--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:51:34 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1389/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2175.18         -2179.14
2      -2175.18         -2178.92
--------------------------------------
TOTAL    -2175.18         -2179.04
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888114    0.089486    0.375433    1.517396    0.860396   1501.00   1501.00    1.000
r(A<->C){all}   0.163825    0.019550    0.000018    0.448613    0.126258    100.46    173.85    1.000
r(A<->G){all}   0.161084    0.018243    0.000007    0.428561    0.126674    223.95    242.98    1.000
r(A<->T){all}   0.163684    0.020120    0.000032    0.455466    0.126935    206.91    207.20    1.001
r(C<->G){all}   0.199215    0.023447    0.000082    0.494916    0.165377    149.95    205.12    1.003
r(C<->T){all}   0.147513    0.016956    0.000028    0.402870    0.111226    188.15    218.42    1.007
r(G<->T){all}   0.164679    0.018641    0.000095    0.430973    0.130361    236.72    329.70    1.000
pi(A){all}      0.176064    0.000091    0.157480    0.195152    0.176183   1146.78   1223.21    1.000
pi(C){all}      0.304341    0.000135    0.282828    0.328021    0.304276   1185.33   1254.06    1.000
pi(G){all}      0.282305    0.000122    0.260727    0.303240    0.282227   1071.66   1140.66    1.000
pi(T){all}      0.237289    0.000112    0.216935    0.258314    0.237204   1242.78   1326.63    1.000
alpha{1,2}      0.332832    0.167604    0.000105    1.180077    0.187623   1052.93   1158.69    1.000
alpha{3}        0.417597    0.222256    0.000170    1.400320    0.246973   1175.29   1338.14    1.000
pinvar{all}     0.998001    0.000003    0.994732    0.999961    0.998442    975.61   1078.90    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2118.449566
Model 2: PositiveSelection	-2118.163032
Model 0: one-ratio	-2118.163015
Model 7: beta	-2118.449068
Model 8: beta&w>1	-2118.163032


Model 0 vs 1	0.5731019999993805

Model 2 vs 1	0.5730679999996937

Model 8 vs 7	0.5720719999999346
>C1
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C2
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C3
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C4
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C5
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C6
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVAAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=527 

C1              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C2              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C3              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C4              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C5              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C6              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
                **************************************************

C1              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C2              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C3              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C4              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C5              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C6              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
                **************************************************

C1              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C2              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C3              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C4              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C5              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C6              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
                **************************************************

C1              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C2              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C3              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C4              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C5              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C6              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
                **************************************************

C1              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C2              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C3              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C4              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C5              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C6              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
                **************************************************

C1              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C2              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C3              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C4              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C5              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C6              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVAAIATRLAGLRAPAG
                ***********************************.**************

C1              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C2              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C3              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C4              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C5              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C6              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
                **************************************************

C1              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C2              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C3              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C4              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C5              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C6              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
                **************************************************

C1              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C2              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C3              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C4              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C5              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C6              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
                **************************************************

C1              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C2              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C3              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C4              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C5              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C6              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
                **************************************************

C1              YQFPSYLGFRIVERWQFHYSQVIKSTR
C2              YQFPSYLGFRIVERWQFHYSQVIKSTR
C3              YQFPSYLGFRIVERWQFHYSQVIKSTR
C4              YQFPSYLGFRIVERWQFHYSQVIKSTR
C5              YQFPSYLGFRIVERWQFHYSQVIKSTR
C6              YQFPSYLGFRIVERWQFHYSQVIKSTR
                ***************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  527 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  527 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15810]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [15810]--->[15810]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.567 Mb, Max= 31.131 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C2              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C3              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C4              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C5              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
C6              VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
                **************************************************

C1              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C2              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C3              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C4              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C5              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
C6              PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
                **************************************************

C1              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C2              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C3              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C4              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C5              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
C6              EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
                **************************************************

C1              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C2              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C3              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C4              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C5              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
C6              EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
                **************************************************

C1              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C2              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C3              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C4              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C5              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
C6              LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
                **************************************************

C1              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C2              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C3              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C4              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C5              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
C6              DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVAAIATRLAGLRAPAG
                ***********************************.**************

C1              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C2              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C3              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C4              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C5              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
C6              DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
                **************************************************

C1              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C2              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C3              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C4              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C5              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
C6              IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
                **************************************************

