--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:49:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1367/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1176.81         -1179.98
2      -1176.82         -1179.97
--------------------------------------
TOTAL    -1176.82         -1179.98
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.891519    0.092805    0.353195    1.488029    0.860495   1241.72   1371.36    1.000
r(A<->C){all}   0.176412    0.022104    0.000114    0.481135    0.139415    117.57    180.97    1.002
r(A<->G){all}   0.156905    0.017672    0.000021    0.430350    0.124312    182.37    198.81    1.000
r(A<->T){all}   0.176720    0.021027    0.000063    0.471102    0.140867    180.19    231.79    1.002
r(C<->G){all}   0.156066    0.018356    0.000016    0.424226    0.120581    126.89    154.59    1.002
r(C<->T){all}   0.164747    0.020119    0.000029    0.440243    0.125793    215.14    216.93    1.000
r(G<->T){all}   0.169151    0.019712    0.000008    0.451966    0.130942    142.03    192.20    1.004
pi(A){all}      0.201388    0.000181    0.175422    0.226682    0.201236   1460.87   1480.93    1.001
pi(C){all}      0.292427    0.000235    0.262781    0.322395    0.292137   1173.34   1215.61    1.001
pi(G){all}      0.309300    0.000244    0.280089    0.340221    0.309425   1342.41   1357.44    1.000
pi(T){all}      0.196885    0.000185    0.168104    0.221159    0.196639   1371.13   1387.81    1.000
alpha{1,2}      0.419062    0.227563    0.000120    1.389504    0.251890    934.08   1113.28    1.000
alpha{3}        0.451626    0.236409    0.000714    1.478272    0.288972   1330.13   1356.98    1.001
pinvar{all}     0.998141    0.000005    0.994066    1.000000    0.998816   1207.86   1251.21    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1135.039933
Model 2: PositiveSelection	-1135.039933
Model 0: one-ratio	-1135.040197
Model 7: beta	-1135.039933
Model 8: beta&w>1	-1135.040179


Model 0 vs 1	5.280000000311702E-4

Model 2 vs 1	0.0

Model 8 vs 7	4.920000001220615E-4
>C1
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C2
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C3
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C4
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C5
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C6
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=287 

C1              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C2              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C3              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C4              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C5              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C6              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
                **************************************************

C1              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C2              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C3              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C4              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C5              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C6              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
                **************************************************

C1              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C2              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C3              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C4              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C5              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C6              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
                **************************************************

C1              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C2              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C3              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C4              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C5              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C6              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
                **************************************************

C1              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C2              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C3              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C4              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C5              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C6              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
                **************************************************

C1              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C2              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C3              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C4              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C5              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C6              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
                *************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  287 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  287 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8610]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8610]--->[8610]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.846 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C2              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C3              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C4              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C5              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
C6              MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
                **************************************************

C1              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C2              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C3              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C4              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C5              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
C6              TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
                **************************************************

C1              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C2              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C3              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C4              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C5              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
C6              SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
                **************************************************

C1              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C2              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C3              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C4              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C5              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
C6              YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
                **************************************************

C1              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C2              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C3              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C4              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C5              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
C6              RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
                **************************************************

C1              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C2              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C3              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C4              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C5              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
C6              FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
                *************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C2              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C3              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C4              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C5              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
C6              ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
                **************************************************

C1              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C2              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C3              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C4              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C5              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
C6              GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
                **************************************************

C1              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C2              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C3              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C4              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C5              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
C6              AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
                **************************************************

C1              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C2              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C3              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C4              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C5              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
C6              ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
                **************************************************

C1              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C2              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C3              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C4              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C5              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
C6              GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
                **************************************************

C1              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C2              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C3              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C4              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C5              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
C6              ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
                **************************************************

C1              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C2              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C3              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C4              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C5              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
C6              TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
                **************************************************

C1              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C2              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C3              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C4              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C5              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
C6              ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
                **************************************************

C1              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C2              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C3              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C4              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C5              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
C6              TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
                **************************************************

C1              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C2              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C3              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C4              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C5              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
C6              TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
                **************************************************

C1              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C2              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C3              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C4              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C5              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
C6              TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
                **************************************************

C1              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C2              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C3              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C4              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C5              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
C6              TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
                **************************************************

C1              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C2              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C3              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C4              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C5              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
C6              CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
                **************************************************

C1              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C2              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C3              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C4              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C5              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
C6              ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
                **************************************************

C1              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C2              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C3              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C4              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C5              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
C6              AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
                **************************************************

C1              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C2              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C3              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C4              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C5              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
C6              TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
                **************************************************

C1              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C2              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C3              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C4              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C5              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
C6              ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
                **************************************************

C1              GCTTCGGCGCG
C2              GCTTCGGCGCG
C3              GCTTCGGCGCG
C4              GCTTCGGCGCG
C5              GCTTCGGCGCG
C6              GCTTCGGCGCG
                ***********



>C1
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C2
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C3
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C4
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C5
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C6
ATGATCGACCACCTCGATAGCGTTGTAGAGATCGGGCTGACCGGACGGCC
GCCACGGGCCATCCCAGAACCCAGGCCGCGTAGCTCGCACGGTCCGGCCA
AGGTCGTCGCGATGTGCAACCAGAAGGGTGGCGTCGGGAAAACCACGTCG
ACGATCAACCTGGGTGCCGCCCTCACCGAATTCGGCCGGAGGGTGCTGCT
GGTGGATATAGACCCGCAGGGCGCACTGTCGGCAGGCCTTGGCGTACCGC
ATTACGAGCTAGACCGGACAATCCACAACCTAATGGTGGAACCACTGGTA
TCGATCGACGACGTGCTGATCCACACACGGGTCAGATACTTAGATTTGGT
ACCCAGCAATATCGACCTGTCGGCTGCCGAGATCCAGTTGGTTAACGAGG
TGGGGCGAGAGCAGACCTTGGCGCGGGCGTTGCACCCGGTACTGGACCGC
TACGATTATGTGCTGATTGACTGCCAGCCTTCGCTGGGCCTACTCACCGT
TAACGGACTGGCTTGTGCAGAGGGCGTAGTTATCCCGACGGAATGCGAAT
TCTTCTCGCTGCGTGGGCTGGCGTTGCTTACCGACACCGTAGACAAGGTG
CGTGATCGGCTCAACCCGAAGTTGGAAATCAGCGGCATCCTGATTACTCG
ATATGACCCGCGCACTGTCAACGCACGCGAGGTTATGGCACGTGTCGTAG
AACGGTTCGGCGACCTGGTCTTTGACACTGTGATCACCCGTACGGTCCGG
TTTCCTGAGACCAGTGTCGCGGGTGAACCCATCACCACGTGGGCACCGAA
ATCGGGCGGCGCCAGGGCCTATCGCGCATTGGCCTGTGAATTCATCGACC
GCTTCGGCGCG
>C1
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C2
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C3
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C4
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C5
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA
>C6
MIDHLDSVVEIGLTGRPPRAIPEPRPRSSHGPAKVVAMCNQKGGVGKTTS
TINLGAALTEFGRRVLLVDIDPQGALSAGLGVPHYELDRTIHNLMVEPLV
SIDDVLIHTRVRYLDLVPSNIDLSAAEIQLVNEVGREQTLARALHPVLDR
YDYVLIDCQPSLGLLTVNGLACAEGVVIPTECEFFSLRGLALLTDTVDKV
RDRLNPKLEISGILITRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPKSGGARAYRALACEFIDRFGA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 861 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859282
      Setting output file names to "/data/6res/ML1367/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1089405670
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5571185194
      Seed = 302348072
      Swapseed = 1579859282
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1926.959277 -- -24.965149
         Chain 2 -- -1926.959277 -- -24.965149
         Chain 3 -- -1926.959277 -- -24.965149
         Chain 4 -- -1926.959277 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1926.959277 -- -24.965149
         Chain 2 -- -1926.959277 -- -24.965149
         Chain 3 -- -1926.959277 -- -24.965149
         Chain 4 -- -1926.959277 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1926.959] (-1926.959) (-1926.959) (-1926.959) * [-1926.959] (-1926.959) (-1926.959) (-1926.959) 
        500 -- (-1192.506) (-1202.162) [-1188.710] (-1184.759) * [-1187.888] (-1193.155) (-1200.702) (-1193.446) -- 0:00:00
       1000 -- [-1185.446] (-1185.922) (-1192.291) (-1182.609) * [-1187.930] (-1196.972) (-1192.600) (-1190.415) -- 0:16:39
       1500 -- [-1183.347] (-1192.904) (-1190.561) (-1190.719) * (-1188.460) (-1192.846) (-1185.012) [-1188.324] -- 0:11:05
       2000 -- [-1182.731] (-1188.259) (-1188.371) (-1186.632) * (-1182.996) (-1187.137) [-1185.549] (-1188.363) -- 0:08:19
       2500 -- (-1192.686) (-1185.633) [-1180.018] (-1189.228) * (-1183.406) [-1186.909] (-1191.968) (-1182.000) -- 0:06:39
       3000 -- (-1187.722) [-1184.085] (-1182.262) (-1188.781) * (-1191.011) (-1195.188) (-1192.053) [-1180.920] -- 0:05:32
       3500 -- (-1192.133) (-1185.035) [-1186.146] (-1182.391) * (-1190.560) (-1183.540) [-1184.049] (-1180.353) -- 0:04:44
       4000 -- (-1185.572) [-1182.811] (-1189.151) (-1181.919) * (-1186.655) [-1184.362] (-1196.180) (-1183.604) -- 0:04:09
       4500 -- (-1185.003) (-1185.517) [-1185.913] (-1193.555) * (-1182.093) (-1183.801) [-1181.056] (-1182.536) -- 0:03:41
       5000 -- (-1194.780) (-1179.025) (-1183.652) [-1185.214] * (-1187.232) [-1188.175] (-1185.068) (-1183.957) -- 0:03:19

      Average standard deviation of split frequencies: 0.095647

       5500 -- (-1188.809) (-1182.892) [-1183.119] (-1185.569) * (-1187.166) (-1191.024) (-1190.248) [-1188.436] -- 0:03:00
       6000 -- (-1187.016) (-1185.465) (-1184.738) [-1180.034] * (-1186.751) (-1190.006) (-1187.812) [-1189.686] -- 0:02:45
       6500 -- (-1186.515) (-1190.190) [-1183.229] (-1186.790) * [-1183.939] (-1189.015) (-1186.381) (-1187.361) -- 0:02:32
       7000 -- (-1187.869) [-1192.182] (-1186.572) (-1180.756) * (-1190.480) (-1182.338) [-1182.431] (-1186.597) -- 0:02:21
       7500 -- (-1187.547) (-1184.259) [-1183.046] (-1182.545) * (-1185.695) (-1193.406) [-1184.301] (-1194.701) -- 0:02:12
       8000 -- (-1183.695) [-1186.935] (-1189.317) (-1190.067) * [-1188.036] (-1181.399) (-1191.060) (-1190.597) -- 0:02:04
       8500 -- (-1193.430) [-1180.512] (-1181.221) (-1190.022) * [-1194.017] (-1187.532) (-1191.688) (-1190.705) -- 0:01:56
       9000 -- (-1187.856) (-1183.407) (-1188.673) [-1187.329] * (-1184.779) (-1180.188) (-1190.703) [-1181.016] -- 0:01:50
       9500 -- (-1194.891) [-1184.799] (-1186.155) (-1190.889) * (-1182.567) [-1187.329] (-1191.202) (-1189.674) -- 0:01:44
      10000 -- (-1184.042) [-1181.428] (-1188.054) (-1184.817) * [-1185.649] (-1194.683) (-1195.013) (-1191.140) -- 0:01:39

      Average standard deviation of split frequencies: 0.060476

      10500 -- [-1187.392] (-1187.650) (-1187.417) (-1189.244) * [-1181.269] (-1185.394) (-1187.426) (-1185.385) -- 0:01:34
      11000 -- (-1191.416) (-1196.749) (-1186.263) [-1186.794] * (-1189.766) (-1180.471) [-1187.687] (-1182.828) -- 0:01:29
      11500 -- (-1182.892) (-1185.410) (-1192.933) [-1188.321] * [-1185.480] (-1181.817) (-1187.265) (-1198.843) -- 0:01:25
      12000 -- (-1191.029) [-1193.787] (-1187.302) (-1187.918) * (-1180.958) (-1190.048) (-1183.014) [-1182.588] -- 0:01:22
      12500 -- (-1182.972) (-1179.436) [-1189.424] (-1184.431) * (-1189.026) [-1188.625] (-1190.005) (-1188.053) -- 0:01:19
      13000 -- [-1184.547] (-1179.818) (-1195.022) (-1192.136) * (-1182.480) [-1179.770] (-1185.160) (-1191.090) -- 0:01:15
      13500 -- [-1186.260] (-1188.605) (-1197.326) (-1192.107) * (-1187.494) (-1189.042) (-1180.802) [-1193.698] -- 0:01:13
      14000 -- [-1180.880] (-1188.868) (-1183.509) (-1186.334) * (-1188.959) (-1185.131) [-1186.781] (-1193.158) -- 0:01:10
      14500 -- (-1184.661) [-1182.763] (-1186.849) (-1186.029) * (-1188.792) [-1181.097] (-1181.039) (-1194.191) -- 0:01:07
      15000 -- [-1193.830] (-1189.692) (-1186.617) (-1184.893) * (-1193.049) (-1191.145) [-1182.794] (-1187.097) -- 0:01:05

      Average standard deviation of split frequencies: 0.053401

      15500 -- (-1185.783) (-1183.114) [-1189.978] (-1182.228) * [-1185.531] (-1189.765) (-1190.429) (-1187.467) -- 0:01:03
      16000 -- (-1180.161) (-1193.956) (-1200.174) [-1181.251] * (-1177.863) [-1186.149] (-1181.887) (-1188.030) -- 0:01:01
      16500 -- (-1184.331) (-1190.445) (-1190.731) [-1191.713] * [-1185.287] (-1185.797) (-1206.121) (-1183.787) -- 0:01:59
      17000 -- (-1185.469) [-1184.462] (-1187.261) (-1188.457) * (-1181.897) [-1189.852] (-1185.681) (-1187.919) -- 0:01:55
      17500 -- (-1197.568) (-1183.577) [-1179.226] (-1188.094) * [-1189.675] (-1185.815) (-1184.103) (-1180.452) -- 0:01:52
      18000 -- [-1182.819] (-1187.434) (-1184.631) (-1183.081) * (-1194.425) (-1185.542) [-1184.699] (-1182.772) -- 0:01:49
      18500 -- [-1196.166] (-1182.099) (-1180.421) (-1186.811) * (-1182.343) (-1188.931) [-1184.827] (-1183.933) -- 0:01:46
      19000 -- [-1189.542] (-1190.311) (-1179.371) (-1181.769) * (-1192.804) (-1184.618) [-1186.713] (-1187.201) -- 0:01:43
      19500 -- (-1192.825) (-1187.888) [-1178.190] (-1187.223) * (-1186.549) (-1185.826) [-1193.400] (-1186.562) -- 0:01:40
      20000 -- (-1180.374) (-1185.429) [-1179.188] (-1195.198) * (-1191.959) (-1196.417) (-1184.948) [-1189.957] -- 0:01:38

