351) (-1177.607) (-1176.710) -- 0:00:03
Average standard deviation of split frequencies: 0.009878
945500 -- (-1182.925) (-1180.394) [-1177.832] (-1175.851) * [-1177.484] (-1177.142) (-1175.993) (-1176.898) -- 0:00:03
946000 -- [-1179.603] (-1178.475) (-1176.855) (-1177.569) * (-1177.668) (-1177.746) [-1177.409] (-1177.207) -- 0:00:03
946500 -- (-1178.467) (-1176.420) (-1175.749) [-1177.773] * (-1179.280) (-1176.552) [-1176.544] (-1178.517) -- 0:00:03
947000 -- (-1175.845) (-1175.561) [-1176.679] (-1177.463) * (-1178.591) [-1178.094] (-1177.249) (-1177.913) -- 0:00:03
947500 -- [-1177.137] (-1177.301) (-1177.671) (-1175.554) * [-1178.902] (-1177.692) (-1176.922) (-1177.222) -- 0:00:03
948000 -- (-1178.777) (-1176.817) [-1177.509] (-1178.324) * (-1177.603) (-1178.208) (-1177.694) [-1176.654] -- 0:00:03
948500 -- (-1178.776) (-1180.494) (-1176.773) [-1178.469] * (-1178.530) (-1175.157) (-1178.662) [-1176.078] -- 0:00:03
949000 -- (-1183.534) (-1180.125) (-1175.461) [-1178.867] * [-1177.042] (-1176.673) (-1177.354) (-1179.136) -- 0:00:03
949500 -- [-1181.437] (-1179.602) (-1175.218) (-1178.161) * (-1177.069) [-1176.312] (-1177.188) (-1177.848) -- 0:00:03
950000 -- (-1177.917) (-1176.503) (-1177.521) [-1178.990] * (-1177.824) (-1178.129) [-1176.513] (-1177.096) -- 0:00:03
Average standard deviation of split frequencies: 0.009947
950500 -- (-1180.153) (-1175.735) (-1176.739) [-1178.591] * (-1178.097) (-1178.740) (-1176.698) [-1177.041] -- 0:00:03
951000 -- (-1178.885) (-1177.932) [-1180.060] (-1177.876) * (-1177.152) (-1178.485) [-1181.141] (-1176.445) -- 0:00:03
951500 -- [-1176.681] (-1177.238) (-1176.873) (-1177.082) * (-1179.012) (-1179.824) [-1178.078] (-1181.077) -- 0:00:03
952000 -- [-1176.481] (-1177.333) (-1177.951) (-1177.452) * (-1177.930) [-1176.385] (-1180.477) (-1177.895) -- 0:00:02
952500 -- (-1176.693) (-1178.494) (-1177.163) [-1179.541] * [-1178.386] (-1177.376) (-1180.204) (-1178.392) -- 0:00:02
953000 -- (-1176.340) (-1179.424) (-1176.185) [-1177.584] * (-1175.749) (-1177.156) [-1177.097] (-1181.408) -- 0:00:02
953500 -- (-1177.402) (-1178.014) [-1176.075] (-1178.634) * [-1175.590] (-1182.531) (-1176.983) (-1178.015) -- 0:00:02
954000 -- (-1177.870) [-1176.839] (-1176.499) (-1177.965) * (-1176.340) (-1180.794) [-1176.553] (-1179.837) -- 0:00:02
954500 -- (-1176.334) (-1177.641) (-1179.256) [-1176.043] * (-1176.161) [-1175.477] (-1182.069) (-1175.892) -- 0:00:02
955000 -- [-1176.456] (-1175.963) (-1176.474) (-1176.921) * (-1179.628) [-1176.054] (-1176.124) (-1180.241) -- 0:00:02
Average standard deviation of split frequencies: 0.009717
955500 -- (-1178.041) (-1177.980) (-1176.474) [-1183.775] * (-1177.358) (-1175.669) [-1176.757] (-1177.620) -- 0:00:02
956000 -- (-1179.672) (-1178.073) (-1177.683) [-1177.012] * (-1178.572) (-1178.235) [-1181.907] (-1177.001) -- 0:00:02
956500 -- (-1178.774) (-1177.987) (-1178.129) [-1177.200] * (-1175.370) (-1176.041) (-1177.429) [-1178.461] -- 0:00:02
957000 -- [-1176.713] (-1177.508) (-1176.571) (-1179.559) * (-1186.690) (-1176.530) (-1176.850) [-1175.374] -- 0:00:02
957500 -- (-1178.594) (-1176.344) (-1177.216) [-1179.583] * (-1178.985) (-1177.462) [-1177.431] (-1176.586) -- 0:00:02
958000 -- (-1178.993) [-1175.550] (-1179.844) (-1178.801) * (-1177.516) (-1176.737) [-1177.262] (-1176.184) -- 0:00:02
958500 -- (-1176.699) (-1175.642) [-1176.152] (-1177.903) * [-1175.949] (-1177.239) (-1176.886) (-1179.407) -- 0:00:02
959000 -- (-1176.921) [-1175.983] (-1175.691) (-1179.435) * (-1177.534) [-1178.298] (-1177.695) (-1176.055) -- 0:00:02
959500 -- (-1176.062) (-1178.901) (-1176.247) [-1176.995] * [-1177.245] (-1177.765) (-1178.067) (-1175.565) -- 0:00:02
960000 -- (-1176.253) (-1178.075) [-1176.560] (-1180.682) * (-1179.289) (-1176.814) [-1176.220] (-1176.324) -- 0:00:02
Average standard deviation of split frequencies: 0.009231
960500 -- (-1175.934) (-1178.052) (-1180.568) [-1178.376] * (-1178.980) [-1181.407] (-1176.146) (-1180.355) -- 0:00:02
961000 -- [-1176.836] (-1180.604) (-1182.227) (-1180.790) * (-1179.673) (-1178.225) (-1178.051) [-1178.510] -- 0:00:02