C1              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C2              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C3              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C4              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C5              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
C6              QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
                **************************************************

C1              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C2              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C3              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C4              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C5              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
C6              WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
                **************************************************

C1              YQFPSYLGFRIVERWQFHYSQVIKSTR
C2              YQFPSYLGFRIVERWQFHYSQVIKSTR
C3              YQFPSYLGFRIVERWQFHYSQVIKSTR
C4              YQFPSYLGFRIVERWQFHYSQVIKSTR
C5              YQFPSYLGFRIVERWQFHYSQVIKSTR
C6              YQFPSYLGFRIVERWQFHYSQVIKSTR
                ***************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.81 C1	 C6	 99.81
TOP	    5    0	 99.81 C6	 C1	 99.81
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.81 C2	 C6	 99.81
TOP	    5    1	 99.81 C6	 C2	 99.81
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.81 C3	 C6	 99.81
TOP	    5    2	 99.81 C6	 C3	 99.81
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.81 C4	 C6	 99.81
TOP	    5    3	 99.81 C6	 C4	 99.81
BOT	    4    5	 99.81 C5	 C6	 99.81
TOP	    5    4	 99.81 C6	 C5	 99.81
AVG	 0	 C1	  *	 99.96
AVG	 1	 C2	  *	 99.96
AVG	 2	 C3	  *	 99.96
AVG	 3	 C4	  *	 99.96
AVG	 4	 C5	  *	 99.96
AVG	 5	 C6	  *	 99.81
TOT	 TOT	  *	 99.94
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
C2              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
C3              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
C4              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
C5              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
C6              GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
                **************************************************

C1              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
C2              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
C3              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
C4              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
C5              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
C6              CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
                **************************************************

C1              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
C2              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
C3              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
C4              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
C5              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
C6              TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
                **************************************************

C1              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
C2              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
C3              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
C4              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
C5              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
C6              CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
                **************************************************

C1              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
C2              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
C3              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
C4              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
C5              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
C6              CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
                **************************************************

C1              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
C2              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
C3              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
C4              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
C5              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
C6              GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
                **************************************************

C1              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
C2              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
C3              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
C4              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
C5              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
C6              GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
                **************************************************

C1              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
C2              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
C3              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
C4              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
C5              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
C6              CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
                **************************************************

C1              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
C2              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
C3              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
C4              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
C5              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
C6              ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
                **************************************************

C1              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
C2              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
C3              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
C4              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
C5              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
C6              GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
                **************************************************

C1              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
C2              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
C3              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
C4              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
C5              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
C6              GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
                **************************************************

C1              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
C2              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
C3              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
C4              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
C5              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
C6              ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
                **************************************************

C1              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
C2              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
C3              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
C4              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
C5              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
C6              CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
                **************************************************

C1              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
C2              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
C3              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
C4              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
C5              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
C6              TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
                **************************************************

C1              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
C2              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
C3              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
C4              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
C5              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
C6              GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
                **************************************************

C1              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
C2              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
C3              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
C4              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
C5              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
C6              GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
                **************************************************

C1              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
C2              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
C3              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
C4              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
C5              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
C6              CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
                **************************************************

C1              TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
C2              TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
C3              TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
C4              TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
C5              TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
C6              TCGTCGCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
                ***** ********************************************

C1              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
C2              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
C3              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
C4              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
C5              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
C6              GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
                **************************************************

C1              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
C2              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
C3              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
C4              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
C5              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
C6              CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
                **************************************************

C1              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
C2              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
C3              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
C4              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
C5              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
C6              GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
                **************************************************

C1              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
C2              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
C3              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
C4              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
C5              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
C6              ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
                **************************************************

C1              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
C2              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
C3              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
C4              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
C5              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
C6              GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
                **************************************************

C1              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
C2              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
C3              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
C4              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
C5              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
C6              ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
                **************************************************

C1              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
C2              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
C3              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
C4              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
C5              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
C6              CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
                **************************************************

C1              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
C2              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
C3              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
C4              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
C5              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
C6              GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
                **************************************************

C1              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
C2              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
C3              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
C4              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
C5              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
C6              CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
                **************************************************

C1              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
C2              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
C3              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
C4              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
C5              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
C6              TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
                **************************************************

C1              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
C2              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
C3              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
C4              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
C5              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
C6              CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
                **************************************************