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-1187.308] (-1188.112) (-1181.097) (-1192.089) * (-1193.867) [-1183.587] (-1188.752) (-1190.856) -- 0:01:35
      21000 -- (-1184.990) [-1182.003] (-1179.300) (-1187.649) * (-1187.449) [-1185.763] (-1182.020) (-1181.533) -- 0:01:33
      21500 -- (-1185.844) [-1184.994] (-1176.727) (-1186.997) * (-1183.983) [-1186.407] (-1184.961) (-1184.616) -- 0:01:31
      22000 -- (-1184.985) [-1182.856] (-1178.919) (-1187.187) * (-1192.030) (-1185.781) (-1185.136) [-1185.715] -- 0:01:28
      22500 -- (-1184.199) (-1191.336) (-1179.253) [-1192.974] * (-1185.315) [-1189.942] (-1176.614) (-1186.615) -- 0:01:26
      23000 -- (-1183.628) (-1187.794) (-1185.917) [-1188.991] * (-1187.929) (-1198.295) (-1176.497) [-1189.281] -- 0:01:24
      23500 -- (-1189.690) (-1192.159) (-1179.083) [-1188.269] * (-1183.606) (-1200.828) (-1179.844) [-1187.184] -- 0:01:23
      24000 -- (-1187.459) (-1184.469) (-1179.747) [-1186.664] * (-1181.050) (-1192.417) (-1178.270) [-1192.829] -- 0:01:21
      24500 -- [-1192.616] (-1185.863) (-1182.155) (-1183.992) * [-1184.746] (-1176.876) (-1178.391) (-1189.573) -- 0:01:19
      25000 -- (-1183.225) [-1181.246] (-1183.444) (-1185.507) * (-1187.394) (-1176.420) [-1177.272] (-1190.304) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-1182.691) [-1187.469] (-1181.693) (-1188.273) * [-1187.083] (-1177.076) (-1178.417) (-1187.197) -- 0:01:16
      26000 -- [-1179.957] (-1185.120) (-1176.502) (-1191.472) * (-1187.260) (-1179.557) [-1177.146] (-1186.009) -- 0:01:14
      26500 -- [-1189.548] (-1189.719) (-1177.453) (-1201.756) * (-1187.912) [-1178.394] (-1177.757) (-1187.412) -- 0:01:13
      27000 -- (-1189.255) [-1187.327] (-1179.077) (-1186.023) * (-1194.815) [-1175.785] (-1176.120) (-1189.954) -- 0:01:12
      27500 -- [-1184.501] (-1181.712) (-1177.749) (-1176.580) * (-1190.560) [-1176.220] (-1176.697) (-1184.936) -- 0:01:10
      28000 -- (-1191.510) (-1182.110) (-1181.984) [-1176.776] * (-1183.674) [-1177.718] (-1176.156) (-1188.495) -- 0:01:09
      28500 -- (-1186.618) [-1198.927] (-1181.350) (-1176.012) * (-1187.220) (-1177.989) (-1175.988) [-1185.353] -- 0:01:08
      29000 -- (-1187.620) (-1186.044) [-1178.731] (-1178.334) * (-1186.847) (-1175.772) (-1176.176) [-1186.492] -- 0:01:06
      29500 -- (-1188.555) [-1186.817] (-1176.858) (-1178.279) * (-1189.873) [-1176.465] (-1179.467) (-1185.438) -- 0:01:05
      30000 -- (-1187.235) (-1187.128) [-1177.505] (-1182.016) * (-1184.793) (-1178.847) (-1181.182) [-1183.159] -- 0:01:04

      Average standard deviation of split frequencies: 0.025080

      30500 -- (-1186.057) (-1192.927) [-1177.436] (-1178.730) * (-1186.781) [-1178.472] (-1180.519) (-1198.592) -- 0:01:03
      31000 -- [-1187.495] (-1182.639) (-1178.497) (-1180.353) * (-1177.332) (-1179.298) (-1181.721) [-1185.446] -- 0:01:02
      31500 -- [-1183.132] (-1195.902) (-1175.977) (-1176.686) * (-1183.309) (-1175.681) (-1177.352) [-1185.546] -- 0:01:32
      32000 -- (-1199.656) (-1183.600) (-1177.289) [-1179.039] * (-1177.575) (-1175.788) (-1179.533) [-1189.033] -- 0:01:30
      32500 -- (-1183.599) (-1186.851) (-1179.318) [-1176.764] * [-1178.451] (-1183.573) (-1178.463) (-1188.068) -- 0:01:29
      33000 -- (-1187.482) [-1186.682] (-1179.016) (-1177.820) * (-1178.537) [-1179.063] (-1178.116) (-1184.036) -- 0:01:27
      33500 -- (-1194.465) (-1196.637) (-1177.603) [-1175.986] * (-1178.888) (-1177.022) (-1178.125) [-1182.030] -- 0:01:26
      34000 -- (-1182.840) [-1183.216] (-1177.923) (-1177.006) * (-1177.059) (-1180.397) (-1177.352) [-1184.037] -- 0:01:25
      34500 -- [-1185.854] (-1179.625) (-1177.190) (-1177.070) * [-1176.231] (-1186.662) (-1177.707) (-1181.817) -- 0:01:23
      35000 -- (-1194.273) (-1179.238) (-1177.369) [-1179.616] * (-1180.174) [-1178.719] (-1176.673) (-1187.890) -- 0:01:22

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-1187.065) (-1178.105) [-1176.968] (-1176.834) * (-1177.937) [-1176.845] (-1177.063) (-1188.309) -- 0:01:21
      36000 -- [-1185.809] (-1178.036) (-1177.874) (-1175.418) * (-1177.123) (-1176.631) (-1177.280) [-1186.331] -- 0:01:20
      36500 -- (-1186.016) (-1177.982) (-1177.831) [-1175.813] * (-1178.189) (-1177.111) (-1180.654) [-1184.617] -- 0:01:19
      37000 -- (-1189.361) (-1180.096) (-1178.854) [-1175.444] * (-1178.301) (-1179.819) (-1177.363) [-1182.473] -- 0:01:18
      37500 -- (-1186.343) (-1180.018) [-1175.370] (-1175.449) * (-1178.441) (-1176.969) (-1179.097) [-1187.783] -- 0:01:17
      38000 -- (-1182.985) (-1177.137) [-1175.490] (-1175.314) * [-1180.354] (-1179.855) (-1178.731) (-1195.760) -- 0:01:15
      38500 -- (-1190.955) (-1178.017) (-1177.629) [-1176.163] * [-1178.752] (-1177.437) (-1177.943) (-1181.124) -- 0:01:14
      39000 -- (-1186.905) [-1177.019] (-1179.406) (-1180.504) * (-1178.783) (-1176.447) (-1176.749) [-1184.664] -- 0:01:13
      39500 -- (-1193.385) [-1176.538] (-1178.498) (-1178.008) * [-1176.856] (-1181.149) (-1176.204) (-1186.293) -- 0:01:12
      40000 -- (-1190.180) (-1177.177) (-1177.762) [-1177.944] * (-1177.725) (-1178.720) (-1177.798) [-1183.277] -- 0:01:12

      Average standard deviation of split frequencies: 0.029559

      40500 -- (-1192.252) (-1177.099) [-1179.328] (-1177.659) * (-1177.180) [-1179.534] (-1180.552) (-1187.584) -- 0:01:11
      41000 -- [-1184.089] (-1176.472) (-1180.669) (-1177.562) * (-1179.365) (-1178.413) (-1180.142) [-1188.936] -- 0:01:10
      41500 -- (-1182.730) (-1176.961) [-1183.644] (-1176.882) * [-1179.460] (-1179.959) (-1182.751) (-1185.349) -- 0:01:09
      42000 -- (-1177.636) [-1182.325] (-1176.298) (-1177.298) * (-1179.164) (-1177.094) (-1177.051) [-1182.995] -- 0:01:08
      42500 -- [-1177.073] (-1178.918) (-1176.207) (-1179.164) * (-1176.288) (-1177.285) (-1175.869) [-1187.913] -- 0:01:07
      43000 -- (-1177.817) [-1177.547] (-1177.301) (-1182.205) * [-1178.618] (-1179.661) (-1177.345) (-1187.574) -- 0:01:06
      43500 -- (-1177.482) [-1177.330] (-1176.248) (-1178.952) * (-1176.594) (-1177.822) (-1179.476) [-1186.665] -- 0:01:05
      44000 -- (-1176.024) (-1176.507) (-1177.456) [-1177.468] * [-1175.385] (-1178.789) (-1176.577) (-1186.149) -- 0:01:05
      44500 -- [-1176.943] (-1177.098) (-1175.287) (-1179.090) * [-1175.602] (-1185.566) (-1176.913) (-1187.314) -- 0:01:04
      45000 -- [-1177.802] (-1176.833) (-1177.402) (-1179.732) * (-1175.738) (-1178.812) (-1177.439) [-1184.487] -- 0:01:03

      Average standard deviation of split frequencies: 0.030256

      45500 -- (-1175.878) (-1178.615) [-1176.440] (-1178.435) * (-1177.559) (-1177.736) (-1177.464) [-1185.640] -- 0:01:02
      46000 -- (-1175.776) [-1175.330] (-1177.410) (-1177.815) * (-1178.386) [-1175.745] (-1177.469) (-1186.260) -- 0:01:02
      46500 -- (-1176.025) (-1175.611) [-1177.934] (-1176.159) * (-1181.550) [-1176.380] (-1181.961) (-1183.313) -- 0:01:01
      47000 -- [-1175.304] (-1175.639) (-1177.114) (-1179.378) * [-1178.843] (-1177.346) (-1181.857) (-1188.751) -- 0:01:21
      47500 -- (-1180.179) (-1175.707) [-1179.430] (-1175.804) * (-1177.328) [-1178.429] (-1177.624) (-1186.369) -- 0:01:20
      48000 -- (-1181.229) (-1176.756) [-1177.896] (-1181.188) * (-1179.883) (-1178.429) [-1176.124] (-1189.463) -- 0:01:19
      48500 -- (-1182.148) [-1176.803] (-1176.159) (-1183.882) * [-1176.416] (-1177.184) (-1175.472) (-1185.918) -- 0:01:18
      49000 -- [-1176.989] (-1178.497) (-1178.050) (-1183.182) * (-1182.329) [-1177.709] (-1180.237) (-1182.199) -- 0:01:17
      49500 -- (-1178.022) (-1177.948) [-1182.535] (-1179.559) * [-1178.625] (-1177.521) (-1178.865) (-1186.432) -- 0:01:16
      50000 -- (-1178.024) [-1175.333] (-1178.490) (-1178.699) * (-1179.566) (-1181.056) (-1178.602) [-1190.424] -- 0:01:16

      Average standard deviation of split frequencies: 0.033299

      50500 -- (-1175.861) [-1177.671] (-1176.697) (-1177.020) * [-1178.242] (-1178.276) (-1176.882) (-1185.741) -- 0:01:15
      51000 -- (-1176.322) [-1177.182] (-1177.573) (-1178.273) * [-1178.002] (-1178.226) (-1175.915) (-1188.266) -- 0:01:14
      51500 -- (-1175.447) (-1176.410) [-1178.772] (-1177.492) * [-1177.061] (-1176.669) (-1177.539) (-1190.963) -- 0:01:13
      52000 -- (-1175.284) (-1177.980) (-1177.435) [-1177.861] * (-1179.439) (-1175.764) (-1175.903) [-1184.857] -- 0:01:12
      52500 -- [-1176.356] (-1178.900) (-1176.040) (-1176.821) * [-1180.885] (-1176.436) (-1177.408) (-1188.094) -- 0:01:12
      53000 -- (-1177.571) (-1177.840) (-1179.618) [-1176.783] * (-1177.118) (-1178.625) (-1177.181) [-1185.318] -- 0:01:11
      53500 -- (-1176.989) (-1177.777) (-1177.870) [-1176.624] * (-1178.864) (-1176.824) (-1177.805) [-1185.305] -- 0:01:10
      54000 -- (-1180.153) (-1175.772) [-1177.445] (-1177.747) * [-1178.066] (-1176.701) (-1177.579) (-1188.776) -- 0:01:10
      54500 -- [-1181.211] (-1178.548) (-1178.196) (-1177.726) * [-1178.679] (-1178.159) (-1179.029) (-1192.082) -- 0:01:09
      55000 -- (-1178.239) [-1180.474] (-1178.933) (-1175.607) * (-1180.189) (-1176.791) (-1177.169) [-1192.331] -- 0:01:08

      Average standard deviation of split frequencies: 0.029042

      55500 -- [-1179.904] (-1179.764) (-1178.062) (-1176.845) * (-1179.756) (-1176.859) (-1177.915) [-1183.800] -- 0:01:08
      56000 -- [-1177.068] (-1179.101) (-1179.477) (-1176.173) * (-1179.824) (-1177.014) [-1177.044] (-1187.046) -- 0:01:07
      56500 -- (-1178.558) [-1179.418] (-1176.311) (-1182.008) * [-1176.480] (-1178.290) (-1177.622) (-1193.087) -- 0:01:06
      57000 -- (-1179.007) [-1175.503] (-1179.983) (-1179.168) * [-1177.046] (-1176.291) (-1181.425) (-1189.982) -- 0:01:06
      57500 -- (-1178.201) (-1176.841) (-1181.727) [-1178.117] * [-1178.673] (-1178.064) (-1179.829) (-1198.401) -- 0:01:05
      58000 -- [-1176.107] (-1176.384) (-1179.550) (-1178.095) * (-1178.854) (-1177.141) (-1179.162) [-1184.221] -- 0:01:04
      58500 -- (-1176.560) (-1178.528) (-1178.208) [-1175.992] * [-1177.236] (-1177.018) (-1178.182) (-1179.917) -- 0:01:04
      59000 -- [-1177.032] (-1176.472) (-1179.881) (-1177.335) * (-1177.161) (-1176.219) [-1176.553] (-1176.010) -- 0:01:03
      59500 -- (-1177.184) [-1176.475] (-1179.984) (-1178.028) * (-1176.229) [-1177.278] (-1179.539) (-1178.248) -- 0:01:03
      60000 -- [-1177.486] (-1175.833) (-1184.678) (-1176.693) * (-1175.402) (-1177.264) (-1179.674) [-1175.741] -- 0:01:02

      Average standard deviation of split frequencies: 0.028628

      60500 -- (-1178.080) (-1178.447) (-1181.095) [-1177.192] * [-1177.016] (-1177.602) (-1179.618) (-1177.920) -- 0:01:02
      61000 -- (-1178.268) [-1176.182] (-1179.795) (-1182.634) * (-1178.970) (-1177.569) (-1176.996) [-1176.091] -- 0:01:01
      61500 -- (-1180.929) (-1175.473) [-1177.161] (-1178.629) * (-1178.969) (-1176.210) [-1177.631] (-1176.179) -- 0:01:01
      62000 -- (-1179.921) [-1176.266] (-1178.016) (-1178.155) * (-1177.013) [-1175.330] (-1176.696) (-1175.766) -- 0:01:15
      62500 -- (-1178.090) (-1180.503) [-1175.539] (-1184.563) * [-1176.511] (-1177.753) (-1175.472) (-1179.798) -- 0:01:15
      63000 -- (-1178.475) [-1177.333] (-1175.499) (-1183.102) * (-1176.259) (-1175.450) [-1177.424] (-1177.602) -- 0:01:14
      63500 -- [-1177.179] (-1180.630) (-1176.575) (-1181.524) * (-1177.844) [-1177.973] (-1177.934) (-1177.227) -- 0:01:13
      64000 -- (-1177.124) (-1178.875) (-1178.221) [-1177.517] * [-1178.182] (-1175.622) (-1176.402) (-1178.555) -- 0:01:13
      64500 -- (-1179.521) [-1176.914] (-1179.753) (-1176.200) * (-1176.252) [-1177.597] (-1176.186) (-1176.626) -- 0:01:12
      65000 -- [-1178.029] (-1175.692) (-1179.826) (-1176.143) * (-1176.972) (-1175.522) [-1176.516] (-1179.302) -- 0:01:11

      Average standard deviation of split frequencies: 0.032855

      65500 -- (-1176.901) [-1177.459] (-1177.660) (-1180.195) * [-1178.119] (-1176.678) (-1176.274) (-1180.020) -- 0:01:11
      66000 -- (-1176.384) (-1188.910) (-1178.956) [-1179.552] * (-1178.263) (-1176.440) [-1178.318] (-1176.688) -- 0:01:10
      66500 -- [-1177.216] (-1184.377) (-1177.907) (-1182.373) * (-1181.950) (-1180.530) (-1180.508) [-1175.879] -- 0:01:10
      67000 -- [-1176.655] (-1184.555) (-1178.510) (-1179.753) * (-1178.017) (-1176.856) [-1177.164] (-1176.996) -- 0:01:09
      67500 -- (-1177.387) (-1177.723) (-1176.311) [-1178.052] * (-1180.533) (-1175.472) (-1176.016) [-1176.466] -- 0:01:09
      68000 -- [-1176.334] (-1176.965) (-1175.116) (-1179.053) * (-1178.822) [-1176.447] (-1176.842) (-1177.397) -- 0:01:08
      68500 -- (-1176.734) (-1177.436) [-1177.029] (-1178.189) * (-1178.380) (-1176.327) [-1176.739] (-1177.612) -- 0:01:07
      69000 -- (-1175.636) (-1178.680) (-1176.281) [-1179.434] * (-1177.303) (-1177.631) (-1180.306) [-1178.890] -- 0:01:07
      69500 -- (-1176.308) [-1177.808] (-1175.599) (-1179.626) * [-1180.110] (-1177.823) (-1179.326) (-1177.521) -- 0:01:06
      70000 -- [-1175.673] (-1177.812) (-1175.599) (-1176.947) * (-1178.347) (-1177.993) [-1176.919] (-1176.728) -- 0:01:06