961500 -- (-1177.617) (-1178.076) [-1177.727] (-1178.381) * (-1177.822) (-1178.222) (-1177.963) [-1177.467] -- 0:00:02
962000 -- (-1177.602) [-1178.680] (-1176.883) (-1180.823) * (-1175.640) (-1176.931) [-1176.476] (-1177.334) -- 0:00:02
962500 -- (-1176.239) (-1178.306) (-1178.038) [-1180.458] * [-1178.178] (-1175.748) (-1178.683) (-1179.212) -- 0:00:02
963000 -- [-1176.506] (-1177.761) (-1177.871) (-1178.960) * (-1180.112) (-1177.703) (-1178.413) [-1177.099] -- 0:00:02
963500 -- (-1180.926) (-1179.616) [-1176.751] (-1178.320) * (-1176.066) (-1178.260) [-1175.616] (-1178.630) -- 0:00:02
964000 -- [-1178.733] (-1183.352) (-1177.177) (-1176.262) * (-1176.082) [-1177.297] (-1176.146) (-1175.992) -- 0:00:02
964500 -- (-1177.216) (-1180.072) (-1179.298) [-1176.255] * (-1179.143) [-1177.850] (-1178.158) (-1176.975) -- 0:00:02
965000 -- [-1177.031] (-1177.821) (-1176.035) (-1182.722) * (-1178.414) [-1176.220] (-1177.631) (-1176.626) -- 0:00:02
Average standard deviation of split frequencies: 0.009817
965500 -- [-1180.326] (-1176.810) (-1181.166) (-1176.442) * [-1177.458] (-1177.208) (-1176.927) (-1177.544) -- 0:00:02
966000 -- (-1181.731) [-1175.858] (-1175.874) (-1178.833) * [-1177.512] (-1177.210) (-1178.153) (-1178.025) -- 0:00:02
966500 -- (-1178.456) (-1176.989) [-1177.324] (-1177.838) * (-1178.186) [-1177.260] (-1177.019) (-1176.213) -- 0:00:02
967000 -- (-1178.722) [-1176.491] (-1179.293) (-1176.537) * [-1178.767] (-1175.858) (-1177.605) (-1175.890) -- 0:00:02
967500 -- (-1177.700) (-1179.149) [-1176.988] (-1176.344) * (-1179.134) (-1176.778) (-1177.012) [-1175.784] -- 0:00:02
968000 -- (-1179.793) (-1177.453) [-1176.459] (-1175.281) * [-1177.279] (-1177.185) (-1177.049) (-1176.031) -- 0:00:01
968500 -- [-1178.033] (-1177.099) (-1176.352) (-1176.188) * (-1178.068) (-1176.484) (-1183.284) [-1176.399] -- 0:00:01
969000 -- (-1177.064) [-1177.387] (-1178.875) (-1178.776) * (-1178.011) (-1183.389) [-1182.865] (-1175.832) -- 0:00:01
969500 -- [-1176.927] (-1176.782) (-1179.096) (-1176.386) * (-1178.710) (-1179.691) (-1177.612) [-1177.945] -- 0:00:01
970000 -- (-1177.022) (-1179.345) [-1178.218] (-1177.854) * (-1177.471) [-1178.222] (-1176.899) (-1176.762) -- 0:00:01
Average standard deviation of split frequencies: 0.009258
970500 -- (-1176.603) (-1178.506) (-1177.492) [-1176.708] * (-1177.995) [-1181.361] (-1175.481) (-1180.126) -- 0:00:01
971000 -- (-1176.590) (-1178.036) (-1179.667) [-1177.296] * (-1177.636) [-1177.935] (-1178.111) (-1178.640) -- 0:00:01
971500 -- (-1176.911) (-1179.901) [-1177.026] (-1177.131) * (-1175.918) (-1176.947) (-1178.887) [-1178.632] -- 0:00:01
972000 -- [-1177.064] (-1178.022) (-1179.049) (-1176.004) * (-1175.397) (-1177.552) [-1178.273] (-1185.736) -- 0:00:01
972500 -- (-1175.902) [-1177.899] (-1179.861) (-1180.102) * (-1177.081) [-1180.224] (-1179.013) (-1176.890) -- 0:00:01
973000 -- (-1176.289) (-1176.252) [-1178.144] (-1181.626) * (-1176.676) (-1179.465) [-1176.126] (-1176.022) -- 0:00:01
973500 -- (-1179.196) [-1177.820] (-1179.418) (-1180.504) * (-1178.418) (-1177.098) (-1176.916) [-1176.323] -- 0:00:01
974000 -- [-1177.808] (-1178.422) (-1180.052) (-1179.895) * [-1177.195] (-1180.348) (-1176.436) (-1176.398) -- 0:00:01
974500 -- (-1180.296) (-1180.674) (-1178.703) [-1176.627] * [-1178.152] (-1181.507) (-1178.802) (-1175.249) -- 0:00:01
975000 -- (-1178.207) (-1176.438) (-1178.600) [-1176.829] * (-1179.741) [-1177.678] (-1177.881) (-1177.758) -- 0:00:01
Average standard deviation of split frequencies: 0.008887
975500 -- [-1175.914] (-1177.169) (-1179.759) (-1178.296) * (-1179.099) (-1176.534) [-1176.270] (-1179.079) -- 0:00:01
976000 -- (-1176.526) [-1178.882] (-1179.542) (-1178.879) * (-1178.545) [-1177.496] (-1176.287) (-1177.422) -- 0:00:01
976500 -- (-1177.086) (-1179.708) (-1175.377) [-1175.695] * (-1178.860) (-1176.427) (-1175.203) [-1180.660] -- 0:00:01
977000 -- [-1176.114] (-1176.948) (-1180.678) (-1176.559) * (-1178.020) (-1176.383) (-1182.248) [-1176.084] -- 0:00:01
977500 -- (-1176.090) (-1176.691) [-1176.542] (-1176.391) * (-1177.332) (-1176.787) (-1180.982) [-1177.135] -- 0:00:01
978000 -- (-1176.000) (-1177.423) (-1179.586) [-1175.553] * (-1179.857) [-1177.195] (-1177.199) (-1177.196) -- 0:00:01