C1              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
C2              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
C3              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
C4              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
C5              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
C6              AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
                **************************************************

C1              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
C2              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
C3              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
C4              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
C5              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
C6              TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
                **************************************************

C1              CCACTATTCGCAGGTCATCAAGTCAACACGG
C2              CCACTATTCGCAGGTCATCAAGTCAACACGG
C3              CCACTATTCGCAGGTCATCAAGTCAACACGG
C4              CCACTATTCGCAGGTCATCAAGTCAACACGG
C5              CCACTATTCGCAGGTCATCAAGTCAACACGG
C6              CCACTATTCGCAGGTCATCAAGTCAACACGG
                *******************************



>C1
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C2
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C3
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C4
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C5
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCCCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C6
GTGACAAGCATCATGTCTGTATCGGCACTTGAGCAGAGCGCAGCGGACGT
CGGTGACAATTCGGCGCGCCAACATGCGCACGGCGCGCTACCCGACTCAT
TGGCAATTGCGATGCTGGCCACAGTCATCAGTGGGGCCTGGGCCAGTAGG
CCTTCGCTCTGGTTCGATGAGGCCGCAACAATATCGGCTTCAGCGAGTCG
CACTGTGCCAGAACTATGGAGATTGCTGAGCCACATCGATGCTGTGCACG
GCTTGTACTACCTGCTGATGCACGGCTGGTTCGCGATATTTCCCTCGACT
GAATTCTGGTCAAGGGTTCCAAGTTGTCTGGCAATTGGGGCCGCTGCTGC
CGGCGTCACGGTTTTCACCAGACAGTTTGCCACACGGACCACTGCGGTAT
ACGCAGGCATTGTCTTCGCCATTCTGCCGCGCATCACCTGGGCCGGTATC
GAAGCACGCTCATCTGCCTTGTCAGTGGCCGCGGCCATGTGGCTGACCGT
GTTGCTCGTGGCCTCGGTACAGCGCAACAGGCCGCGGCTATGGCTGTGCT
ATGCGCTGACATTGATGCTGTCAATTTTGCTGAATCTCACCCTGGCCACG
CTGGTGCTGGTTTACGCCGTGATCCTGCCATGGCTCGCACCCAACAAATT
TCGCAATTCTCCGTTCATCTGGTGGGCGGTTACCTCGGTCGTCGCACTCG
GGACTATAACGCCGTTCATCTTGTTCGCTCATGGCCAAGTATGGCAGGTC
GACTGGATCTTCCGGGTCAGCTGGCACTACGTCTTCGACATCACACAACG
CCAGTATTTCGACCACAGCGTTTCGTTCGCGATTGCCACGGCCGTGATCA
TCGTCGCCGCGATCGCGACTCGCCTGGCTGGCTTGCGAGCCCCGGCGGGC
GACCTTCGCAGCTTGGTGATTATCTGCACTGCGTGGATCGTCATTCCCAC
CACTCTCATGGTCGGCTACTCGGCGGTCATTGAACCAGTTTACTACCCGC
GTTACCTGATCCTCACCGCTCCGGCGGCAGCTATCGTCATAGCGGTCTGC
ATTGTCACGGTCGCCCGTAAACCGTGGCCTATTGCCGGCGTCCTAGTGTT
GTTCGCTGTTGCTGCCTTTCCAAATTATCTCTTTACGCAACGCGGGCGAT
ACGCCAAAGAAGGCTGGGATTACAGTCAAGTAGCCGATGTGATCAGTTCC
CAGGCTGCGCCAGGGGACTGTCTGATCGTTGACAACACTGTGCCCTGGCG
GCCCGGGCCGATCCGCGCACTGCTGGCCGCTCGGCCGGCGGCTTTTCGAT
CGCTGATCGACATCGAACGTGGTTTCTACGGACCGACAGTCGGCACCCTG
TGGGACGGTCATGTTCCCGTGTGGTTGGTGACGGCCAAGATCAACAAGTG
CTCCACGGTCTGGACAGTCTCCGACCGAGACACATCACTGCCCGACCATC