      Average standard deviation of split frequencies: 0.029141

      70500 -- (-1175.940) [-1178.746] (-1177.324) (-1177.540) * [-1178.471] (-1179.213) (-1178.277) (-1177.030) -- 0:01:05
      71000 -- (-1175.589) (-1177.783) [-1175.345] (-1180.051) * (-1179.113) [-1179.070] (-1179.412) (-1178.256) -- 0:01:05
      71500 -- (-1175.464) (-1177.392) [-1178.581] (-1177.642) * (-1176.435) (-1181.186) (-1178.709) [-1176.170] -- 0:01:04
      72000 -- (-1178.065) [-1177.508] (-1175.818) (-1179.826) * (-1176.537) (-1182.232) [-1179.382] (-1178.872) -- 0:01:04
      72500 -- [-1178.871] (-1177.445) (-1181.714) (-1178.769) * (-1178.664) (-1177.838) (-1177.771) [-1177.554] -- 0:01:03
      73000 -- [-1177.309] (-1177.326) (-1176.487) (-1175.800) * (-1179.019) (-1177.293) [-1177.241] (-1176.345) -- 0:01:03
      73500 -- (-1176.845) (-1178.992) [-1175.226] (-1178.432) * (-1181.131) (-1181.580) (-1181.176) [-1176.083] -- 0:01:03
      74000 -- (-1177.762) (-1178.894) [-1176.590] (-1176.532) * [-1176.733] (-1178.945) (-1181.076) (-1175.768) -- 0:01:02
      74500 -- (-1181.385) (-1178.697) [-1175.588] (-1175.970) * [-1176.164] (-1180.196) (-1178.453) (-1180.499) -- 0:01:02
      75000 -- (-1177.882) [-1176.220] (-1176.641) (-1176.872) * [-1178.650] (-1179.503) (-1179.420) (-1183.935) -- 0:01:01

      Average standard deviation of split frequencies: 0.027000

      75500 -- (-1180.248) (-1175.468) (-1176.857) [-1176.654] * [-1176.610] (-1181.062) (-1176.394) (-1184.608) -- 0:01:01
      76000 -- (-1180.066) (-1175.985) (-1177.573) [-1177.024] * [-1180.393] (-1181.613) (-1176.708) (-1176.402) -- 0:01:00
      76500 -- (-1177.229) (-1177.634) (-1178.313) [-1177.670] * [-1176.194] (-1181.413) (-1178.091) (-1176.005) -- 0:01:00
      77000 -- [-1182.874] (-1178.805) (-1178.289) (-1180.484) * (-1178.830) (-1176.887) (-1177.194) [-1177.013] -- 0:00:59
      77500 -- (-1179.546) [-1177.331] (-1176.740) (-1177.556) * [-1175.878] (-1177.030) (-1177.725) (-1176.221) -- 0:00:59
      78000 -- (-1180.022) (-1181.447) (-1177.197) [-1176.497] * (-1177.868) [-1177.429] (-1177.833) (-1175.940) -- 0:00:59
      78500 -- [-1179.616] (-1182.237) (-1176.495) (-1177.778) * [-1176.676] (-1179.369) (-1177.862) (-1176.244) -- 0:01:10
      79000 -- [-1177.252] (-1183.250) (-1176.202) (-1178.812) * (-1176.178) [-1177.353] (-1176.739) (-1184.168) -- 0:01:09
      79500 -- (-1181.453) [-1178.305] (-1177.921) (-1178.072) * (-1176.905) [-1176.803] (-1176.167) (-1185.300) -- 0:01:09
      80000 -- (-1178.525) [-1176.525] (-1177.846) (-1176.403) * (-1177.131) (-1179.788) [-1177.572] (-1180.569) -- 0:01:09

      Average standard deviation of split frequencies: 0.026125

      80500 -- (-1176.341) [-1176.688] (-1175.816) (-1177.503) * (-1176.082) [-1176.611] (-1178.153) (-1179.350) -- 0:01:08
      81000 -- (-1176.374) (-1181.592) (-1178.622) [-1180.499] * (-1178.952) (-1176.239) [-1178.336] (-1176.709) -- 0:01:08
      81500 -- [-1177.047] (-1176.480) (-1175.983) (-1178.945) * [-1176.692] (-1176.115) (-1177.972) (-1176.016) -- 0:01:07
      82000 -- (-1177.085) (-1177.371) (-1178.193) [-1176.781] * (-1180.005) (-1179.557) (-1176.743) [-1176.254] -- 0:01:07
      82500 -- (-1176.419) (-1177.430) [-1177.824] (-1175.968) * (-1176.184) (-1180.421) [-1175.543] (-1178.488) -- 0:01:06
      83000 -- (-1180.765) (-1180.282) (-1178.284) [-1175.624] * (-1176.878) [-1175.518] (-1176.811) (-1177.274) -- 0:01:06
      83500 -- (-1180.245) [-1176.544] (-1177.411) (-1175.887) * (-1176.554) (-1177.388) [-1177.080] (-1176.906) -- 0:01:05
      84000 -- (-1178.766) (-1178.293) (-1177.680) [-1177.540] * (-1176.687) (-1178.764) [-1177.050] (-1176.991) -- 0:01:05
      84500 -- (-1177.720) (-1183.174) (-1179.749) [-1179.018] * (-1176.010) (-1176.425) [-1175.759] (-1178.328) -- 0:01:05
      85000 -- (-1178.330) (-1176.455) [-1178.817] (-1177.981) * (-1177.359) [-1176.316] (-1175.919) (-1176.319) -- 0:01:04

      Average standard deviation of split frequencies: 0.025676

      85500 -- (-1178.658) (-1175.530) (-1179.149) [-1177.212] * [-1177.836] (-1177.134) (-1175.178) (-1177.631) -- 0:01:04
      86000 -- (-1179.874) (-1177.729) [-1179.466] (-1177.183) * (-1175.546) [-1180.328] (-1176.911) (-1175.723) -- 0:01:03
      86500 -- (-1178.892) (-1178.809) (-1176.755) [-1176.353] * (-1176.284) (-1183.750) [-1178.338] (-1175.581) -- 0:01:03
      87000 -- (-1178.492) (-1176.707) [-1176.834] (-1176.802) * (-1175.910) (-1181.352) [-1176.770] (-1175.624) -- 0:01:02
      87500 -- (-1179.697) (-1176.507) [-1179.053] (-1177.957) * (-1176.790) (-1178.066) (-1179.067) [-1177.074] -- 0:01:02
      88000 -- (-1179.613) (-1175.273) (-1180.513) [-1177.518] * (-1178.645) (-1178.772) (-1181.463) [-1176.829] -- 0:01:02
      88500 -- [-1177.223] (-1175.774) (-1183.416) (-1179.886) * (-1181.547) (-1179.138) (-1181.273) [-1180.378] -- 0:01:01
      89000 -- [-1175.794] (-1175.870) (-1178.760) (-1178.477) * (-1177.198) [-1178.123] (-1179.151) (-1177.714) -- 0:01:01
      89500 -- [-1176.796] (-1180.032) (-1178.891) (-1178.788) * (-1178.400) (-1177.132) (-1180.232) [-1177.948] -- 0:01:01
      90000 -- [-1179.376] (-1180.381) (-1179.840) (-1179.007) * (-1179.588) (-1177.563) (-1176.302) [-1176.155] -- 0:01:00

      Average standard deviation of split frequencies: 0.025176

      90500 -- (-1178.331) (-1175.816) [-1177.075] (-1177.121) * (-1178.103) (-1181.615) [-1176.206] (-1177.542) -- 0:01:00
      91000 -- (-1184.488) (-1175.908) [-1180.139] (-1180.054) * (-1179.083) (-1179.274) [-1176.723] (-1177.308) -- 0:00:59
      91500 -- (-1177.485) (-1176.754) [-1179.986] (-1177.850) * (-1176.693) (-1177.905) [-1175.717] (-1177.055) -- 0:00:59
      92000 -- (-1178.473) (-1178.644) (-1179.499) [-1179.592] * (-1175.693) [-1176.804] (-1175.849) (-1178.880) -- 0:00:59
      92500 -- [-1175.841] (-1179.009) (-1177.630) (-1176.168) * (-1176.054) [-1177.723] (-1176.705) (-1179.970) -- 0:00:58
      93000 -- (-1176.172) (-1177.580) (-1175.793) [-1176.978] * (-1177.847) (-1178.765) [-1176.213] (-1177.964) -- 0:00:58
      93500 -- (-1177.544) (-1176.883) [-1176.302] (-1177.777) * [-1176.272] (-1176.729) (-1176.350) (-1175.641) -- 0:00:58
      94000 -- (-1176.778) (-1177.319) [-1177.977] (-1177.492) * (-1177.222) (-1177.427) [-1181.778] (-1176.479) -- 0:00:57
      94500 -- (-1176.200) [-1176.160] (-1179.811) (-1176.990) * (-1176.874) (-1176.825) [-1176.464] (-1179.908) -- 0:00:57
      95000 -- [-1176.588] (-1177.330) (-1176.996) (-1178.456) * (-1177.107) (-1176.556) [-1175.537] (-1178.190) -- 0:01:06

      Average standard deviation of split frequencies: 0.025916

      95500 -- (-1178.528) (-1177.106) (-1176.206) [-1178.449] * (-1177.130) [-1176.536] (-1181.915) (-1175.622) -- 0:01:06
      96000 -- [-1179.449] (-1178.169) (-1176.280) (-1175.299) * (-1177.155) (-1177.714) (-1180.430) [-1176.538] -- 0:01:05
      96500 -- (-1183.818) (-1177.532) (-1180.558) [-1175.352] * (-1178.446) [-1177.010] (-1179.497) (-1177.329) -- 0:01:05
      97000 -- (-1178.678) (-1181.439) (-1177.130) [-1176.345] * (-1178.932) (-1176.639) (-1178.733) [-1177.073] -- 0:01:05
      97500 -- (-1176.593) (-1175.650) (-1176.175) [-1176.720] * [-1178.927] (-1176.021) (-1177.280) (-1176.279) -- 0:01:04
      98000 -- (-1176.177) (-1177.536) [-1175.951] (-1176.548) * (-1179.412) [-1177.727] (-1179.258) (-1176.552) -- 0:01:04
      98500 -- [-1178.861] (-1175.996) (-1179.641) (-1176.291) * (-1180.165) (-1182.142) (-1179.929) [-1178.641] -- 0:01:04
      99000 -- (-1175.656) [-1177.498] (-1177.695) (-1176.257) * (-1176.522) [-1175.566] (-1177.578) (-1176.215) -- 0:01:03
      99500 -- (-1177.886) (-1179.388) (-1176.318) [-1176.492] * (-1177.484) (-1177.217) (-1176.730) [-1175.829] -- 0:01:03
      100000 -- (-1177.394) (-1178.823) (-1180.310) [-1180.072] * (-1178.563) (-1177.957) (-1177.038) [-1175.997] -- 0:01:02

      Average standard deviation of split frequencies: 0.022894

      100500 -- [-1179.091] (-1181.272) (-1181.579) (-1177.665) * [-1177.195] (-1179.011) (-1178.078) (-1176.123) -- 0:01:02
      101000 -- (-1177.189) [-1178.585] (-1176.655) (-1179.536) * (-1177.300) (-1176.660) [-1178.633] (-1175.963) -- 0:01:02
      101500 -- (-1176.622) (-1177.374) [-1181.007] (-1177.116) * (-1182.905) [-1176.435] (-1176.371) (-1177.447) -- 0:01:01
      102000 -- (-1177.884) [-1176.163] (-1177.382) (-1176.878) * (-1179.634) (-1175.998) (-1178.269) [-1178.971] -- 0:01:01
      102500 -- (-1177.085) (-1177.294) (-1175.952) [-1177.440] * (-1178.151) [-1177.798] (-1178.576) (-1175.824) -- 0:01:01
      103000 -- (-1176.684) (-1175.939) (-1176.973) [-1178.151] * (-1181.828) [-1175.507] (-1178.178) (-1177.526) -- 0:01:00
      103500 -- (-1176.771) [-1178.269] (-1176.045) (-1179.842) * (-1177.882) (-1177.547) (-1179.789) [-1177.215] -- 0:01:00
      104000 -- (-1178.558) (-1177.804) (-1176.638) [-1176.753] * (-1177.424) (-1176.415) (-1178.335) [-1175.770] -- 0:01:00
      104500 -- [-1177.613] (-1178.163) (-1176.324) (-1180.686) * (-1177.813) (-1176.544) [-1177.896] (-1175.354) -- 0:00:59
      105000 -- (-1176.244) [-1177.483] (-1176.740) (-1181.078) * [-1175.996] (-1176.698) (-1176.545) (-1175.282) -- 0:00:59

      Average standard deviation of split frequencies: 0.024954

      105500 -- (-1176.991) [-1176.294] (-1176.941) (-1181.169) * (-1176.967) [-1177.728] (-1179.267) (-1175.778) -- 0:00:59
      106000 -- (-1176.242) [-1177.086] (-1177.193) (-1181.318) * [-1177.794] (-1177.435) (-1179.552) (-1175.502) -- 0:00:59
      106500 -- (-1176.235) (-1177.721) [-1179.324] (-1179.622) * (-1176.021) (-1177.088) (-1181.659) [-1177.608] -- 0:00:58
      107000 -- (-1176.719) [-1176.294] (-1176.263) (-1177.575) * (-1176.383) (-1179.150) (-1180.500) [-1176.034] -- 0:00:58
      107500 -- [-1178.532] (-1178.836) (-1175.796) (-1177.502) * [-1177.076] (-1181.897) (-1178.107) (-1176.596) -- 0:00:58
      108000 -- (-1180.239) (-1178.719) (-1175.664) [-1179.556] * (-1178.430) [-1176.333] (-1175.500) (-1178.238) -- 0:00:57
      108500 -- (-1181.077) (-1177.588) [-1176.368] (-1176.568) * (-1179.916) (-1180.219) (-1175.477) [-1175.272] -- 0:00:57
      109000 -- (-1177.906) (-1180.524) (-1175.791) [-1177.090] * [-1178.543] (-1185.261) (-1177.901) (-1175.291) -- 0:00:57
      109500 -- [-1178.835] (-1180.226) (-1176.409) (-1175.843) * (-1178.067) (-1178.618) (-1177.368) [-1176.600] -- 0:00:56
      110000 -- [-1184.351] (-1180.828) (-1178.472) (-1175.627) * (-1183.773) (-1179.975) [-1182.929] (-1177.877) -- 0:00:56

      Average standard deviation of split frequencies: 0.024138

      110500 -- (-1179.592) (-1180.496) [-1175.886] (-1175.631) * (-1179.963) (-1177.003) [-1182.423] (-1176.143) -- 0:00:56
      111000 -- (-1179.692) (-1179.556) (-1176.842) [-1177.312] * (-1180.295) (-1177.801) [-1179.300] (-1179.552) -- 0:01:04
      111500 -- (-1179.406) (-1177.435) [-1176.610] (-1177.925) * (-1179.016) (-1177.640) [-1180.620] (-1177.590) -- 0:01:03
      112000 -- (-1179.469) [-1177.988] (-1179.534) (-1177.827) * [-1178.076] (-1179.604) (-1180.000) (-1177.036) -- 0:01:03
      112500 -- (-1176.815) (-1181.420) [-1178.001] (-1177.780) * (-1176.624) (-1181.350) (-1177.526) [-1176.501] -- 0:01:03
      113000 -- [-1175.971] (-1178.559) (-1175.980) (-1175.922) * (-1175.701) (-1178.428) (-1179.513) [-1176.480] -- 0:01:02
      113500 -- [-1176.154] (-1180.685) (-1177.764) (-1177.822) * (-1180.074) (-1178.296) (-1177.823) [-1177.386] -- 0:01:02
      114000 -- (-1177.236) [-1178.667] (-1177.621) (-1180.175) * (-1180.312) [-1178.296] (-1179.670) (-1176.271) -- 0:01:02
      114500 -- (-1180.157) [-1177.580] (-1178.380) (-1178.924) * (-1181.138) [-1178.084] (-1179.040) (-1176.051) -- 0:01:01
      115000 -- (-1179.412) (-1184.336) [-1177.354] (-1181.893) * (-1179.964) (-1176.947) (-1181.796) [-1176.966] -- 0:01:01