978500 -- (-1176.117) (-1178.677) [-1177.914] (-1176.156) * [-1177.925] (-1176.170) (-1180.464) (-1179.299) -- 0:00:01
979000 -- (-1177.401) [-1180.415] (-1177.691) (-1176.698) * (-1177.817) [-1176.950] (-1177.927) (-1181.377) -- 0:00:01
979500 -- (-1179.675) (-1178.376) [-1176.846] (-1179.371) * [-1176.515] (-1176.770) (-1179.780) (-1180.631) -- 0:00:01
980000 -- (-1175.723) [-1177.538] (-1176.765) (-1179.401) * [-1177.049] (-1179.236) (-1177.236) (-1177.636) -- 0:00:01
Average standard deviation of split frequencies: 0.009005
980500 -- (-1180.984) (-1177.884) (-1179.006) [-1178.124] * (-1177.284) (-1176.894) (-1181.980) [-1175.503] -- 0:00:01
981000 -- (-1179.068) [-1175.519] (-1177.343) (-1176.265) * [-1176.987] (-1178.267) (-1175.558) (-1176.929) -- 0:00:01
981500 -- (-1180.172) (-1176.366) (-1179.927) [-1184.663] * (-1176.230) (-1181.788) (-1177.800) [-1176.278] -- 0:00:01
982000 -- (-1176.365) (-1179.670) [-1177.915] (-1178.686) * [-1176.547] (-1178.231) (-1176.023) (-1179.948) -- 0:00:01
982500 -- (-1176.837) [-1176.343] (-1180.074) (-1176.450) * [-1178.198] (-1179.396) (-1176.058) (-1178.554) -- 0:00:01
983000 -- [-1178.242] (-1176.395) (-1177.637) (-1182.711) * (-1177.941) [-1176.304] (-1178.608) (-1176.873) -- 0:00:01
983500 -- (-1178.497) (-1177.922) [-1177.150] (-1179.550) * [-1177.543] (-1178.844) (-1177.558) (-1176.876) -- 0:00:01
984000 -- [-1177.763] (-1177.366) (-1176.636) (-1180.393) * (-1176.324) [-1178.432] (-1175.723) (-1177.797) -- 0:00:00
984500 -- [-1176.203] (-1177.659) (-1178.578) (-1176.055) * [-1176.124] (-1176.449) (-1176.653) (-1179.377) -- 0:00:00
985000 -- (-1177.022) (-1178.586) [-1175.691] (-1179.414) * (-1180.276) [-1176.928] (-1176.691) (-1179.530) -- 0:00:00
Average standard deviation of split frequencies: 0.009323
985500 -- [-1176.654] (-1178.068) (-1181.629) (-1180.448) * (-1180.565) (-1176.333) [-1178.497] (-1180.040) -- 0:00:00
986000 -- (-1178.208) (-1177.474) (-1176.759) [-1176.951] * (-1177.464) (-1183.602) (-1179.339) [-1181.898] -- 0:00:00
986500 -- (-1180.999) (-1175.537) [-1176.174] (-1176.432) * [-1177.579] (-1177.806) (-1176.449) (-1176.566) -- 0:00:00
987000 -- (-1181.062) [-1175.787] (-1178.482) (-1181.254) * [-1178.412] (-1177.750) (-1177.343) (-1180.722) -- 0:00:00
987500 -- [-1176.933] (-1178.329) (-1177.006) (-1178.154) * (-1175.734) (-1177.697) (-1177.890) [-1180.347] -- 0:00:00
988000 -- (-1177.305) (-1176.007) [-1177.329] (-1179.141) * (-1176.799) (-1175.805) [-1177.789] (-1176.260) -- 0:00:00
988500 -- [-1176.372] (-1176.790) (-1176.871) (-1177.798) * (-1180.731) [-1176.075] (-1178.309) (-1180.248) -- 0:00:00
989000 -- (-1176.730) [-1177.692] (-1176.507) (-1177.600) * (-1178.725) [-1177.465] (-1178.463) (-1178.851) -- 0:00:00
989500 -- (-1177.215) (-1178.761) [-1176.008] (-1176.194) * (-1180.001) (-1177.869) (-1180.107) [-1177.440] -- 0:00:00
990000 -- (-1178.447) [-1178.359] (-1176.372) (-1178.546) * (-1177.176) (-1178.772) [-1176.852] (-1175.754) -- 0:00:00
Average standard deviation of split frequencies: 0.008946
990500 -- [-1177.934] (-1178.760) (-1176.533) (-1176.937) * [-1177.291] (-1177.465) (-1179.088) (-1177.485) -- 0:00:00
991000 -- (-1176.144) (-1184.403) [-1176.231] (-1176.580) * (-1176.752) [-1175.756] (-1181.215) (-1179.272) -- 0:00:00
991500 -- (-1176.387) [-1178.534] (-1178.898) (-1178.075) * (-1176.373) [-1179.713] (-1179.266) (-1176.287) -- 0:00:00
992000 -- (-1180.142) (-1179.471) (-1180.011) [-1178.159] * (-1178.741) [-1178.668] (-1181.485) (-1178.694) -- 0:00:00
992500 -- (-1177.160) (-1177.165) (-1179.710) [-1176.847] * (-1177.809) (-1177.305) (-1177.049) [-1176.291] -- 0:00:00
993000 -- (-1180.316) (-1178.956) (-1176.832) [-1178.973] * (-1178.431) (-1179.225) (-1177.078) [-1177.484] -- 0:00:00
993500 -- (-1180.374) (-1179.453) [-1176.954] (-1180.322) * [-1175.565] (-1178.216) (-1180.071) (-1179.175) -- 0:00:00
994000 -- (-1183.103) (-1177.801) (-1177.284) [-1175.889] * [-1177.294] (-1177.949) (-1176.297) (-1177.915) -- 0:00:00
994500 -- (-1179.163) [-1178.499] (-1182.935) (-1175.424) * [-1176.661] (-1179.246) (-1177.087) (-1181.692) -- 0:00:00