AAGCGGGACAATTACTGTCACCAGGGCTCATATTGGGACGTGCGCCGGCG
TATCAATTTCCCAGTTATCTGGGGTTCCGCATTGTCGAGCGGTGGCAATT
CCACTATTCGCAGGTCATCAAGTCAACACGG
>C1
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C2
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C3
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C4
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C5
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVPAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR
>C6
VTSIMSVSALEQSAADVGDNSARQHAHGALPDSLAIAMLATVISGAWASR
PSLWFDEAATISASASRTVPELWRLLSHIDAVHGLYYLLMHGWFAIFPST
EFWSRVPSCLAIGAAAAGVTVFTRQFATRTTAVYAGIVFAILPRITWAGI
EARSSALSVAAAMWLTVLLVASVQRNRPRLWLCYALTLMLSILLNLTLAT
LVLVYAVILPWLAPNKFRNSPFIWWAVTSVVALGTITPFILFAHGQVWQV
DWIFRVSWHYVFDITQRQYFDHSVSFAIATAVIIVAAIATRLAGLRAPAG
DLRSLVIICTAWIVIPTTLMVGYSAVIEPVYYPRYLILTAPAAAIVIAVC
IVTVARKPWPIAGVLVLFAVAAFPNYLFTQRGRYAKEGWDYSQVADVISS
QAAPGDCLIVDNTVPWRPGPIRALLAARPAAFRSLIDIERGFYGPTVGTL
WDGHVPVWLVTAKINKCSTVWTVSDRDTSLPDHQAGQLLSPGLILGRAPA
YQFPSYLGFRIVERWQFHYSQVIKSTR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1581 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859395
      Setting output file names to "/data/6res/ML1389/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1388601476
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5319369870
      Seed = 1582068565
      Swapseed = 1579859395
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3541.754901 -- -24.965149
         Chain 2 -- -3541.756450 -- -24.965149
         Chain 3 -- -3541.756654 -- -24.965149
         Chain 4 -- -3541.756654 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3541.754901 -- -24.965149
         Chain 2 -- -3541.755105 -- -24.965149
         Chain 3 -- -3541.756654 -- -24.965149
         Chain 4 -- -3541.755105 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3541.755] (-3541.756) (-3541.757) (-3541.757) * [-3541.755] (-3541.755) (-3541.757) (-3541.755) 
        500 -- (-2209.701) (-2191.087) [-2186.456] (-2181.723) * (-2192.281) (-2202.583) (-2205.517) [-2181.619] -- 0:00:00
       1000 -- (-2186.388) [-2176.278] (-2186.220) (-2180.645) * (-2187.847) (-2201.339) [-2177.965] (-2184.779) -- 0:00:00
       1500 -- [-2181.269] (-2183.116) (-2180.352) (-2182.712) * (-2185.462) [-2184.113] (-2181.148) (-2183.726) -- 0:00:00
       2000 -- [-2184.821] (-2179.355) (-2182.470) (-2182.029) * (-2184.103) (-2194.018) (-2186.672) [-2180.136] -- 0:00:00
       2500 -- [-2177.872] (-2182.381) (-2185.520) (-2186.925) * [-2183.028] (-2184.861) (-2181.334) (-2183.899) -- 0:00:00
       3000 -- [-2176.012] (-2184.544) (-2180.242) (-2177.388) * (-2182.760) [-2184.945] (-2179.205) (-2184.146) -- 0:00:00
       3500 -- [-2177.891] (-2182.266) (-2186.318) (-2183.788) * (-2182.146) [-2180.897] (-2183.467) (-2181.510) -- 0:00:00
       4000 -- (-2189.546) (-2181.423) (-2184.616) [-2181.999] * (-2182.614) [-2183.114] (-2180.464) (-2180.867) -- 0:00:00
       4500 -- (-2181.561) (-2193.824) [-2175.384] (-2184.787) * (-2186.026) (-2180.983) (-2177.093) [-2179.453] -- 0:00:00
       5000 -- (-2183.554) (-2183.378) (-2184.427) [-2181.665] * [-2180.774] (-2179.677) (-2180.409) (-2188.812) -- 0:00:00