      Average standard deviation of split frequencies: 0.021900

      115500 -- (-1176.495) (-1183.737) [-1178.265] (-1175.464) * [-1176.571] (-1177.668) (-1179.328) (-1176.800) -- 0:01:01
      116000 -- [-1175.950] (-1177.266) (-1176.862) (-1180.270) * (-1178.934) (-1178.585) [-1176.849] (-1175.906) -- 0:01:00
      116500 -- (-1177.240) (-1176.368) [-1177.075] (-1179.406) * (-1176.927) [-1178.079] (-1178.594) (-1176.199) -- 0:01:00
      117000 -- (-1180.837) (-1177.827) [-1179.121] (-1183.859) * [-1177.630] (-1177.857) (-1177.722) (-1176.885) -- 0:01:00
      117500 -- (-1178.219) (-1178.663) [-1179.597] (-1182.694) * [-1178.694] (-1177.359) (-1177.821) (-1178.093) -- 0:01:00
      118000 -- [-1179.065] (-1181.387) (-1181.384) (-1180.603) * [-1177.715] (-1177.726) (-1177.951) (-1178.861) -- 0:00:59
      118500 -- (-1176.919) (-1179.170) [-1177.002] (-1176.460) * (-1175.753) (-1182.573) (-1181.317) [-1177.119] -- 0:00:59
      119000 -- (-1176.107) [-1176.063] (-1177.104) (-1176.408) * (-1177.508) (-1178.853) (-1179.260) [-1178.817] -- 0:00:59
      119500 -- [-1176.809] (-1176.209) (-1188.486) (-1177.830) * (-1177.253) (-1178.086) (-1180.433) [-1182.121] -- 0:00:58
      120000 -- [-1177.018] (-1178.896) (-1179.060) (-1177.343) * [-1177.186] (-1176.918) (-1180.441) (-1181.350) -- 0:00:58

      Average standard deviation of split frequencies: 0.021487

      120500 -- (-1177.654) [-1178.660] (-1176.858) (-1177.395) * (-1177.369) (-1177.561) [-1176.344] (-1177.115) -- 0:00:58
      121000 -- (-1181.753) (-1176.188) (-1176.431) [-1177.362] * [-1176.269] (-1178.084) (-1176.137) (-1175.981) -- 0:00:58
      121500 -- (-1182.057) [-1176.590] (-1176.735) (-1176.884) * (-1176.079) (-1178.868) [-1176.366] (-1178.200) -- 0:00:57
      122000 -- (-1180.919) (-1177.537) [-1177.777] (-1178.898) * (-1175.736) (-1178.386) [-1177.284] (-1175.980) -- 0:00:57
      122500 -- [-1178.225] (-1176.820) (-1178.875) (-1182.112) * (-1175.651) [-1179.137] (-1175.794) (-1177.052) -- 0:00:57
      123000 -- (-1175.585) [-1175.931] (-1176.022) (-1182.772) * (-1177.637) [-1177.517] (-1178.526) (-1179.149) -- 0:00:57
      123500 -- (-1175.638) (-1177.837) (-1175.529) [-1175.356] * (-1178.482) (-1177.284) [-1176.778] (-1176.645) -- 0:00:56
      124000 -- [-1175.979] (-1175.477) (-1179.158) (-1177.600) * (-1177.342) (-1178.064) (-1176.908) [-1176.189] -- 0:00:56
      124500 -- (-1177.163) [-1175.233] (-1179.249) (-1178.209) * (-1178.903) (-1178.076) [-1178.073] (-1178.997) -- 0:00:56
      125000 -- (-1176.920) [-1175.232] (-1177.826) (-1177.323) * (-1179.822) (-1179.454) [-1178.887] (-1179.603) -- 0:00:56

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-1176.725) (-1176.919) [-1178.921] (-1179.663) * [-1177.984] (-1178.974) (-1175.175) (-1178.586) -- 0:00:55
      126000 -- (-1175.953) [-1177.050] (-1179.210) (-1180.262) * (-1179.345) [-1181.621] (-1176.694) (-1179.785) -- 0:00:55
      126500 -- (-1179.362) [-1176.498] (-1177.878) (-1179.425) * [-1175.794] (-1178.146) (-1175.300) (-1178.589) -- 0:00:55
      127000 -- [-1176.998] (-1176.369) (-1178.747) (-1178.163) * [-1176.655] (-1176.690) (-1176.797) (-1180.526) -- 0:01:01
      127500 -- [-1179.206] (-1176.072) (-1178.018) (-1179.095) * (-1179.686) (-1177.446) [-1176.674] (-1181.688) -- 0:01:01
      128000 -- (-1177.453) (-1176.553) (-1177.746) [-1175.699] * (-1176.645) (-1183.173) [-1175.221] (-1181.436) -- 0:01:01
      128500 -- (-1177.444) [-1176.716] (-1179.022) (-1177.522) * (-1176.743) (-1179.322) (-1175.325) [-1176.821] -- 0:01:01
      129000 -- [-1176.507] (-1177.246) (-1180.887) (-1176.145) * (-1178.343) (-1180.777) (-1175.298) [-1178.355] -- 0:01:00
      129500 -- [-1175.611] (-1179.068) (-1178.607) (-1175.835) * [-1176.969] (-1180.740) (-1181.534) (-1176.981) -- 0:01:00
      130000 -- (-1178.043) [-1177.439] (-1177.811) (-1176.169) * (-1175.600) (-1179.889) (-1176.556) [-1177.954] -- 0:01:00

      Average standard deviation of split frequencies: 0.022596

      130500 -- (-1176.577) (-1179.385) [-1177.011] (-1175.767) * [-1175.978] (-1176.148) (-1180.421) (-1176.258) -- 0:00:59
      131000 -- (-1177.502) (-1178.222) [-1179.580] (-1177.012) * [-1175.755] (-1177.299) (-1177.319) (-1176.091) -- 0:00:59
      131500 -- (-1178.759) [-1176.588] (-1179.952) (-1176.766) * (-1179.525) (-1178.082) (-1179.567) [-1179.481] -- 0:00:59
      132000 -- (-1179.696) (-1176.670) (-1178.241) [-1182.023] * (-1175.368) [-1178.611] (-1179.645) (-1177.514) -- 0:00:59
      132500 -- (-1176.843) (-1179.619) (-1176.330) [-1179.220] * (-1178.385) [-1178.033] (-1177.125) (-1179.717) -- 0:00:58
      133000 -- [-1177.865] (-1176.998) (-1179.272) (-1177.731) * (-1178.594) (-1177.791) [-1177.846] (-1179.371) -- 0:00:58
      133500 -- [-1178.056] (-1177.060) (-1176.692) (-1178.271) * [-1180.789] (-1177.427) (-1177.371) (-1177.226) -- 0:00:58
      134000 -- (-1177.822) (-1177.417) [-1180.584] (-1177.403) * (-1180.204) (-1178.132) [-1182.322] (-1177.560) -- 0:00:58
      134500 -- (-1177.889) [-1177.734] (-1176.597) (-1177.720) * (-1177.946) (-1177.494) (-1181.773) [-1177.038] -- 0:00:57
      135000 -- [-1178.544] (-1180.685) (-1176.314) (-1177.184) * [-1176.372] (-1176.496) (-1179.207) (-1176.772) -- 0:00:57

      Average standard deviation of split frequencies: 0.022915

      135500 -- [-1179.260] (-1178.199) (-1177.825) (-1178.798) * (-1175.948) (-1176.983) [-1176.567] (-1176.772) -- 0:00:57
      136000 -- (-1177.355) (-1177.875) [-1176.111] (-1179.818) * (-1177.293) (-1176.364) (-1176.443) [-1176.257] -- 0:00:57
      136500 -- (-1178.645) (-1179.229) [-1177.572] (-1177.406) * (-1179.568) [-1175.755] (-1176.579) (-1178.615) -- 0:00:56
      137000 -- (-1179.699) (-1177.175) (-1181.184) [-1176.879] * [-1175.641] (-1175.748) (-1176.841) (-1178.420) -- 0:00:56
      137500 -- (-1179.228) (-1177.898) [-1177.336] (-1178.087) * (-1178.660) (-1178.322) (-1178.564) [-1181.222] -- 0:00:56
      138000 -- (-1180.252) (-1177.827) (-1178.931) [-1177.575] * [-1176.631] (-1176.259) (-1177.047) (-1181.624) -- 0:00:56
      138500 -- (-1177.999) (-1179.504) [-1178.504] (-1176.265) * (-1181.414) (-1176.259) (-1176.207) [-1179.910] -- 0:00:55
      139000 -- (-1177.468) (-1178.262) [-1178.976] (-1176.734) * (-1177.434) (-1176.643) [-1177.368] (-1178.327) -- 0:00:55
      139500 -- [-1177.017] (-1176.256) (-1177.443) (-1176.642) * (-1176.518) (-1176.617) (-1178.577) [-1175.723] -- 0:00:55
      140000 -- (-1177.099) [-1176.345] (-1176.863) (-1177.135) * (-1178.054) (-1176.666) (-1175.840) [-1176.637] -- 0:00:55

      Average standard deviation of split frequencies: 0.021290

      140500 -- (-1176.704) (-1177.147) [-1180.891] (-1177.059) * (-1177.115) (-1177.851) (-1176.596) [-1177.311] -- 0:00:55
      141000 -- (-1177.754) [-1177.050] (-1182.212) (-1178.049) * [-1175.631] (-1180.818) (-1175.808) (-1177.595) -- 0:00:54
      141500 -- (-1177.479) (-1176.607) [-1176.663] (-1177.081) * (-1178.491) (-1178.433) (-1176.295) [-1176.432] -- 0:00:54
      142000 -- (-1179.570) (-1176.450) [-1178.085] (-1178.517) * (-1179.518) (-1177.894) (-1176.434) [-1177.143] -- 0:00:54
      142500 -- (-1178.251) (-1175.925) (-1177.747) [-1177.231] * [-1177.963] (-1177.918) (-1176.873) (-1178.143) -- 0:00:54
      143000 -- (-1178.762) (-1178.441) (-1180.637) [-1179.044] * (-1177.153) (-1177.238) [-1179.191] (-1179.841) -- 0:00:53
      143500 -- (-1178.822) [-1178.600] (-1181.183) (-1178.023) * (-1177.371) [-1178.651] (-1178.445) (-1178.751) -- 0:00:59
      144000 -- (-1178.052) (-1178.033) [-1179.317] (-1178.815) * (-1183.366) (-1181.360) (-1177.014) [-1176.460] -- 0:00:59
      144500 -- [-1176.521] (-1176.495) (-1181.518) (-1177.891) * (-1178.902) (-1183.463) [-1177.035] (-1176.392) -- 0:00:59
      145000 -- [-1176.224] (-1180.182) (-1178.262) (-1178.037) * [-1176.026] (-1180.111) (-1177.194) (-1175.676) -- 0:00:58

      Average standard deviation of split frequencies: 0.021462

      145500 -- (-1176.283) (-1179.018) [-1179.101] (-1177.018) * (-1175.786) (-1177.235) (-1175.952) [-1176.154] -- 0:00:58
      146000 -- [-1176.633] (-1179.511) (-1177.904) (-1177.151) * (-1176.276) (-1178.361) [-1176.475] (-1176.708) -- 0:00:58
      146500 -- (-1177.890) (-1176.939) [-1177.344] (-1176.705) * [-1176.595] (-1183.501) (-1179.091) (-1177.165) -- 0:00:58
      147000 -- (-1175.416) (-1179.497) [-1179.974] (-1176.712) * [-1176.610] (-1181.328) (-1181.755) (-1176.623) -- 0:00:58
      147500 -- (-1175.609) [-1176.379] (-1176.234) (-1177.724) * (-1179.984) [-1176.452] (-1183.484) (-1175.633) -- 0:00:57
      148000 -- (-1178.463) (-1176.206) (-1175.503) [-1177.454] * (-1180.882) (-1176.659) (-1177.249) [-1175.580] -- 0:00:57
      148500 -- (-1177.171) [-1176.048] (-1175.475) (-1177.924) * (-1180.742) (-1176.955) (-1179.309) [-1177.246] -- 0:00:57
      149000 -- (-1177.260) [-1175.725] (-1181.228) (-1177.397) * (-1176.903) (-1178.254) [-1177.752] (-1178.557) -- 0:00:57
      149500 -- [-1177.464] (-1175.724) (-1179.345) (-1179.538) * (-1175.119) (-1179.674) [-1179.507] (-1175.760) -- 0:00:56
      150000 -- [-1176.857] (-1178.154) (-1179.302) (-1177.757) * (-1176.566) (-1178.269) (-1181.100) [-1179.102] -- 0:00:56

      Average standard deviation of split frequencies: 0.020245

      150500 -- (-1177.537) (-1176.358) [-1178.169] (-1175.749) * (-1178.595) (-1176.308) (-1179.329) [-1176.468] -- 0:00:56
      151000 -- (-1176.895) (-1176.493) (-1178.319) [-1176.922] * (-1178.324) (-1181.144) [-1181.082] (-1177.140) -- 0:00:56
      151500 -- (-1177.661) (-1178.213) (-1177.567) [-1175.908] * [-1178.064] (-1180.207) (-1178.326) (-1178.590) -- 0:00:56
      152000 -- [-1177.696] (-1178.515) (-1177.102) (-1180.457) * [-1177.151] (-1179.772) (-1178.453) (-1178.233) -- 0:00:55
      152500 -- (-1179.731) (-1176.378) [-1178.104] (-1182.135) * (-1179.159) (-1176.507) (-1178.689) [-1177.952] -- 0:00:55
      153000 -- (-1179.497) [-1180.653] (-1177.523) (-1179.971) * (-1177.000) (-1177.554) (-1177.032) [-1176.324] -- 0:00:55
      153500 -- (-1184.435) (-1179.265) [-1177.523] (-1178.567) * (-1175.323) (-1176.191) (-1177.153) [-1177.483] -- 0:00:55
      154000 -- (-1180.624) (-1177.155) (-1177.698) [-1180.436] * (-1176.142) (-1178.874) [-1179.659] (-1181.098) -- 0:00:54
      154500 -- (-1177.089) (-1177.720) [-1177.058] (-1179.433) * (-1176.811) [-1177.425] (-1179.170) (-1177.813) -- 0:00:54
      155000 -- (-1176.069) (-1178.552) [-1177.528] (-1177.664) * (-1176.653) [-1177.927] (-1180.651) (-1176.256) -- 0:00:54

      Average standard deviation of split frequencies: 0.018299

      155500 -- [-1180.012] (-1176.198) (-1176.344) (-1177.794) * (-1176.764) [-1176.135] (-1177.788) (-1175.775) -- 0:00:54
      156000 -- (-1176.423) (-1178.585) (-1178.427) [-1177.109] * (-1176.349) [-1175.624] (-1175.983) (-1175.569) -- 0:00:54
      156500 -- (-1176.721) [-1177.490] (-1177.049) (-1178.639) * (-1176.543) (-1176.378) [-1175.280] (-1176.808) -- 0:00:53
      157000 -- (-1181.060) [-1177.457] (-1176.415) (-1175.710) * [-1176.157] (-1179.469) (-1175.893) (-1176.556) -- 0:00:53
      157500 -- (-1177.643) (-1176.475) (-1177.892) [-1175.693] * [-1176.170] (-1180.849) (-1176.673) (-1177.180) -- 0:00:53
      158000 -- [-1176.681] (-1177.967) (-1179.425) (-1176.558) * (-1175.724) (-1176.354) [-1180.896] (-1177.856) -- 0:00:53
      158500 -- (-1178.218) [-1178.309] (-1178.949) (-1175.755) * (-1176.640) (-1180.333) [-1175.526] (-1176.756) -- 0:00:53
      159000 -- (-1177.721) (-1179.889) (-1178.719) [-1179.605] * (-1177.875) (-1179.152) [-1178.782] (-1181.863) -- 0:00:52
      159500 -- (-1177.246) [-1179.484] (-1178.687) (-1179.504) * [-1180.564] (-1178.041) (-1177.618) (-1177.206) -- 0:00:52
      160000 -- (-1179.572) (-1182.754) [-1177.183] (-1181.485) * [-1178.618] (-1177.602) (-1179.145) (-1176.505) -- 0:00:57