995000 -- (-1177.810) (-1177.883) (-1180.005) [-1176.900] * [-1180.246] (-1179.657) (-1175.257) (-1176.523) -- 0:00:00
Average standard deviation of split frequencies: 0.008898
995500 -- (-1176.810) [-1178.423] (-1179.508) (-1177.569) * [-1179.704] (-1178.246) (-1180.048) (-1177.335) -- 0:00:00
996000 -- [-1177.825] (-1181.575) (-1176.750) (-1177.275) * (-1177.419) [-1176.941] (-1178.545) (-1176.852) -- 0:00:00
996500 -- (-1178.456) [-1177.534] (-1179.100) (-1177.346) * (-1177.473) (-1176.358) [-1175.922] (-1179.539) -- 0:00:00
997000 -- [-1177.623] (-1178.920) (-1177.128) (-1178.858) * (-1177.262) (-1179.235) [-1175.639] (-1176.917) -- 0:00:00
997500 -- [-1177.697] (-1176.195) (-1176.600) (-1180.109) * [-1177.976] (-1177.807) (-1179.632) (-1180.373) -- 0:00:00
998000 -- [-1176.524] (-1176.234) (-1176.856) (-1179.425) * (-1177.000) (-1176.487) (-1178.268) [-1175.535] -- 0:00:00
998500 -- (-1178.323) [-1178.292] (-1178.099) (-1175.755) * (-1176.691) (-1175.657) (-1181.571) [-1178.863] -- 0:00:00
999000 -- (-1177.920) (-1179.985) [-1177.767] (-1178.753) * [-1177.582] (-1175.375) (-1179.161) (-1181.452) -- 0:00:00
999500 -- [-1176.203] (-1175.658) (-1176.337) (-1179.916) * [-1176.342] (-1176.932) (-1176.368) (-1177.324) -- 0:00:00
1000000 -- (-1176.122) (-1179.519) [-1177.464] (-1186.714) * (-1177.201) (-1183.024) [-1178.568] (-1180.400) -- 0:00:00
Average standard deviation of split frequencies: 0.009076
Analysis completed in 1 mins 2 seconds
Analysis used 60.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1175.07
Likelihood of best state for "cold" chain of run 2 was -1175.07
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.7 % ( 33 %) Dirichlet(Pi{all})
28.2 % ( 24 %) Slider(Pi{all})
78.8 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 59 %) Multiplier(Alpha{3})
20.1 % ( 31 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 82 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.1 % ( 26 %) Dirichlet(Pi{all})
28.7 % ( 30 %) Slider(Pi{all})
78.2 % ( 50 %) Multiplier(Alpha{1,2})
77.7 % ( 57 %) Multiplier(Alpha{3})
19.2 % ( 30 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.6 % ( 35 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166509 0.82 0.67
3 | 166506 166860 0.84
4 | 166778 166650 166697
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167439 0.82 0.67
3 | 166718 165901 0.84
4 | 166913 166759 166270
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1176.88
| 2 1 |
| 1 2 1 1 |
| 1 22 2 |
| 2 2 12 2 21 1 2 1 |
| *1 1 2 1 1 2 |
|1 2 1 221 2 * * 121|
| 1 1 1 1 11 1 1 2 1 1 2 2|
| 12 2 1 1 21 2 2 2 2 2 2 1 |
|2 1 11 22 2 1 1 1 2 2 |
| 2 1 1 11 1 21 1 |
| 12 1 2 2 21 1 2 2 |
| 2 1 1 1 2 1 |
| 2 12 2 |
| 2 2 2 2 |
| 22 * 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1178.31
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1176.81 -1179.98
2 -1176.82 -1179.97
--------------------------------------
TOTAL -1176.82 -1179.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891519 0.092805 0.353195 1.488029 0.860495 1241.72 1371.36 1.000
r(A<->C){all} 0.176412 0.022104 0.000114 0.481135 0.139415 117.57 180.97 1.002
r(A<->G){all} 0.156905 0.017672 0.000021 0.430350 0.124312 182.37 198.81 1.000
r(A<->T){all} 0.176720 0.021027 0.000063 0.471102 0.140867 180.19 231.79 1.002
r(C<->G){all} 0.156066 0.018356 0.000016 0.424226 0.120581 126.89 154.59 1.002
r(C<->T){all} 0.164747 0.020119 0.000029 0.440243 0.125793 215.14 216.93 1.000
r(G<->T){all} 0.169151 0.019712 0.000008 0.451966 0.130942 142.03 192.20 1.004
pi(A){all} 0.201388 0.000181 0.175422 0.226682 0.201236 1460.87 1480.93 1.001
pi(C){all} 0.292427 0.000235 0.262781 0.322395 0.292137 1173.34 1215.61 1.001
pi(G){all} 0.309300 0.000244 0.280089 0.340221 0.309425 1342.41 1357.44 1.000
pi(T){all} 0.196885 0.000185 0.168104 0.221159 0.196639 1371.13 1387.81 1.000
alpha{1,2} 0.419062 0.227563 0.000120 1.389504 0.251890 934.08 1113.28 1.000
alpha{3} 0.451626 0.236409 0.000714 1.478272 0.288972 1330.13 1356.98 1.001
pinvar{all} 0.998141 0.000005 0.994066 1.000000 0.998816 1207.86 1251.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..****
9 -- .**.**
10 -- .*..*.
11 -- .**...
12 -- ..*..*
13 -- .*...*
14 -- ...**.
15 -- .***.*
16 -- ....**
17 -- .****.
18 -- ..*.*.
19 -- .*.***
20 -- .*.*..
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.000471 0.149900 0.150566 2
8 450 0.149900 0.008480 0.143904 0.155896 2
9 447 0.148901 0.012719 0.139907 0.157895 2
10 444 0.147901 0.025439 0.129913 0.165889 2
11 441 0.146902 0.004240 0.143904 0.149900 2
12 437 0.145570 0.016488 0.133911 0.157229 2
13 432 0.143904 0.005653 0.139907 0.147901 2
14 432 0.143904 0.002827 0.141905 0.145903 2
15 429 0.142905 0.015546 0.131912 0.153897 2
16 426 0.141905 0.008480 0.135909 0.147901 2
17 424 0.141239 0.001884 0.139907 0.142572 2
18 410 0.136576 0.001884 0.135243 0.137908 2
19 410 0.136576 0.016017 0.125250 0.147901 2
20 409 0.136243 0.004240 0.133245 0.139241 2
21 401 0.133578 0.011777 0.125250 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099013 0.009872 0.000011 0.295769 0.066492 1.000 2
length{all}[2] 0.100596 0.010468 0.000041 0.298146 0.068528 1.001 2
length{all}[3] 0.096987 0.009648 0.000001 0.292467 0.065847 1.000 2
length{all}[4] 0.101525 0.010873 0.000065 0.312239 0.069867 1.000 2
length{all}[5] 0.097937 0.009505 0.000059 0.293158 0.067531 1.000 2
length{all}[6] 0.100716 0.010066 0.000040 0.304725 0.068622 1.000 2
length{all}[7] 0.094609 0.008660 0.000293 0.279614 0.065043 0.998 2
length{all}[8] 0.101395 0.010541 0.000073 0.318833 0.069605 0.998 2
length{all}[9] 0.102857 0.010687 0.000067 0.296936 0.070087 1.000 2
length{all}[10] 0.097102 0.010388 0.000294 0.327820 0.064051 0.999 2
length{all}[11] 0.100091 0.009610 0.000081 0.278265 0.071038 1.002 2
length{all}[12] 0.094807 0.009234 0.000022 0.283274 0.065432 1.000 2
length{all}[13] 0.093372 0.008419 0.000148 0.265270 0.063339 1.000 2
length{all}[14] 0.097251 0.009004 0.000029 0.275567 0.062848 1.001 2
length{all}[15] 0.100142 0.010969 0.000020 0.339891 0.069765 1.020 2
length{all}[16] 0.094178 0.007809 0.001127 0.269534 0.067538 0.998 2
length{all}[17] 0.099721 0.008556 0.000086 0.282333 0.065687 1.003 2
length{all}[18] 0.096840 0.009610 0.000117 0.296790 0.070876 1.001 2
length{all}[19] 0.088635 0.007249 0.000312 0.255529 0.061677 1.019 2
length{all}[20] 0.091861 0.008913 0.000121 0.259463 0.064143 1.005 2
length{all}[21] 0.107875 0.011021 0.000310 0.350973 0.076473 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009076
Maximum standard deviation of split frequencies = 0.025439
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.002
Maximum PSRF for parameter values = 1.020
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 861
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 287 / 287 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 287 / 287 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043960 0.062264 0.066343 0.062529 0.024688 0.096552 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1235.673254
Iterating by ming2
Initial: fx= 1235.673254
x= 0.04396 0.06226 0.06634 0.06253 0.02469 0.09655 0.30000 1.30000
1 h-m-p 0.0000 0.0001 688.7282 ++ 1194.192541 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0063 54.9103 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 630.6515 ++ 1166.960487 m 0.0001 44 | 2/8
4 h-m-p 0.0010 0.0105 37.6905 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 565.4099 ++ 1146.104319 m 0.0001 75 | 3/8
6 h-m-p 0.0012 0.0204 25.8296 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 490.9435 ++ 1145.877579 m 0.0000 106 | 4/8
8 h-m-p 0.0001 0.0370 18.5313 ---------.. | 4/8
9 h-m-p 0.0000 0.0000 400.4316 ++ 1143.699063 m 0.0000 135 | 5/8
10 h-m-p 0.0003 0.0442 12.9461 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 282.5882 ++ 1135.040197 m 0.0001 165 | 6/8
12 h-m-p 0.3836 8.0000 0.0000 +++ 1135.040197 m 8.0000 177 | 6/8
13 h-m-p 0.0546 8.0000 0.0013 ----C 1135.040197 0 0.0001 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 ---------Y 1135.040197 0 0.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 --Y 1135.040197 0 0.0003 231
Out..