      Average standard deviation of split frequencies: 0.018093

      160500 -- (-1176.928) (-1182.677) (-1181.259) [-1178.510] * (-1178.698) [-1176.942] (-1180.203) (-1178.078) -- 0:00:57
      161000 -- [-1175.471] (-1180.925) (-1185.123) (-1175.747) * (-1176.510) (-1177.042) [-1178.098] (-1180.186) -- 0:00:57
      161500 -- (-1176.317) (-1180.117) (-1176.727) [-1180.410] * (-1176.838) [-1178.095] (-1176.998) (-1180.964) -- 0:00:57
      162000 -- (-1176.451) [-1176.063] (-1177.007) (-1180.374) * (-1178.639) (-1177.152) [-1177.137] (-1179.606) -- 0:00:56
      162500 -- (-1176.625) (-1176.884) (-1177.404) [-1177.432] * (-1179.323) [-1178.651] (-1180.160) (-1178.139) -- 0:00:56
      163000 -- (-1178.226) (-1176.911) [-1178.225] (-1177.059) * [-1179.061] (-1180.859) (-1180.313) (-1176.657) -- 0:00:56
      163500 -- [-1180.716] (-1179.007) (-1181.989) (-1177.041) * (-1177.699) (-1179.596) (-1177.376) [-1179.000] -- 0:00:56
      164000 -- (-1176.272) (-1179.742) (-1181.431) [-1177.043] * [-1178.202] (-1177.710) (-1181.793) (-1179.190) -- 0:00:56
      164500 -- (-1175.779) [-1178.745] (-1176.149) (-1176.059) * (-1179.809) (-1176.795) [-1176.853] (-1177.744) -- 0:00:55
      165000 -- (-1175.641) (-1181.053) (-1176.847) [-1176.306] * [-1178.465] (-1178.339) (-1182.647) (-1177.860) -- 0:00:55

      Average standard deviation of split frequencies: 0.018616

      165500 -- [-1176.573] (-1181.478) (-1176.410) (-1176.094) * (-1175.774) (-1175.547) [-1179.081] (-1178.456) -- 0:00:55
      166000 -- [-1176.835] (-1177.798) (-1178.267) (-1175.494) * (-1177.957) (-1177.337) (-1179.032) [-1179.635] -- 0:00:55
      166500 -- (-1177.928) (-1179.180) [-1178.521] (-1176.139) * (-1176.337) [-1176.600] (-1175.665) (-1177.146) -- 0:00:55
      167000 -- (-1176.026) (-1179.356) (-1177.604) [-1176.375] * (-1177.841) (-1176.916) [-1175.778] (-1177.343) -- 0:00:54
      167500 -- (-1177.103) [-1179.109] (-1181.977) (-1176.802) * [-1176.344] (-1177.998) (-1177.148) (-1179.228) -- 0:00:54
      168000 -- (-1175.325) [-1180.184] (-1177.917) (-1175.970) * (-1177.755) (-1177.764) [-1177.249] (-1180.917) -- 0:00:54
      168500 -- (-1176.512) (-1176.424) (-1176.015) [-1176.522] * (-1177.616) (-1179.022) [-1175.965] (-1176.718) -- 0:00:54
      169000 -- [-1177.250] (-1175.968) (-1176.658) (-1177.820) * (-1179.271) (-1176.718) [-1175.915] (-1179.782) -- 0:00:54
      169500 -- (-1175.734) (-1179.401) [-1176.107] (-1177.189) * (-1175.890) (-1175.818) (-1177.149) [-1179.696] -- 0:00:53
      170000 -- (-1178.729) (-1177.092) [-1176.199] (-1176.796) * (-1177.291) [-1175.673] (-1178.010) (-1179.813) -- 0:00:53

      Average standard deviation of split frequencies: 0.019028

      170500 -- [-1177.815] (-1178.403) (-1175.529) (-1180.380) * [-1179.149] (-1175.865) (-1176.989) (-1180.951) -- 0:00:53
      171000 -- (-1178.831) [-1182.167] (-1175.532) (-1181.223) * (-1178.825) (-1179.841) (-1176.816) [-1181.909] -- 0:00:53
      171500 -- (-1176.491) (-1183.261) [-1175.521] (-1176.520) * (-1177.381) (-1178.110) [-1176.774] (-1179.419) -- 0:00:53
      172000 -- (-1177.595) [-1178.752] (-1175.664) (-1176.756) * (-1181.205) (-1176.543) (-1175.449) [-1177.474] -- 0:00:52
      172500 -- (-1178.015) (-1178.222) [-1176.026] (-1180.975) * (-1177.949) (-1181.342) (-1177.859) [-1177.924] -- 0:00:52
      173000 -- (-1182.362) (-1176.063) (-1175.700) [-1181.086] * (-1178.173) [-1181.782] (-1177.538) (-1177.531) -- 0:00:52
      173500 -- (-1181.305) (-1176.479) (-1177.299) [-1178.276] * (-1177.973) [-1182.045] (-1178.047) (-1176.870) -- 0:00:52
      174000 -- (-1179.873) (-1176.757) (-1178.417) [-1178.948] * (-1176.473) (-1177.873) (-1178.404) [-1178.006] -- 0:00:52
      174500 -- (-1178.023) (-1175.602) [-1176.523] (-1181.462) * [-1179.521] (-1179.001) (-1176.676) (-1177.176) -- 0:00:52
      175000 -- [-1176.422] (-1175.640) (-1178.031) (-1178.263) * (-1176.446) (-1177.930) [-1175.823] (-1180.158) -- 0:00:51

      Average standard deviation of split frequencies: 0.019537

      175500 -- (-1176.011) (-1175.972) (-1177.992) [-1176.119] * (-1177.759) [-1177.012] (-1176.900) (-1179.048) -- 0:00:51
      176000 -- [-1175.579] (-1175.972) (-1182.795) (-1179.919) * (-1177.140) [-1177.303] (-1177.111) (-1178.211) -- 0:00:51
      176500 -- (-1177.163) (-1180.438) [-1177.637] (-1179.387) * (-1181.069) (-1177.543) (-1176.145) [-1176.700] -- 0:00:55
      177000 -- (-1175.672) [-1183.005] (-1179.134) (-1180.907) * (-1187.601) [-1179.681] (-1179.357) (-1177.528) -- 0:00:55
      177500 -- (-1181.294) [-1180.483] (-1179.529) (-1175.655) * (-1180.863) [-1177.991] (-1176.741) (-1176.426) -- 0:00:55
      178000 -- [-1182.041] (-1179.853) (-1179.153) (-1178.949) * (-1181.197) [-1178.732] (-1176.000) (-1177.441) -- 0:00:55
      178500 -- (-1181.258) (-1183.638) [-1178.297] (-1179.245) * (-1179.948) (-1180.914) [-1178.543] (-1180.669) -- 0:00:55
      179000 -- (-1179.345) [-1179.092] (-1178.740) (-1176.912) * (-1176.823) [-1179.871] (-1178.588) (-1182.804) -- 0:00:55
      179500 -- (-1180.953) (-1178.271) [-1175.172] (-1180.505) * (-1178.114) (-1179.935) (-1176.924) [-1177.623] -- 0:00:54
      180000 -- (-1181.693) [-1176.390] (-1177.889) (-1178.817) * (-1175.978) (-1180.911) (-1180.462) [-1176.647] -- 0:00:54

      Average standard deviation of split frequencies: 0.018700

      180500 -- (-1177.355) (-1176.822) (-1178.783) [-1176.910] * (-1178.773) (-1181.814) (-1181.161) [-1177.146] -- 0:00:54
      181000 -- (-1177.984) (-1179.760) [-1178.348] (-1176.545) * (-1177.019) [-1178.640] (-1177.276) (-1177.176) -- 0:00:54
      181500 -- (-1179.476) (-1178.260) [-1176.041] (-1181.769) * (-1178.001) [-1180.711] (-1178.330) (-1181.894) -- 0:00:54
      182000 -- (-1177.694) (-1177.358) [-1177.258] (-1178.621) * (-1178.134) (-1179.977) (-1176.096) [-1176.659] -- 0:00:53
      182500 -- (-1179.259) (-1176.922) (-1177.138) [-1178.928] * [-1177.173] (-1176.948) (-1177.268) (-1179.854) -- 0:00:53
      183000 -- [-1177.650] (-1177.544) (-1180.905) (-1176.991) * (-1177.940) [-1177.684] (-1178.583) (-1180.214) -- 0:00:53
      183500 -- (-1176.393) [-1181.310] (-1176.622) (-1177.339) * (-1179.914) (-1178.184) [-1176.601] (-1180.114) -- 0:00:53
      184000 -- [-1176.575] (-1176.553) (-1177.102) (-1177.190) * (-1177.280) [-1179.379] (-1176.854) (-1181.423) -- 0:00:53
      184500 -- [-1177.464] (-1177.191) (-1177.359) (-1177.067) * [-1178.646] (-1179.810) (-1177.078) (-1176.124) -- 0:00:53
      185000 -- (-1176.573) (-1176.839) (-1186.290) [-1177.314] * (-1177.184) [-1177.287] (-1177.234) (-1176.387) -- 0:00:52

      Average standard deviation of split frequencies: 0.016807

      185500 -- [-1176.532] (-1175.691) (-1183.796) (-1176.185) * (-1176.317) [-1177.241] (-1181.029) (-1180.902) -- 0:00:52
      186000 -- (-1179.643) [-1176.243] (-1180.181) (-1176.295) * (-1177.344) (-1177.810) (-1176.091) [-1177.564] -- 0:00:52
      186500 -- [-1177.909] (-1178.529) (-1177.705) (-1178.252) * (-1176.297) (-1179.474) [-1177.480] (-1177.983) -- 0:00:52
      187000 -- [-1178.158] (-1177.017) (-1178.974) (-1178.271) * (-1179.280) (-1178.002) (-1177.995) [-1176.506] -- 0:00:52
      187500 -- (-1175.811) (-1178.343) (-1177.452) [-1176.914] * (-1177.947) (-1177.608) (-1178.471) [-1176.559] -- 0:00:52
      188000 -- (-1177.821) (-1177.418) [-1180.765] (-1177.431) * [-1177.112] (-1180.637) (-1178.471) (-1180.022) -- 0:00:51
      188500 -- (-1176.900) (-1179.521) (-1180.270) [-1177.219] * (-1177.292) (-1176.124) [-1178.702] (-1176.918) -- 0:00:51
      189000 -- (-1180.189) [-1177.740] (-1180.238) (-1177.593) * (-1183.179) [-1175.629] (-1180.131) (-1179.292) -- 0:00:51
      189500 -- (-1176.281) [-1179.482] (-1182.600) (-1177.530) * [-1185.898] (-1176.746) (-1177.430) (-1178.766) -- 0:00:51
      190000 -- (-1175.594) (-1178.693) [-1181.654] (-1176.423) * (-1182.588) (-1177.407) [-1177.775] (-1179.951) -- 0:00:51

      Average standard deviation of split frequencies: 0.014544

      190500 -- [-1176.644] (-1178.693) (-1181.718) (-1177.392) * (-1178.070) [-1178.123] (-1176.827) (-1178.881) -- 0:00:50
      191000 -- (-1180.544) (-1178.855) [-1178.095] (-1177.451) * (-1176.758) [-1177.034] (-1178.511) (-1179.505) -- 0:00:50
      191500 -- [-1182.439] (-1178.562) (-1179.710) (-1178.557) * (-1177.791) [-1177.636] (-1177.412) (-1181.325) -- 0:00:50
      192000 -- (-1178.202) [-1178.725] (-1179.331) (-1179.433) * (-1176.562) (-1177.105) (-1180.479) [-1177.435] -- 0:00:50
      192500 -- (-1177.915) (-1181.550) [-1176.654] (-1176.844) * (-1176.372) (-1178.689) [-1175.653] (-1178.604) -- 0:00:50
      193000 -- [-1177.430] (-1177.556) (-1177.143) (-1177.703) * [-1176.445] (-1178.697) (-1178.733) (-1176.136) -- 0:00:54
      193500 -- (-1177.520) (-1181.384) [-1176.470] (-1176.618) * (-1179.532) [-1176.033] (-1176.387) (-1179.919) -- 0:00:54
      194000 -- (-1179.788) (-1178.034) (-1176.696) [-1175.918] * [-1180.183] (-1176.083) (-1176.099) (-1178.549) -- 0:00:54
      194500 -- (-1178.283) [-1178.878] (-1179.793) (-1176.089) * (-1177.259) (-1177.480) (-1175.250) [-1177.228] -- 0:00:53
      195000 -- (-1180.309) [-1177.705] (-1179.353) (-1176.037) * (-1176.605) (-1178.516) [-1175.765] (-1178.312) -- 0:00:53

      Average standard deviation of split frequencies: 0.015421

      195500 -- (-1181.940) (-1182.086) [-1182.009] (-1176.209) * (-1178.454) [-1176.967] (-1175.416) (-1181.383) -- 0:00:53
      196000 -- (-1182.754) (-1177.435) (-1176.594) [-1176.131] * [-1178.177] (-1176.974) (-1176.027) (-1178.123) -- 0:00:53
      196500 -- (-1182.583) [-1176.385] (-1178.615) (-1176.099) * (-1179.570) [-1177.348] (-1176.188) (-1176.949) -- 0:00:53
      197000 -- (-1180.057) [-1176.010] (-1175.630) (-1176.059) * (-1178.092) (-1178.761) [-1175.201] (-1176.841) -- 0:00:52
      197500 -- (-1180.132) [-1176.708] (-1180.127) (-1175.763) * (-1182.288) (-1180.471) (-1177.925) [-1176.920] -- 0:00:52
      198000 -- (-1177.781) (-1178.851) (-1175.590) [-1175.278] * [-1176.684] (-1179.070) (-1178.766) (-1177.644) -- 0:00:52
      198500 -- [-1177.363] (-1177.055) (-1175.807) (-1176.865) * [-1176.781] (-1180.335) (-1177.085) (-1175.855) -- 0:00:52
      199000 -- (-1177.926) (-1181.019) [-1176.665] (-1179.636) * [-1176.781] (-1175.629) (-1176.393) (-1175.568) -- 0:00:52
      199500 -- [-1180.105] (-1177.966) (-1176.072) (-1177.922) * (-1176.670) (-1177.405) (-1177.699) [-1175.679] -- 0:00:52
      200000 -- (-1181.447) [-1177.361] (-1175.547) (-1178.601) * (-1177.040) [-1177.455] (-1180.971) (-1181.133) -- 0:00:51

      Average standard deviation of split frequencies: 0.016168

      200500 -- (-1178.739) (-1177.432) [-1176.172] (-1178.523) * [-1176.583] (-1176.887) (-1177.452) (-1176.914) -- 0:00:51
      201000 -- (-1178.889) [-1177.567] (-1179.421) (-1177.351) * (-1177.421) (-1176.889) [-1177.030] (-1178.165) -- 0:00:51
      201500 -- (-1178.144) (-1177.562) (-1185.400) [-1175.598] * (-1175.712) [-1176.619] (-1178.852) (-1175.445) -- 0:00:51
      202000 -- (-1180.439) [-1176.746] (-1189.227) (-1175.521) * (-1178.144) (-1175.948) [-1175.586] (-1175.531) -- 0:00:51
      202500 -- (-1176.589) (-1181.048) (-1177.874) [-1175.315] * (-1177.562) [-1175.832] (-1176.305) (-1177.191) -- 0:00:51
      203000 -- [-1178.180] (-1179.572) (-1178.818) (-1177.194) * (-1179.047) (-1175.676) [-1178.255] (-1178.057) -- 0:00:51
      203500 -- [-1177.610] (-1179.087) (-1178.611) (-1176.679) * (-1179.421) [-1176.485] (-1179.589) (-1177.094) -- 0:00:50
      204000 -- (-1177.322) [-1177.894] (-1178.411) (-1179.167) * (-1179.768) [-1176.458] (-1177.582) (-1179.238) -- 0:00:50
      204500 -- (-1176.877) (-1177.594) (-1178.485) [-1176.459] * (-1176.366) [-1176.803] (-1176.319) (-1177.347) -- 0:00:50
      205000 -- (-1176.486) [-1181.271] (-1177.350) (-1177.299) * [-1176.653] (-1182.679) (-1176.817) (-1176.127) -- 0:00:50