lnL = -1135.040197
232 lfun, 232 eigenQcodon, 1392 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067796 0.046020 0.054820 0.077411 0.043602 0.036728 0.300008 0.878131 0.533740
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.923933
np = 9
lnL0 = -1226.421857
Iterating by ming2
Initial: fx= 1226.421857
x= 0.06780 0.04602 0.05482 0.07741 0.04360 0.03673 0.30001 0.87813 0.53374
1 h-m-p 0.0000 0.0001 679.4153 ++ 1165.104948 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 346.3145 ++ 1155.379056 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 9426.7125 ++ 1152.513468 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 3503644.8985 ++ 1144.830086 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 78518.5656 ++ 1137.583555 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 14662.7151 ++ 1135.040159 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1135.040159 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.0948 ------------Y 1135.040159 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 1135.040159 m 8.0000 131 | 6/9
10 h-m-p 0.0014 0.5922 1.2979 --------C 1135.040159 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0012 +++++ 1135.040159 m 8.0000 169 | 6/9
12 h-m-p 0.0174 1.3482 0.5633 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040158 m 8.0000 213 | 6/9
14 h-m-p 0.0077 3.8515 0.2985 -------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040158 m 8.0000 257 | 6/9
16 h-m-p 0.0078 3.9210 0.2933 ----------C 1135.040158 0 0.0000 282 | 6/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 1135.040158 m 8.0000 300 | 6/9
18 h-m-p 0.0060 2.9910 0.2954 ---------N 1135.040158 0 0.0000 324 | 6/9
19 h-m-p 0.0160 8.0000 0.0003 +++++ 1135.040158 m 8.0000 342 | 6/9
20 h-m-p 0.0059 1.9031 0.3611 ---------Y 1135.040158 0 0.0000 366 | 6/9
21 h-m-p 0.0160 8.0000 0.0001 ----N 1135.040158 0 0.0000 385 | 6/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 1135.040158 m 8.0000 403 | 6/9
23 h-m-p 0.0035 1.7558 0.4154 ----------Y 1135.040158 0 0.0000 428 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 1135.040158 m 8.0000 446 | 6/9
25 h-m-p 0.0027 1.3741 0.5828 ----------C 1135.040158 0 0.0000 471 | 6/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040158 m 8.0000 489 | 6/9
27 h-m-p 0.0022 1.0859 0.7030 ------------.. | 6/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040158 m 8.0000 532 | 6/9
29 h-m-p 0.0079 3.9678 0.2913 ---------Y 1135.040158 0 0.0000 556 | 6/9
30 h-m-p 0.0160 8.0000 0.0002 +++++ 1135.040158 m 8.0000 574 | 6/9
31 h-m-p 0.0056 2.7804 0.5964 ------------.. | 6/9
32 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040157 m 8.0000 617 | 6/9
33 h-m-p 0.0076 3.8064 0.3032 ---------Y 1135.040157 0 0.0000 641 | 6/9
34 h-m-p 0.0160 8.0000 0.0032 +++++ 1135.040154 m 8.0000 659 | 6/9
35 h-m-p 0.0745 4.2526 0.3439 -----------Y 1135.040154 0 0.0000 685 | 6/9
36 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040154 m 8.0000 703 | 6/9
37 h-m-p 0.0008 0.2358 1.1501 +++++ 1135.040144 m 0.2358 721 | 7/9
38 h-m-p 0.3972 1.9861 0.2635 ++ 1135.040085 m 1.9861 733 | 8/9
39 h-m-p 0.2085 1.0423 0.3914 ++ 1135.039933 m 1.0423 747 | 9/9
40 h-m-p 0.0160 8.0000 0.0000 N 1135.039933 0 0.0160 760 | 9/9
41 h-m-p 0.0160 8.0000 0.0000 N 1135.039933 0 0.0160 772
Out..
lnL = -1135.039933
773 lfun, 2319 eigenQcodon, 9276 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106401 0.042973 0.010836 0.037470 0.057566 0.023923 0.000100 1.125293 0.430846 0.274668 1.378123
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.511440
np = 11
lnL0 = -1210.477058
Iterating by ming2
Initial: fx= 1210.477058
x= 0.10640 0.04297 0.01084 0.03747 0.05757 0.02392 0.00011 1.12529 0.43085 0.27467 1.37812
1 h-m-p 0.0000 0.0000 637.1125 ++ 1209.369472 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 260.7765 +++ 1192.373821 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0002 183.8687 ++ 1177.767433 m 0.0002 45 | 3/11
4 h-m-p 0.0003 0.0017 65.1184 ++ 1163.865341 m 0.0017 59 | 4/11
5 h-m-p 0.0000 0.0000 1389.2092 ++ 1159.856159 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 23447.8725 ++ 1152.647948 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 620.0656 ++ 1149.639048 m 0.0000 101 | 7/11
8 h-m-p 0.0160 8.0000 11.9606 -------------.. | 7/11
9 h-m-p 0.0000 0.0002 266.1559 +++ 1135.040132 m 0.0002 141 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 1135.040132 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0338 -------------.. | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040132 m 8.0000 203 | 8/11
13 h-m-p 0.0160 8.0000 2.1135 ----------Y 1135.040132 0 0.0000 230 | 8/11
14 h-m-p 0.0160 8.0000 0.0004 +++++ 1135.040132 m 8.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 1.6488 ----------N 1135.040132 0 0.0000 274 | 8/11
16 h-m-p 0.0160 8.0000 0.0005 +++++ 1135.040132 m 8.0000 291 | 8/11
17 h-m-p 0.0160 8.0000 2.4543 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040132 m 8.0000 336 | 8/11
19 h-m-p 0.0160 8.0000 3.5293 ------------Y 1135.040132 0 0.0000 365 | 8/11
20 h-m-p 0.0160 8.0000 0.0226 +++++ 1135.040121 m 8.0000 382 | 8/11
21 h-m-p 0.0972 8.0000 1.8610 -----------Y 1135.040121 0 0.0000 410 | 8/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040121 m 8.0000 427 | 8/11
23 h-m-p 0.0007 0.3668 0.7873 +++++ 1135.040111 m 0.3668 447 | 9/11
24 h-m-p 0.4012 8.0000 0.3895 ++Y 1135.040103 0 5.1903 466 | 9/11
25 h-m-p 1.6000 8.0000 0.1025 C 1135.040103 0 1.4136 482 | 9/11
26 h-m-p 1.6000 8.0000 0.0073 Y 1135.040103 0 0.2693 498 | 9/11
27 h-m-p 1.6000 8.0000 0.0003 -----Y 1135.040103 0 0.0004 519 | 9/11
28 h-m-p 0.0160 8.0000 0.0003 +++++ 1135.040103 m 8.0000 538 | 9/11
29 h-m-p 0.0160 8.0000 3.6498 ++Y 1135.040088 0 0.4882 556 | 9/11
30 h-m-p 1.6000 8.0000 0.1783 C 1135.040088 0 0.3899 570 | 9/11
31 h-m-p 1.6000 8.0000 0.0012 ++ 1135.040087 m 8.0000 586 | 9/11
32 h-m-p 0.0160 8.0000 4.1804 -------------.. | 9/11
33 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.040087 m 8.0000 630 | 9/11
34 h-m-p 0.0160 8.0000 0.2552 ------------N 1135.040087 0 0.0000 658 | 9/11
35 h-m-p 0.0160 8.0000 0.5841 +++++ 1135.039937 m 8.0000 677 | 9/11
36 h-m-p 1.6000 8.0000 0.2255 ++ 1135.039934 m 8.0000 693 | 9/11
37 h-m-p 1.6000 8.0000 0.4319 ++ 1135.039933 m 8.0000 709 | 9/11
38 h-m-p 1.6000 8.0000 0.1686 ++ 1135.039933 m 8.0000 725 | 9/11
39 h-m-p 1.6000 8.0000 0.6101 ++ 1135.039933 m 8.0000 741 | 9/11
40 h-m-p 1.6000 8.0000 0.3183 ++ 1135.039933 m 8.0000 757 | 9/11
41 h-m-p 1.6000 8.0000 0.0000 N 1135.039933 0 1.6000 773
Out..