      Average standard deviation of split frequencies: 0.015346

      205500 -- [-1176.614] (-1179.119) (-1178.508) (-1177.639) * (-1187.477) [-1177.688] (-1178.678) (-1175.690) -- 0:00:50
      206000 -- (-1176.675) (-1181.755) (-1179.358) [-1176.038] * [-1177.504] (-1180.186) (-1178.842) (-1179.168) -- 0:00:50
      206500 -- (-1176.739) (-1177.272) (-1178.845) [-1177.238] * (-1177.255) [-1179.356] (-1176.985) (-1176.926) -- 0:00:49
      207000 -- (-1176.522) [-1177.411] (-1176.877) (-1175.875) * [-1184.071] (-1178.802) (-1179.836) (-1176.975) -- 0:00:49
      207500 -- [-1178.631] (-1178.237) (-1178.522) (-1176.751) * (-1184.766) (-1178.426) [-1180.376] (-1178.644) -- 0:00:49
      208000 -- (-1178.345) [-1178.876] (-1177.383) (-1175.646) * (-1177.299) (-1178.840) (-1178.234) [-1179.807] -- 0:00:49
      208500 -- (-1176.824) (-1181.588) (-1177.994) [-1177.573] * (-1177.731) (-1177.267) (-1176.791) [-1179.063] -- 0:00:49
      209000 -- (-1176.945) (-1175.936) (-1176.776) [-1177.212] * (-1177.205) (-1175.473) [-1177.565] (-1180.505) -- 0:00:52
      209500 -- (-1175.222) [-1176.219] (-1178.702) (-1177.136) * [-1177.625] (-1176.334) (-1178.625) (-1177.318) -- 0:00:52
      210000 -- (-1176.514) (-1177.526) [-1177.581] (-1176.799) * [-1177.697] (-1176.473) (-1178.584) (-1176.187) -- 0:00:52

      Average standard deviation of split frequencies: 0.014084

      210500 -- (-1175.858) (-1179.010) [-1176.535] (-1177.187) * (-1176.187) (-1177.450) [-1178.971] (-1177.423) -- 0:00:52
      211000 -- [-1178.078] (-1182.173) (-1176.534) (-1177.078) * (-1177.312) (-1176.349) [-1177.312] (-1178.890) -- 0:00:52
      211500 -- [-1177.386] (-1180.891) (-1178.402) (-1177.637) * (-1177.965) [-1176.226] (-1180.879) (-1176.702) -- 0:00:52
      212000 -- [-1177.721] (-1181.682) (-1178.141) (-1178.097) * (-1176.988) [-1176.115] (-1179.862) (-1179.955) -- 0:00:52
      212500 -- [-1177.563] (-1177.472) (-1176.392) (-1175.401) * (-1181.334) (-1175.512) [-1176.317] (-1178.315) -- 0:00:51
      213000 -- (-1175.998) [-1179.981] (-1176.666) (-1178.564) * (-1176.788) [-1176.510] (-1177.977) (-1179.118) -- 0:00:51
      213500 -- (-1177.164) [-1176.117] (-1177.020) (-1180.511) * (-1177.773) (-1176.856) [-1178.120] (-1175.905) -- 0:00:51
      214000 -- (-1181.416) (-1176.456) (-1175.247) [-1177.870] * (-1177.329) (-1175.834) [-1177.705] (-1178.395) -- 0:00:51
      214500 -- (-1188.784) [-1176.980] (-1175.301) (-1176.239) * (-1179.792) (-1178.108) (-1179.343) [-1176.056] -- 0:00:51
      215000 -- (-1183.236) (-1178.041) (-1176.001) [-1176.635] * (-1180.053) [-1175.914] (-1178.278) (-1178.556) -- 0:00:51

      Average standard deviation of split frequencies: 0.014122

      215500 -- [-1176.961] (-1177.339) (-1183.551) (-1177.404) * (-1177.837) (-1180.199) (-1179.667) [-1175.713] -- 0:00:50
      216000 -- (-1177.228) (-1184.967) (-1183.388) [-1177.557] * (-1178.586) [-1176.736] (-1177.401) (-1180.362) -- 0:00:50
      216500 -- (-1178.394) [-1182.668] (-1177.542) (-1177.786) * (-1179.180) [-1176.787] (-1179.522) (-1178.832) -- 0:00:50
      217000 -- (-1177.167) [-1176.625] (-1179.251) (-1177.203) * (-1178.426) (-1176.556) [-1181.173] (-1175.933) -- 0:00:50
      217500 -- (-1177.566) (-1182.751) [-1178.998] (-1176.864) * (-1179.516) (-1177.209) [-1176.439] (-1177.212) -- 0:00:50
      218000 -- (-1179.702) (-1178.392) (-1179.217) [-1176.719] * [-1176.756] (-1175.798) (-1179.895) (-1177.743) -- 0:00:50
      218500 -- [-1177.710] (-1179.422) (-1179.806) (-1175.964) * [-1178.688] (-1175.842) (-1177.833) (-1175.949) -- 0:00:50
      219000 -- (-1180.120) [-1176.834] (-1176.870) (-1175.966) * (-1181.785) (-1176.563) [-1176.241] (-1175.609) -- 0:00:49
      219500 -- (-1177.803) (-1178.831) (-1179.468) [-1178.189] * [-1176.876] (-1177.635) (-1179.442) (-1177.575) -- 0:00:49
      220000 -- (-1180.131) (-1177.482) [-1186.794] (-1175.940) * (-1176.739) (-1178.099) (-1179.221) [-1176.674] -- 0:00:49

      Average standard deviation of split frequencies: 0.017090

      220500 -- (-1179.770) [-1180.343] (-1180.294) (-1176.752) * (-1176.056) (-1180.112) [-1178.039] (-1177.800) -- 0:00:49
      221000 -- (-1177.903) (-1180.264) (-1178.508) [-1176.015] * (-1176.206) (-1179.945) (-1179.545) [-1176.572] -- 0:00:49
      221500 -- (-1175.787) (-1177.987) [-1178.418] (-1178.147) * (-1176.348) [-1179.638] (-1175.698) (-1176.187) -- 0:00:49
      222000 -- (-1176.299) (-1177.968) [-1176.407] (-1180.232) * [-1176.148] (-1178.479) (-1176.705) (-1176.543) -- 0:00:49
      222500 -- (-1176.369) (-1175.938) [-1179.844] (-1177.780) * (-1176.083) [-1180.735] (-1176.183) (-1175.812) -- 0:00:48
      223000 -- (-1177.694) (-1177.638) (-1183.602) [-1177.806] * [-1178.021] (-1176.943) (-1180.205) (-1177.280) -- 0:00:48
      223500 -- (-1176.287) [-1178.669] (-1179.353) (-1180.293) * (-1177.754) (-1176.589) (-1181.710) [-1178.025] -- 0:00:48
      224000 -- (-1177.393) (-1178.021) [-1175.577] (-1179.552) * (-1178.576) (-1175.996) (-1175.855) [-1179.496] -- 0:00:48
      224500 -- (-1176.243) (-1179.295) (-1176.050) [-1178.174] * (-1182.740) (-1177.106) (-1175.730) [-1175.639] -- 0:00:48
      225000 -- (-1175.661) (-1177.038) (-1176.577) [-1177.275] * [-1180.656] (-1178.815) (-1175.382) (-1181.348) -- 0:00:51

      Average standard deviation of split frequencies: 0.015528

      225500 -- (-1177.198) (-1178.263) (-1176.619) [-1176.510] * (-1177.515) (-1177.014) [-1175.960] (-1178.615) -- 0:00:51
      226000 -- [-1176.359] (-1178.346) (-1182.169) (-1178.156) * (-1179.780) (-1176.189) [-1176.619] (-1178.214) -- 0:00:51
      226500 -- (-1175.906) (-1177.530) (-1183.242) [-1181.194] * (-1178.299) (-1177.006) (-1176.175) [-1179.073] -- 0:00:51
      227000 -- (-1176.128) (-1181.714) [-1177.408] (-1178.433) * [-1184.633] (-1178.184) (-1178.936) (-1177.838) -- 0:00:51
      227500 -- (-1177.002) [-1177.496] (-1176.818) (-1177.317) * [-1178.200] (-1176.793) (-1176.816) (-1179.273) -- 0:00:50
      228000 -- (-1178.202) (-1177.230) (-1177.852) [-1177.728] * (-1177.095) (-1180.143) [-1176.936] (-1176.527) -- 0:00:50
      228500 -- (-1177.354) (-1178.832) (-1176.413) [-1176.577] * (-1176.348) [-1176.434] (-1176.808) (-1176.376) -- 0:00:50
      229000 -- (-1178.466) (-1175.823) (-1177.888) [-1176.859] * (-1180.509) (-1176.769) [-1178.398] (-1175.543) -- 0:00:50
      229500 -- [-1178.814] (-1176.520) (-1179.063) (-1181.568) * (-1176.100) (-1179.231) [-1176.682] (-1175.838) -- 0:00:50
      230000 -- (-1179.113) [-1176.152] (-1180.214) (-1176.078) * [-1177.406] (-1178.570) (-1177.923) (-1176.057) -- 0:00:50

      Average standard deviation of split frequencies: 0.016349

      230500 -- (-1178.658) [-1176.991] (-1175.763) (-1176.327) * [-1179.063] (-1178.305) (-1177.927) (-1175.764) -- 0:00:50
      231000 -- (-1179.126) [-1175.945] (-1177.289) (-1176.318) * (-1179.150) [-1178.033] (-1175.600) (-1178.665) -- 0:00:49
      231500 -- [-1175.970] (-1179.941) (-1178.048) (-1175.353) * (-1178.176) [-1181.320] (-1177.910) (-1180.234) -- 0:00:49
      232000 -- [-1177.668] (-1181.922) (-1178.389) (-1176.423) * (-1175.995) [-1180.123] (-1179.318) (-1178.049) -- 0:00:49
      232500 -- (-1177.245) [-1183.820] (-1176.088) (-1176.991) * (-1176.194) [-1178.020] (-1187.225) (-1178.163) -- 0:00:49
      233000 -- (-1176.745) [-1181.458] (-1178.172) (-1180.237) * (-1179.213) (-1177.908) [-1179.750] (-1180.935) -- 0:00:49
      233500 -- (-1177.402) (-1180.202) (-1178.565) [-1175.323] * (-1177.455) [-1182.689] (-1183.190) (-1180.704) -- 0:00:49
      234000 -- (-1175.667) [-1181.296] (-1178.469) (-1176.080) * (-1180.244) (-1180.517) [-1176.732] (-1179.504) -- 0:00:49
      234500 -- (-1177.700) [-1176.066] (-1177.547) (-1175.431) * [-1177.956] (-1180.280) (-1177.586) (-1177.777) -- 0:00:48
      235000 -- (-1177.195) (-1175.941) (-1175.859) [-1176.625] * (-1177.375) (-1180.170) (-1176.230) [-1178.267] -- 0:00:48

      Average standard deviation of split frequencies: 0.016979

      235500 -- (-1176.554) (-1176.507) [-1175.712] (-1175.907) * (-1179.204) (-1177.527) (-1176.815) [-1177.387] -- 0:00:48
      236000 -- [-1181.187] (-1177.991) (-1175.802) (-1176.706) * [-1176.023] (-1179.531) (-1177.387) (-1176.832) -- 0:00:48
      236500 -- (-1177.714) (-1175.582) [-1177.226] (-1177.486) * (-1175.809) (-1176.266) [-1177.365] (-1175.643) -- 0:00:48
      237000 -- (-1179.692) [-1178.696] (-1177.610) (-1179.719) * [-1180.843] (-1176.837) (-1177.075) (-1180.547) -- 0:00:48
      237500 -- (-1179.910) (-1177.704) [-1175.922] (-1180.688) * (-1179.484) [-1179.428] (-1177.207) (-1176.265) -- 0:00:48
      238000 -- (-1178.168) [-1177.917] (-1177.176) (-1179.101) * (-1177.683) (-1178.055) (-1176.759) [-1178.115] -- 0:00:48
      238500 -- (-1178.761) (-1178.020) (-1178.552) [-1176.534] * (-1178.438) [-1177.016] (-1176.168) (-1176.501) -- 0:00:47
      239000 -- (-1181.358) [-1175.591] (-1179.482) (-1176.666) * (-1176.558) (-1177.033) [-1178.010] (-1177.912) -- 0:00:47
      239500 -- (-1179.136) [-1176.248] (-1180.825) (-1176.340) * (-1177.609) (-1177.406) [-1176.595] (-1178.672) -- 0:00:47
      240000 -- (-1177.140) (-1177.669) (-1182.286) [-1176.318] * [-1176.656] (-1179.009) (-1176.815) (-1178.233) -- 0:00:50

      Average standard deviation of split frequencies: 0.016976

      240500 -- (-1176.582) (-1177.176) (-1184.508) [-1175.926] * [-1175.806] (-1177.981) (-1176.406) (-1178.642) -- 0:00:50
      241000 -- (-1177.251) [-1178.474] (-1180.901) (-1182.736) * (-1180.009) (-1178.011) (-1176.669) [-1179.570] -- 0:00:50
      241500 -- [-1176.600] (-1177.184) (-1180.638) (-1183.020) * (-1177.874) (-1179.855) [-1176.757] (-1176.994) -- 0:00:50
      242000 -- (-1176.923) (-1179.461) (-1178.970) [-1177.806] * (-1177.460) [-1179.872] (-1176.757) (-1179.467) -- 0:00:50
      242500 -- (-1176.416) [-1176.999] (-1176.980) (-1175.812) * (-1178.253) [-1179.597] (-1176.587) (-1179.611) -- 0:00:49
      243000 -- [-1177.358] (-1178.222) (-1175.994) (-1175.783) * (-1178.934) (-1179.463) (-1179.368) [-1179.249] -- 0:00:49
      243500 -- (-1178.247) (-1178.848) [-1176.658] (-1177.914) * (-1176.217) (-1176.544) (-1179.393) [-1175.409] -- 0:00:49
      244000 -- (-1176.720) (-1177.167) (-1175.925) [-1176.397] * (-1177.668) (-1176.165) (-1178.176) [-1176.091] -- 0:00:49
      244500 -- (-1179.762) (-1186.803) [-1176.875] (-1177.166) * (-1178.866) (-1179.897) [-1176.422] (-1176.868) -- 0:00:49
      245000 -- (-1182.970) [-1178.027] (-1175.634) (-1178.743) * (-1175.652) [-1176.830] (-1181.368) (-1176.192) -- 0:00:49

      Average standard deviation of split frequencies: 0.017353

      245500 -- (-1181.564) [-1178.060] (-1176.852) (-1177.796) * (-1177.096) [-1178.144] (-1179.980) (-1175.323) -- 0:00:49
      246000 -- (-1180.367) (-1176.883) [-1178.398] (-1176.543) * (-1177.154) (-1179.656) [-1178.999] (-1177.475) -- 0:00:49
      246500 -- [-1176.907] (-1178.525) (-1178.757) (-1179.927) * (-1178.000) [-1176.205] (-1179.713) (-1176.099) -- 0:00:48
      247000 -- [-1176.194] (-1177.345) (-1177.440) (-1178.191) * (-1177.441) [-1177.513] (-1178.786) (-1179.322) -- 0:00:48
      247500 -- (-1179.848) (-1178.114) [-1179.129] (-1178.292) * [-1184.456] (-1178.659) (-1177.421) (-1176.426) -- 0:00:48
      248000 -- [-1180.607] (-1179.478) (-1182.167) (-1180.129) * (-1176.721) (-1180.033) [-1175.711] (-1176.300) -- 0:00:48
      248500 -- (-1177.729) (-1179.485) [-1181.458] (-1178.895) * (-1176.425) [-1180.430] (-1176.001) (-1176.705) -- 0:00:48
      249000 -- (-1184.563) [-1176.645] (-1179.042) (-1180.465) * (-1180.921) (-1176.736) [-1177.107] (-1177.614) -- 0:00:48
      249500 -- (-1179.378) [-1181.875] (-1177.246) (-1177.984) * (-1176.486) (-1176.465) [-1177.206] (-1175.923) -- 0:00:48
      250000 -- (-1177.639) [-1177.864] (-1181.137) (-1180.963) * (-1176.616) (-1179.664) [-1177.138] (-1176.500) -- 0:00:48