lnL = -1135.039933
774 lfun, 3096 eigenQcodon, 13932 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1135.097662 S = -1135.041104 -0.021886
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:06
did 20 / 57 patterns 0:06
did 30 / 57 patterns 0:07
did 40 / 57 patterns 0:07
did 50 / 57 patterns 0:07
did 57 / 57 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053739 0.018512 0.054494 0.095073 0.030711 0.028291 0.000100 0.548023 1.571878
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.157488
np = 9
lnL0 = -1210.234320
Iterating by ming2
Initial: fx= 1210.234320
x= 0.05374 0.01851 0.05449 0.09507 0.03071 0.02829 0.00011 0.54802 1.57188
1 h-m-p 0.0000 0.0000 632.4418 ++ 1209.685043 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0088 62.3026 +++++ 1184.718757 m 0.0088 29 | 2/9
3 h-m-p 0.0000 0.0002 534.6274 ++ 1154.175951 m 0.0002 41 | 3/9
4 h-m-p 0.0010 0.0051 76.2309 ++ 1139.144979 m 0.0051 53 | 4/9
5 h-m-p 0.0000 0.0002 1158.2039 ++ 1136.912472 m 0.0002 65 | 5/9
6 h-m-p 0.0000 0.0001 4438.0122 ++ 1135.433137 m 0.0001 77 | 6/9
7 h-m-p 0.0001 0.0005 940.0601 ----------.. | 6/9
8 h-m-p 0.0000 0.0000 385.9316 ++ 1135.240165 m 0.0000 109 | 7/9
9 h-m-p 0.0160 8.0000 1.0517 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 272.8914 ++ 1135.039933 m 0.0000 144 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 1135.039933 0 1.6000 156 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 N 1135.039933 0 0.0160 169
Out..
lnL = -1135.039933
170 lfun, 1870 eigenQcodon, 10200 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011559 0.086056 0.096974 0.104093 0.033641 0.088281 0.000100 0.900000 0.267920 1.191812 1.299918
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.897135
np = 11
lnL0 = -1239.452575
Iterating by ming2
Initial: fx= 1239.452575
x= 0.01156 0.08606 0.09697 0.10409 0.03364 0.08828 0.00011 0.90000 0.26792 1.19181 1.29992
1 h-m-p 0.0000 0.0000 549.5887 ++ 1239.235121 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 365.1040 +++ 1222.846341 m 0.0002 31 | 2/11
3 h-m-p 0.0001 0.0003 267.8156 ++ 1195.956107 m 0.0003 45 | 3/11
4 h-m-p 0.0001 0.0003 747.7027 ++ 1163.862642 m 0.0003 59 | 4/11
5 h-m-p 0.0005 0.0025 87.7842 ++ 1149.023430 m 0.0025 73 | 5/11
6 h-m-p 0.0000 0.0001 2624.3613 ++ 1146.834555 m 0.0001 87 | 6/11
7 h-m-p 0.0000 0.0002 4622.1097 ++ 1138.418507 m 0.0002 101 | 7/11
8 h-m-p 0.0000 0.0001 14293.8431
QuantileBeta(0.15, 0.00500, 2.31077) = 1.122901e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
+ 1135.040181 m 0.0001 115
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.075269e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038997e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
| 8/11
9 h-m-p 1.6000 8.0000 0.0029
QuantileBeta(0.15, 0.00500, 2.46252) = 1.037973e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46104) = 1.038742e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46067) = 1.038934e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46057) = 1.038982e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46055) = 1.038994e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038997e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
Y 1135.040181 0 0.0000 137
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.075269e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46067) = 1.038932e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46041) = 1.039065e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
| 8/11
10 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038998e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46054) = 1.038999e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46054) = 1.039000e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46053) = 1.039005e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
+ 1135.040181 m 8.0000 157
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.075284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46064) = 1.038945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
| 8/11
11 h-m-p 0.0085 4.2366 1.7520
QuantileBeta(0.15, 0.00500, 2.46104) = 1.038739e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46065) = 1.038944e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46055) = 1.038995e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039008e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039011e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
N 1135.040181 0 0.0000 183
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.075284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039011e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
| 8/11
12 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039013e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46051) = 1.039014e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46050) = 1.039020e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46045) = 1.039045e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
+ 1135.040181 m 8.0000 200
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.075351e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039010e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46026) = 1.039144e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
| 8/11
13 h-m-p 0.0087 4.3293 0.2974
QuantileBeta(0.15, 0.00500, 2.46239) = 1.038043e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46089) = 1.038818e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46042) = 1.039061e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46040) = 1.039073e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039076e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
N 1135.040181 0 0.0000 227
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.075351e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039010e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46026) = 1.039144e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
| 8/11
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
Y 1135.040181 0 0.0000 254
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.075351e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039010e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46026) = 1.039144e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
| 8/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039077e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039078e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46039) = 1.039080e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
+ 1135.040181 m 8.0000 274
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.075357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46051) = 1.039016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46025) = 1.039149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
| 8/11
16 h-m-p 0.0089 4.4678 0.3186
QuantileBeta(0.15, 0.00500, 2.46138) = 1.038566e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46063) = 1.038954e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46044) = 1.039050e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46040) = 1.039075e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039081e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
Y 1135.040181 0 0.0000 300
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.075357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46051) = 1.039016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46025) = 1.039149e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
| 8/11
17 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46038) = 1.039084e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46037) = 1.039086e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46036) = 1.039095e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46029) = 1.039131e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
+ 1135.040181 m 8.0000 320
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.075454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46033) = 1.039110e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46007) = 1.039244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
| 8/11
18 h-m-p 0.0100 5.0084 0.2777
QuantileBeta(0.15, 0.00500, 2.46112) = 1.038701e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46043) = 1.039058e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46026) = 1.039147e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46021) = 1.039169e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039175e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039176e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
Y 1135.040181 0 0.0000 348
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.075454e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46033) = 1.039110e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46007) = 1.039244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
| 8/11
19 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46020) = 1.039177e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46019) = 1.039179e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46018) = 1.039185e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
+ 1135.040181 m 8.0000 368
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.075471e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46030) = 1.039126e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46004) = 1.039260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
| 8/11
20 h-m-p 0.0103 5.1458 0.2295
QuantileBeta(0.15, 0.00500, 2.46052) = 1.039012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46025) = 1.039148e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46019) = 1.039182e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039190e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039192e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
Y 1135.040181 0 0.0000 396
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.075471e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46030) = 1.039126e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46004) = 1.039260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
| 8/11
21 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
Y 1135.040181 0 0.0000 417
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.075471e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46030) = 1.039126e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46004) = 1.039260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
| 8/11
22 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039193e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46017) = 1.039194e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46016) = 1.039196e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46014) = 1.039206e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
+ 1135.040181 m 8.0000 437
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.075498e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46025) = 1.039152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45999) = 1.039286e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
| 8/11
23 h-m-p 0.0101 5.0611 0.4005
QuantileBeta(0.15, 0.00500, 2.46237) = 1.038050e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46068) = 1.038927e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46026) = 1.039146e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46015) = 1.039201e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46013) = 1.039215e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039218e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
C 1135.040181 0 0.0000 463
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.075498e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46025) = 1.039152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45999) = 1.039286e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
| 8/11
24 h-m-p 0.0160 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 2.46011) = 1.039222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46009) = 1.039231e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46003) = 1.039266e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45976) = 1.039407e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45867) = 1.039969e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
+ 1135.040180 m 8.0000 483
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.077015e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45742) = 1.040618e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45717) = 1.040752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
| 8/11
25 h-m-p 0.0131 5.1722 0.3898
QuantileBeta(0.15, 0.00500, 2.46012) = 1.039219e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45800) = 1.040318e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45747) = 1.040593e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45734) = 1.040662e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45731) = 1.040679e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040684e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
C 1135.040180 0 0.0000 509
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.077015e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45742) = 1.040618e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45717) = 1.040752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45730) = 1.040685e-160 2000 rounds
| 8/11
26 h-m-p 0.0160 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 2.45729) = 1.040687e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45728) = 1.040692e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45724) = 1.040713e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45708) = 1.040795e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45645) = 1.041125e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
+ 1135.040180 m 8.0000 529
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.077905e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45577) = 1.041479e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45552) = 1.041612e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
| 8/11
27 h-m-p 0.0104 5.2104 0.3895
QuantileBeta(0.15, 0.00500, 2.45790) = 1.040372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45621) = 1.041252e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45579) = 1.041472e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45568) = 1.041527e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45565) = 1.041541e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45565) = 1.041544e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
Y 1135.040180 0 0.0000 558
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.077905e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45577) = 1.041479e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45552) = 1.041612e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
| 8/11
28 h-m-p 0.0160 8.0000 0.0016
QuantileBeta(0.15, 0.00500, 2.45563) = 1.041553e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45559) = 1.041576e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45541) = 1.041666e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45472) = 1.042028e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.45194) = 1.043478e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
+ 1135.040179 m 8.0000 578
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.081819e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44854) = 1.045260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44829) = 1.045394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
| 8/11
29 h-m-p 0.0310 5.2508 0.4072
QuantileBeta(0.15, 0.00500, 2.45564) = 1.041545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45022) = 1.044379e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44887) = 1.045090e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44853) = 1.045268e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44844) = 1.045312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045323e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045326e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
N 1135.040179 0 0.0000 607
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.081819e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44854) = 1.045260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44829) = 1.045394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
| 8/11
30 h-m-p 0.0160 8.0000 0.0027
QuantileBeta(0.15, 0.00500, 2.44844) = 1.045314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045324e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045326e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
N 1135.040179 0 0.0000 630
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.081819e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44854) = 1.045260e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44829) = 1.045394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
| 8/11
31 h-m-p 0.0160 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045325e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045326e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
C 1135.040179 0 0.0000 653
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
Out..
lnL = -1135.040179
654 lfun, 7848 eigenQcodon, 43164 P(t)
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1135.052928 S = -1135.035215 -0.007785
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:20
did 20 / 57 patterns 0:20
did 30 / 57 patterns 0:20
did 40 / 57 patterns 0:20
did 50 / 57 patterns 0:21
did 57 / 57 patterns 0:21
QuantileBeta(0.15, 0.00500, 2.44842) = 1.045327e-160 2000 rounds
Time used: 0:21
CodeML output code: -1