      Average standard deviation of split frequencies: 0.016299

      250500 -- (-1177.154) [-1177.973] (-1178.377) (-1179.073) * (-1178.395) [-1178.709] (-1180.063) (-1179.276) -- 0:00:47
      251000 -- [-1176.269] (-1178.763) (-1176.093) (-1180.028) * (-1181.147) (-1180.648) (-1177.643) [-1175.891] -- 0:00:47
      251500 -- (-1179.551) [-1179.430] (-1178.601) (-1184.689) * [-1180.832] (-1180.648) (-1176.371) (-1176.406) -- 0:00:47
      252000 -- (-1181.218) (-1177.873) [-1177.957] (-1181.690) * (-1178.483) (-1177.696) [-1176.069] (-1179.647) -- 0:00:47
      252500 -- (-1179.166) (-1176.416) [-1177.809] (-1179.600) * [-1178.917] (-1177.774) (-1175.869) (-1177.074) -- 0:00:47
      253000 -- [-1176.028] (-1176.342) (-1177.265) (-1180.874) * (-1178.949) (-1179.620) [-1175.922] (-1177.135) -- 0:00:47
      253500 -- (-1176.133) (-1176.680) (-1179.220) [-1176.372] * (-1178.313) (-1176.103) (-1176.113) [-1176.014] -- 0:00:47
      254000 -- (-1176.986) (-1179.119) [-1179.915] (-1177.396) * [-1176.567] (-1176.235) (-1179.141) (-1183.219) -- 0:00:46
      254500 -- (-1176.788) (-1184.207) [-1177.313] (-1175.684) * (-1176.637) [-1177.584] (-1182.252) (-1175.881) -- 0:00:46
      255000 -- (-1178.258) [-1178.809] (-1176.819) (-1177.976) * (-1177.558) [-1175.660] (-1179.606) (-1180.745) -- 0:00:46

      Average standard deviation of split frequencies: 0.016266

      255500 -- [-1179.718] (-1179.657) (-1176.774) (-1178.321) * (-1188.020) (-1176.141) [-1180.155] (-1184.647) -- 0:00:49
      256000 -- [-1175.973] (-1175.359) (-1177.571) (-1178.388) * (-1178.637) [-1176.449] (-1178.631) (-1180.729) -- 0:00:49
      256500 -- (-1176.012) (-1177.804) (-1176.661) [-1175.428] * (-1179.171) [-1176.889] (-1178.898) (-1183.269) -- 0:00:49
      257000 -- [-1176.698] (-1176.610) (-1177.472) (-1177.141) * [-1181.931] (-1176.010) (-1179.526) (-1180.232) -- 0:00:49
      257500 -- (-1175.804) [-1176.635] (-1178.169) (-1176.457) * (-1176.221) (-1177.229) (-1178.452) [-1177.266] -- 0:00:49
      258000 -- (-1180.835) [-1176.233] (-1176.668) (-1177.179) * [-1176.380] (-1179.090) (-1176.817) (-1176.384) -- 0:00:48
      258500 -- (-1182.451) (-1175.962) [-1176.575] (-1178.008) * (-1177.227) [-1181.451] (-1178.104) (-1180.217) -- 0:00:48
      259000 -- (-1185.399) (-1182.464) (-1179.935) [-1176.379] * (-1176.513) (-1177.301) (-1176.934) [-1177.024] -- 0:00:48
      259500 -- (-1178.815) [-1179.958] (-1177.487) (-1175.923) * (-1176.871) (-1177.045) [-1177.082] (-1175.762) -- 0:00:48
      260000 -- [-1176.645] (-1182.213) (-1179.249) (-1178.437) * [-1177.831] (-1177.325) (-1178.036) (-1176.681) -- 0:00:48

      Average standard deviation of split frequencies: 0.015573

      260500 -- (-1176.985) (-1178.338) (-1179.984) [-1177.663] * [-1181.151] (-1177.315) (-1176.460) (-1180.882) -- 0:00:48
      261000 -- (-1180.132) (-1179.250) [-1178.483] (-1176.942) * (-1175.780) (-1177.469) [-1176.756] (-1181.761) -- 0:00:48
      261500 -- (-1184.041) (-1178.527) (-1177.977) [-1175.965] * (-1177.652) (-1177.119) (-1179.930) [-1176.358] -- 0:00:48
      262000 -- (-1181.036) (-1178.492) (-1177.655) [-1176.253] * (-1176.248) [-1176.449] (-1178.900) (-1176.886) -- 0:00:47
      262500 -- (-1177.492) [-1177.692] (-1178.594) (-1177.354) * (-1179.378) [-1176.460] (-1176.076) (-1176.360) -- 0:00:47
      263000 -- [-1177.224] (-1176.250) (-1178.960) (-1176.936) * (-1179.850) (-1181.088) (-1177.346) [-1176.858] -- 0:00:47
      263500 -- (-1177.205) [-1176.555] (-1177.634) (-1177.525) * [-1181.548] (-1181.532) (-1180.455) (-1177.303) -- 0:00:47
      264000 -- [-1177.454] (-1176.555) (-1176.791) (-1177.168) * (-1176.037) (-1182.857) (-1176.180) [-1180.089] -- 0:00:47
      264500 -- (-1183.170) [-1176.857] (-1177.575) (-1177.396) * [-1176.773] (-1180.335) (-1178.841) (-1178.918) -- 0:00:47
      265000 -- (-1182.869) (-1177.640) (-1177.102) [-1177.226] * [-1176.467] (-1178.328) (-1181.586) (-1177.038) -- 0:00:47

      Average standard deviation of split frequencies: 0.015654

      265500 -- (-1179.936) [-1175.962] (-1177.729) (-1177.955) * (-1177.436) [-1176.542] (-1181.145) (-1179.407) -- 0:00:47
      266000 -- (-1178.197) (-1177.678) [-1176.929] (-1176.425) * [-1179.701] (-1176.242) (-1179.998) (-1176.925) -- 0:00:46
      266500 -- (-1176.590) (-1176.060) (-1177.625) [-1176.442] * (-1177.594) [-1176.830] (-1176.764) (-1177.426) -- 0:00:46
      267000 -- [-1176.590] (-1177.516) (-1178.273) (-1177.500) * (-1177.795) (-1180.266) [-1176.133] (-1176.070) -- 0:00:46
      267500 -- (-1178.190) [-1177.505] (-1178.000) (-1179.503) * (-1178.350) (-1179.729) [-1175.672] (-1176.078) -- 0:00:46
      268000 -- (-1179.622) (-1176.578) [-1177.320] (-1180.369) * (-1178.982) (-1177.065) (-1179.383) [-1176.078] -- 0:00:46
      268500 -- [-1177.919] (-1176.071) (-1175.697) (-1176.642) * (-1179.458) [-1177.183] (-1176.795) (-1176.173) -- 0:00:46
      269000 -- (-1178.572) (-1175.427) (-1175.629) [-1179.220] * (-1176.755) (-1179.559) (-1178.889) [-1176.323] -- 0:00:46
      269500 -- (-1180.018) [-1175.198] (-1175.482) (-1180.427) * (-1179.575) [-1176.326] (-1177.133) (-1178.209) -- 0:00:46
      270000 -- (-1176.834) (-1175.583) (-1175.482) [-1176.646] * (-1182.170) (-1176.343) (-1176.117) [-1178.318] -- 0:00:45

      Average standard deviation of split frequencies: 0.015367

      270500 -- (-1175.594) [-1177.813] (-1178.682) (-1176.224) * (-1186.621) (-1176.851) [-1176.974] (-1178.054) -- 0:00:45
      271000 -- (-1176.013) (-1177.475) [-1178.210] (-1176.240) * (-1177.495) (-1177.841) [-1177.059] (-1178.675) -- 0:00:45
      271500 -- (-1177.660) [-1178.803] (-1177.257) (-1175.821) * (-1176.600) (-1179.928) [-1176.326] (-1178.683) -- 0:00:45
      272000 -- (-1176.536) (-1183.863) (-1178.180) [-1175.846] * (-1177.767) (-1177.276) [-1175.759] (-1180.562) -- 0:00:48
      272500 -- (-1177.016) (-1176.273) [-1178.271] (-1175.597) * (-1178.424) (-1175.578) [-1176.737] (-1178.863) -- 0:00:48
      273000 -- (-1176.418) (-1176.319) [-1177.179] (-1178.449) * (-1179.413) (-1175.923) [-1177.887] (-1179.345) -- 0:00:47
      273500 -- (-1176.184) (-1179.190) (-1176.805) [-1178.634] * (-1180.500) (-1178.941) [-1176.147] (-1176.880) -- 0:00:47
      274000 -- (-1176.020) [-1179.190] (-1178.768) (-1176.175) * [-1178.579] (-1181.841) (-1179.729) (-1176.317) -- 0:00:47
      274500 -- [-1175.807] (-1178.839) (-1177.449) (-1176.935) * (-1176.094) (-1182.778) (-1178.757) [-1180.637] -- 0:00:47
      275000 -- (-1176.013) [-1177.647] (-1176.457) (-1181.644) * (-1175.913) (-1176.457) [-1178.972] (-1178.493) -- 0:00:47

      Average standard deviation of split frequencies: 0.014367

      275500 -- (-1176.678) [-1179.763] (-1176.148) (-1176.667) * (-1177.323) (-1180.529) [-1178.737] (-1177.810) -- 0:00:47
      276000 -- (-1177.827) (-1181.190) (-1179.363) [-1176.010] * (-1179.719) (-1176.813) (-1176.811) [-1177.976] -- 0:00:47
      276500 -- (-1177.350) (-1179.354) [-1177.399] (-1175.374) * (-1177.901) (-1176.831) [-1176.852] (-1178.525) -- 0:00:47
      277000 -- (-1178.905) [-1177.115] (-1179.266) (-1176.593) * [-1177.544] (-1178.056) (-1178.499) (-1175.309) -- 0:00:46
      277500 -- (-1177.267) (-1177.882) [-1178.398] (-1179.333) * [-1176.133] (-1176.716) (-1177.333) (-1179.851) -- 0:00:46
      278000 -- (-1181.123) (-1176.493) [-1176.873] (-1176.518) * (-1175.435) (-1175.659) [-1178.472] (-1181.403) -- 0:00:46
      278500 -- (-1176.638) (-1176.422) (-1178.636) [-1175.805] * (-1178.717) (-1179.102) (-1178.896) [-1180.244] -- 0:00:46
      279000 -- [-1177.000] (-1178.146) (-1180.147) (-1175.676) * (-1179.144) (-1176.206) [-1177.720] (-1178.737) -- 0:00:46
      279500 -- [-1175.659] (-1178.587) (-1178.801) (-1180.785) * (-1177.619) (-1175.924) (-1178.350) [-1176.332] -- 0:00:46
      280000 -- (-1176.909) [-1177.485] (-1177.743) (-1175.502) * (-1177.663) (-1178.263) (-1176.798) [-1178.460] -- 0:00:46

      Average standard deviation of split frequencies: 0.013717

      280500 -- [-1178.189] (-1175.313) (-1177.147) (-1176.531) * (-1177.925) (-1178.141) [-1176.788] (-1177.076) -- 0:00:46
      281000 -- (-1184.377) [-1175.799] (-1177.094) (-1177.195) * (-1178.502) (-1180.925) [-1175.270] (-1176.696) -- 0:00:46
      281500 -- (-1178.951) (-1178.542) [-1178.221] (-1177.188) * (-1177.088) (-1177.298) (-1179.492) [-1176.707] -- 0:00:45
      282000 -- (-1177.435) [-1177.644] (-1177.233) (-1176.087) * [-1178.869] (-1177.389) (-1178.783) (-1176.380) -- 0:00:45
      282500 -- (-1176.492) (-1177.422) [-1177.459] (-1178.669) * (-1181.833) (-1177.231) (-1179.392) [-1184.223] -- 0:00:45
      283000 -- [-1178.049] (-1181.997) (-1178.288) (-1177.997) * (-1177.934) (-1180.123) (-1176.635) [-1177.348] -- 0:00:45
      283500 -- (-1177.420) [-1181.165] (-1177.886) (-1177.395) * (-1178.903) (-1177.235) (-1181.005) [-1177.338] -- 0:00:45
      284000 -- [-1177.066] (-1176.590) (-1177.449) (-1178.561) * (-1180.198) (-1177.748) (-1179.297) [-1175.890] -- 0:00:45
      284500 -- (-1175.805) [-1177.756] (-1177.442) (-1178.153) * (-1177.310) (-1177.259) [-1181.149] (-1176.038) -- 0:00:45
      285000 -- (-1176.571) (-1177.627) (-1179.374) [-1177.633] * [-1178.699] (-1177.902) (-1178.525) (-1177.666) -- 0:00:45

      Average standard deviation of split frequencies: 0.012911

      285500 -- (-1177.576) (-1177.438) (-1178.246) [-1175.654] * (-1177.801) (-1176.555) (-1178.221) [-1178.169] -- 0:00:45
      286000 -- (-1179.270) (-1177.352) (-1177.696) [-1175.636] * (-1180.625) (-1176.407) [-1177.946] (-1175.945) -- 0:00:44
      286500 -- [-1176.924] (-1177.274) (-1179.028) (-1177.353) * (-1177.479) (-1178.948) (-1177.019) [-1178.824] -- 0:00:44
      287000 -- (-1179.806) (-1175.591) (-1179.601) [-1177.222] * (-1182.099) (-1177.924) [-1176.417] (-1176.013) -- 0:00:44
      287500 -- (-1178.764) (-1180.056) (-1178.394) [-1177.958] * (-1180.675) (-1175.911) [-1175.780] (-1176.496) -- 0:00:44
      288000 -- (-1175.945) [-1175.560] (-1178.626) (-1178.774) * [-1177.843] (-1176.900) (-1176.103) (-1176.057) -- 0:00:44
      288500 -- (-1175.682) (-1177.007) [-1179.017] (-1177.691) * (-1179.463) [-1178.509] (-1181.731) (-1176.797) -- 0:00:46
      289000 -- [-1177.422] (-1180.157) (-1176.937) (-1177.369) * (-1179.046) (-1181.337) (-1177.151) [-1178.316] -- 0:00:46
      289500 -- [-1177.061] (-1179.561) (-1177.273) (-1176.922) * (-1176.478) (-1179.638) [-1178.140] (-1179.271) -- 0:00:46
      290000 -- (-1177.318) [-1179.330] (-1179.266) (-1176.177) * (-1179.479) [-1178.760] (-1182.302) (-1179.279) -- 0:00:46

      Average standard deviation of split frequencies: 0.012974

      290500 -- (-1179.036) (-1182.283) (-1178.663) [-1175.250] * (-1181.819) [-1178.845] (-1180.710) (-1176.870) -- 0:00:46
      291000 -- [-1178.188] (-1180.066) (-1181.466) (-1176.808) * (-1179.711) [-1177.052] (-1180.238) (-1176.360) -- 0:00:46
      291500 -- [-1177.123] (-1178.566) (-1182.289) (-1178.716) * (-1176.381) [-1177.689] (-1179.300) (-1176.471) -- 0:00:46
      292000 -- (-1180.292) (-1178.405) [-1175.456] (-1179.793) * [-1176.460] (-1177.214) (-1176.814) (-1184.637) -- 0:00:46
      292500 -- (-1178.559) [-1178.736] (-1179.474) (-1179.907) * (-1180.076) (-1177.186) [-1176.820] (-1179.364) -- 0:00:45
      293000 -- (-1177.558) (-1182.913) (-1180.664) [-1177.785] * (-1177.410) [-1176.456] (-1177.076) (-1176.690) -- 0:00:45
      293500 -- (-1179.227) (-1176.536) [-1179.480] (-1178.793) * (-1177.323) [-1178.489] (-1175.541) (-1176.214) -- 0:00:45
      294000 -- [-1177.113] (-1181.416) (-1179.951) (-1179.489) * [-1176.727] (-1177.065) (-1176.299) (-1177.648) -- 0:00:45
      294500 -- [-1178.040] (-1179.750) (-1176.533) (-1177.819) * [-1178.438] (-1177.072) (-1178.165) (-1178.947) -- 0:00:45
      295000 -- (-1177.569) (-1179.269) (-1179.595) [-1177.629] * (-1177.893) (-1177.928) [-1176.993] (-1176.660) -- 0:00:45

      Average standard deviation of split frequencies: 0.012918

      295500 -- [-1176.448] (-1179.803) (-1176.181) (-1176.243) * (-1176.960) [-1176.625] (-1176.677) (-1175.948) -- 0:00:45
      296000 -- (-1176.443) (-1178.618) (-1176.310) [-1176.612] * (-1181.322) (-1175.919) [-1176.671] (-1182.076) -- 0:00:45
      296500 -- (-1176.973) (-1177.061) [-1181.475] (-1177.860) * (-1176.104) (-1179.245) [-1176.413] (-1180.975) -- 0:00:45
      297000 -- (-1177.363) (-1178.307) (-1178.474) [-1177.131] * (-1175.999) (-1178.299) [-1176.485] (-1180.783) -- 0:00:44
      297500 -- [-1177.588] (-1177.629) (-1178.571) (-1177.975) * (-1176.287) [-1176.247] (-1178.484) (-1181.774) -- 0:00:44
      298000 -- (-1177.216) (-1177.603) (-1179.422) [-1176.993] * [-1176.668] (-1176.851) (-1180.324) (-1177.050) -- 0:00:44
      298500 -- (-1179.994) [-1177.875] (-1177.976) (-1178.789) * (-1177.737) (-1177.875) (-1183.309) [-1176.929] -- 0:00:44
      299000 -- [-1179.089] (-1175.373) (-1177.561) (-1179.013) * (-1180.035) (-1177.029) [-1177.665] (-1177.918) -- 0:00:44
      299500 -- (-1178.048) (-1178.254) (-1177.236) [-1177.064] * (-1181.392) (-1176.788) (-1177.765) [-1176.401] -- 0:00:44
      300000 -- (-1178.434) (-1176.645) (-1176.968) [-1180.735] * (-1177.387) (-1176.631) [-1176.297] (-1175.553) -- 0:00:44

      Average standard deviation of split frequencies: 0.012717

      300500 -- (-1180.831) (-1176.646) (-1177.351) [-1180.654] * (-1179.084) [-1177.084] (-1176.230) (-1175.158) -- 0:00:44
      301000 -- (-1178.210) (-1178.289) [-1176.534] (-1178.749) * (-1179.425) (-1176.436) [-1177.397] (-1176.828) -- 0:00:44
      301500 -- [-1177.478] (-1175.666) (-1177.544) (-1176.395) * (-1178.857) [-1183.007] (-1180.397) (-1181.265) -- 0:00:44
      302000 -- (-1177.554) (-1175.840) (-1178.167) [-1177.247] * (-1178.135) (-1179.761) (-1177.522) [-1180.844] -- 0:00:43
      302500 -- (-1175.740) [-1176.697] (-1178.148) (-1176.124) * (-1177.037) (-1177.427) [-1177.753] (-1178.153) -- 0:00:43
      303000 -- (-1177.624) [-1175.274] (-1179.496) (-1175.925) * (-1175.517) (-1176.601) [-1178.195] (-1177.736) -- 0:00:43
      303500 -- (-1185.973) [-1175.604] (-1180.779) (-1178.544) * (-1178.660) (-1178.014) [-1179.816] (-1177.962) -- 0:00:43
      304000 -- (-1179.649) (-1177.647) (-1177.319) [-1178.373] * [-1176.172] (-1175.831) (-1178.294) (-1178.641) -- 0:00:43
      304500 -- (-1177.171) (-1176.356) (-1177.101) [-1177.854] * [-1176.326] (-1176.531) (-1176.454) (-1176.974) -- 0:00:45
      305000 -- (-1177.279) (-1175.650) (-1177.578) [-1178.573] * (-1177.300) [-1177.048] (-1178.128) (-1180.036) -- 0:00:45

      Average standard deviation of split frequencies: 0.012410

      305500 -- [-1177.698] (-1176.818) (-1177.763) (-1178.718) * (-1177.452) (-1176.616) (-1176.272) [-1175.491] -- 0:00:45
      306000 -- (-1176.742) [-1176.988] (-1183.131) (-1177.291) * (-1176.500) [-1176.482] (-1176.121) (-1182.927) -- 0:00:45
      306500 -- [-1181.653] (-1175.581) (-1178.505) (-1178.432) * (-1178.511) (-1178.859) (-1179.197) [-1180.836] -- 0:00:45
      307000 -- (-1177.080) (-1176.884) (-1181.987) [-1179.547] * (-1179.489) (-1177.762) [-1179.845] (-1179.088) -- 0:00:45
      307500 -- (-1177.155) (-1177.081) [-1181.788] (-1176.601) * (-1177.940) (-1179.379) (-1180.470) [-1176.603] -- 0:00:45
      308000 -- [-1176.677] (-1177.988) (-1179.629) (-1177.554) * (-1177.511) (-1177.723) [-1177.308] (-1177.263) -- 0:00:44
      308500 -- (-1181.145) [-1177.812] (-1176.284) (-1176.541) * (-1178.481) [-1176.927] (-1177.920) (-1179.207) -- 0:00:44
      309000 -- (-1175.809) [-1177.128] (-1179.753) (-1177.395) * (-1178.631) [-1176.216] (-1176.728) (-1179.449) -- 0:00:44
      309500 -- (-1175.574) [-1178.098] (-1178.708) (-1179.357) * (-1180.275) [-1177.511] (-1177.110) (-1177.754) -- 0:00:44
      310000 -- [-1178.180] (-1178.237) (-1176.627) (-1178.188) * [-1179.884] (-1177.087) (-1179.618) (-1177.129) -- 0:00:44

      Average standard deviation of split frequencies: 0.013488

      310500 -- (-1178.370) [-1178.059] (-1179.549) (-1176.912) * [-1178.882] (-1179.945) (-1176.031) (-1179.672) -- 0:00:44
      311000 -- (-1177.384) (-1177.895) [-1177.690] (-1181.649) * (-1177.159) (-1180.356) (-1176.633) [-1178.045] -- 0:00:44
      311500 -- (-1175.407) (-1176.452) (-1184.124) [-1177.760] * [-1177.785] (-1179.772) (-1176.472) (-1176.502) -- 0:00:44
      312000 -- (-1176.710) [-1177.149] (-1176.738) (-1175.544) * (-1180.138) [-1181.651] (-1180.352) (-1176.646) -- 0:00:44
      312500 -- (-1179.011) (-1176.572) [-1178.145] (-1179.664) * [-1183.210] (-1176.742) (-1178.013) (-1178.398) -- 0:00:44
      313000 -- (-1178.218) (-1177.032) (-1178.455) [-1177.312] * (-1175.880) (-1176.827) (-1179.360) [-1176.948] -- 0:00:43
      313500 -- (-1176.260) (-1177.380) [-1177.329] (-1176.048) * (-1177.169) [-1176.489] (-1179.352) (-1175.800) -- 0:00:43
      314000 -- [-1178.353] (-1175.868) (-1180.531) (-1176.406) * [-1178.134] (-1176.545) (-1177.765) (-1176.734) -- 0:00:43
      314500 -- (-1176.006) (-1176.514) (-1178.052) [-1175.643] * [-1178.271] (-1175.412) (-1180.364) (-1176.315) -- 0:00:43
      315000 -- [-1176.729] (-1178.757) (-1176.134) (-1179.899) * [-1177.210] (-1175.972) (-1175.826) (-1177.803) -- 0:00:43

      Average standard deviation of split frequencies: 0.014211

      315500 -- (-1176.163) (-1177.484) [-1175.791] (-1178.120) * (-1181.101) (-1178.565) (-1176.249) [-1177.759] -- 0:00:43
      316000 -- (-1177.832) (-1176.535) [-1175.468] (-1175.988) * (-1178.883) (-1183.186) (-1182.995) [-1181.407] -- 0:00:43
      316500 -- [-1176.431] (-1175.806) (-1177.456) (-1177.045) * [-1176.503] (-1178.610) (-1181.867) (-1181.731) -- 0:00:43
      317000 -- [-1175.452] (-1176.516) (-1177.829) (-1176.477) * (-1175.914) [-1179.072] (-1179.042) (-1176.816) -- 0:00:43
      317500 -- (-1177.301) (-1178.161) (-1182.110) [-1178.784] * (-1176.260) (-1180.167) (-1176.330) [-1177.646] -- 0:00:42
      318000 -- (-1179.012) (-1177.383) [-1176.941] (-1182.629) * (-1177.299) (-1177.340) [-1177.168] (-1175.700) -- 0:00:42
      318500 -- (-1177.535) [-1175.653] (-1178.500) (-1176.053) * (-1179.033) [-1177.241] (-1176.587) (-1176.352) -- 0:00:42
      319000 -- (-1177.535) [-1178.679] (-1178.084) (-1178.073) * [-1177.366] (-1179.675) (-1175.564) (-1181.505) -- 0:00:42
      319500 -- (-1176.077) (-1178.892) [-1177.235] (-1178.661) * [-1177.413] (-1175.805) (-1176.383) (-1177.880) -- 0:00:42
      320000 -- (-1175.283) [-1178.813] (-1176.065) (-1178.030) * (-1176.888) (-1178.003) [-1176.014] (-1177.869) -- 0:00:42

      Average standard deviation of split frequencies: 0.013557

      320500 -- (-1176.019) (-1178.537) [-1176.534] (-1179.927) * [-1177.734] (-1179.291) (-1179.018) (-1177.725) -- 0:00:42
      321000 -- (-1176.962) (-1177.387) [-1177.865] (-1176.319) * [-1181.491] (-1177.095) (-1175.877) (-1179.376) -- 0:00:44
      321500 -- (-1177.023) (-1181.594) (-1176.441) [-1176.746] * (-1175.638) (-1177.805) (-1180.044) [-1179.039] -- 0:00:44
      322000 -- (-1179.324) (-1177.854) [-1177.909] (-1175.968) * (-1177.479) (-1176.795) [-1179.108] (-1177.134) -- 0:00:44
      322500 -- (-1178.415) (-1179.254) [-1176.247] (-1177.684) * (-1176.798) (-1178.041) [-1176.848] (-1176.374) -- 0:00:44
      323000 -- [-1178.670] (-1180.577) (-1179.264) (-1177.616) * (-1175.449) (-1177.585) (-1176.056) [-1175.337] -- 0:00:44
      323500 -- [-1176.855] (-1178.170) (-1180.528) (-1183.362) * (-1175.925) [-1179.089] (-1177.253) (-1179.144) -- 0:00:43
      324000 -- (-1177.878) (-1175.492) (-1176.881) [-1177.139] * (-1177.527) [-1178.378] (-1176.505) (-1178.594) -- 0:00:43
      324500 -- (-1176.748) [-1175.858] (-1175.289) (-1179.451) * (-1180.288) (-1178.665) (-1178.814) [-1177.311] -- 0:00:43
      325000 -- (-1177.471) (-1178.589) [-1176.223] (-1175.317) * (-1181.867) [-1177.865] (-1176.165) (-1178.630) -- 0:00:43

      Average standard deviation of split frequencies: 0.014139

      325500 -- (-1177.612) (-1176.713) [-1175.329] (-1176.267) * (-1179.082) (-1177.918) [-1176.532] (-1177.542) -- 0:00:43
      326000 -- (-1175.977) (-1176.806) [-1175.328] (-1176.736) * (-1179.809) (-1178.996) (-1178.481) [-1178.695] -- 0:00:43
      326500 -- (-1177.590) (-1179.462) [-1180.923] (-1175.398) * (-1176.481) [-1177.895] (-1176.781) (-1177.488) -- 0:00:43
      327000 -- [-1176.510] (-1179.494) (-1182.281) (-1176.427) * [-1177.276] (-1179.173) (-1178.970) (-1178.049) -- 0:00:43
      327500 -- (-1176.250) [-1175.957] (-1177.395) (-1181.405) * (-1176.896) (-1180.350) (-1177.455) [-1179.291] -- 0:00:43
      328000 -- (-1175.450) [-1177.324] (-1176.631) (-1183.996) * (-1177.143) [-1178.261] (-1179.580) (-1176.110) -- 0:00:43
      328500 -- (-1176.931) (-1179.047) [-1176.303] (-1176.121) * (-1176.511) (-1179.652) [-1177.523] (-1175.348) -- 0:00:42
      329000 -- (-1176.583) [-1176.900] (-1176.124) (-1177.078) * (-1183.578) (-1176.936) [-1177.311] (-1177.219) -- 0:00:42
      329500 -- (-1178.681) (-1177.304) [-1179.704] (-1179.169) * (-1176.688) [-1176.508] (-1177.800) (-1179.789) -- 0:00:42
      330000 -- [-1178.455] (-1178.203) (-1177.672) (-1176.106) * (-1178.995) (-1175.808) [-1177.623] (-1178.589) -- 0:00:42

      Average standard deviation of split frequencies: 0.014019

      330500 -- (-1180.372) (-1180.830) (-1177.278) [-1176.633] * (-1176.654) (-1176.767) [-1176.179] (-1178.502) -- 0:00:42
      331000 -- (-1176.379) (-1175.643) [-1177.264] (-1177.321) * (-1175.978) (-1177.670) (-1177.114) [-1178.837] -- 0:00:42
      331500 -- (-1180.030) (-1179.190) [-1177.123] (-1178.692) * (-1178.503) (-1179.118) [-1179.200] (-1176.589) -- 0:00:42
      332000 -- (-1179.452) (-1179.197) [-1176.410] (-1178.004) * (-1177.447) (-1177.761) [-1176.685] (-1178.123) -- 0:00:42
      332500 -- [-1178.573] (-1176.234) (-1177.073) (-1177.334) * (-1179.887) (-1177.698) [-1176.366] (-1179.102) -- 0:00:42
      333000 -- (-1177.755) [-1176.673] (-1180.510) (-1178.968) * (-1175.657) (-1178.658) [-1177.748] (-1176.921) -- 0:00:42
      333500 -- (-1177.181) [-1178.708] (-1178.745) (-1181.803) * (-1185.109) (-1178.274) (-1179.519) [-1175.991] -- 0:00:41
      334000 -- (-1178.235) (-1178.786) [-1178.745] (-1179.847) * (-1186.915) [-1177.399] (-1179.301) (-1176.824) -- 0:00:41
      334500 -- (-1177.100) (-1181.156) [-1176.464] (-1178.947) * (-1176.698) (-1176.597) (-1180.488) [-1176.401] -- 0:00:41
      335000 -- (-1176.985) (-1179.159) [-1175.486] (-1178.042) * (-1176.418) (-1176.712) (-1180.537) [-1176.699] -- 0:00:41

      Average standard deviation of split frequencies: 0.012462

      335500 -- (-1177.507) (-1180.613) [-1176.908] (-1179.895) * (-1177.873) [-1176.743] (-1177.718) (-1177.940) -- 0:00:41
      336000 -- (-1177.945) [-1178.430] (-1178.592) (-1175.780) * [-1175.944] (-1176.077) (-1179.373) (-1178.926) -- 0:00:41
      336500 -- (-1177.974) [-1177.520] (-1177.989) (-1178.459) * (-1180.680) [-1176.008] (-1179.905) (-1179.925) -- 0:00:41
      337000 -- (-1179.485) [-1178.402] (-1177.863) (-1178.046) * (-1177.243) [-1175.378] (-1179.715) (-1180.322) -- 0:00:41
      337500 -- [-1179.611] (-1177.653) (-1181.753) (-1176.816) * [-1178.097] (-1176.105) (-1176.505) (-1179.891) -- 0:00:43
      338000 -- [-1179.640] (-1176.468) (-1176.579) (-1177.395) * [-1176.588] (-1175.692) (-1177.281) (-1177.941) -- 0:00:43
      338500 -- (-1177.350) (-1177.139) [-1177.786] (-1176.975) * (-11