      Average standard deviation of split frequencies: 0.112239

       5500 -- (-2177.808) [-2175.983] (-2179.415) (-2193.083) * (-2180.216) (-2190.517) [-2179.996] (-2183.561) -- 0:00:00
       6000 -- [-2183.177] (-2182.439) (-2176.485) (-2189.523) * [-2176.418] (-2186.377) (-2179.728) (-2183.897) -- 0:00:00
       6500 -- (-2183.009) (-2178.144) [-2187.933] (-2188.041) * [-2180.759] (-2179.931) (-2179.381) (-2181.920) -- 0:00:00
       7000 -- [-2182.701] (-2184.697) (-2179.495) (-2181.907) * (-2179.605) [-2174.263] (-2183.523) (-2189.483) -- 0:00:00
       7500 -- (-2182.375) (-2179.729) (-2190.119) [-2181.451] * (-2178.763) (-2177.081) (-2182.067) [-2180.785] -- 0:00:00
       8000 -- (-2184.188) (-2179.518) [-2180.206] (-2176.071) * (-2190.744) (-2178.525) (-2181.023) [-2178.804] -- 0:00:00
       8500 -- (-2184.157) (-2181.598) [-2181.026] (-2180.883) * (-2189.628) (-2179.304) [-2184.508] (-2180.839) -- 0:00:00
       9000 -- [-2179.495] (-2177.148) (-2178.057) (-2179.713) * (-2186.101) (-2177.132) [-2179.962] (-2181.084) -- 0:00:00
       9500 -- (-2176.578) (-2176.620) (-2189.397) [-2176.324] * (-2185.920) (-2176.873) [-2181.183] (-2180.659) -- 0:00:00
      10000 -- (-2187.096) (-2176.424) [-2179.727] (-2179.786) * (-2185.866) (-2174.798) [-2180.237] (-2180.067) -- 0:00:00

      Average standard deviation of split frequencies: 0.086179

      10500 -- (-2190.328) (-2183.113) (-2185.488) [-2184.417] * [-2185.474] (-2177.452) (-2181.360) (-2178.239) -- 0:00:00
      11000 -- (-2186.648) [-2180.120] (-2180.961) (-2181.235) * (-2177.678) (-2177.776) (-2186.965) [-2183.448] -- 0:00:00
      11500 -- (-2182.148) (-2180.374) (-2178.012) [-2180.631] * (-2184.798) (-2179.596) [-2181.150] (-2179.909) -- 0:00:00
      12000 -- [-2182.365] (-2186.590) (-2183.172) (-2181.738) * (-2182.725) (-2177.944) (-2183.976) [-2176.482] -- 0:00:00
      12500 -- (-2184.571) (-2186.137) (-2180.298) [-2181.567] * (-2179.353) (-2177.946) [-2177.756] (-2177.134) -- 0:01:19
      13000 -- [-2180.783] (-2182.633) (-2175.796) (-2186.476) * (-2183.937) (-2181.038) [-2179.961] (-2178.928) -- 0:01:15
      13500 -- (-2184.676) [-2177.100] (-2176.208) (-2186.975) * (-2184.089) (-2176.983) (-2178.965) [-2181.359] -- 0:01:13
      14000 -- (-2182.430) (-2180.347) [-2176.887] (-2183.852) * (-2185.753) (-2178.581) [-2183.096] (-2183.457) -- 0:01:10
      14500 -- (-2179.657) (-2190.985) (-2179.078) [-2178.180] * (-2186.631) (-2180.347) [-2178.313] (-2181.482) -- 0:01:07
      15000 -- [-2173.270] (-2179.719) (-2177.832) (-2178.700) * (-2185.098) (-2176.019) (-2182.497) [-2175.576] -- 0:01:05

      Average standard deviation of split frequencies: 0.069238

      15500 -- (-2179.563) (-2182.231) [-2183.278] (-2183.533) * (-2180.532) (-2179.200) [-2175.051] (-2182.583) -- 0:01:03
      16000 -- (-2179.554) [-2174.131] (-2178.625) (-2182.150) * (-2181.779) (-2175.964) [-2177.019] (-2185.480) -- 0:01:01
      16500 -- (-2175.382) (-2184.486) [-2183.117] (-2179.458) * (-2177.941) (-2177.085) [-2180.481] (-2175.221) -- 0:00:59
      17000 -- [-2177.565] (-2176.954) (-2177.459) (-2179.692) * (-2179.461) (-2174.948) [-2174.458] (-2177.643) -- 0:00:57
      17500 -- (-2179.904) (-2180.435) [-2176.697] (-2177.404) * (-2177.967) (-2176.965) [-2176.097] (-2176.486) -- 0:00:56
      18000 -- (-2177.412) [-2183.562] (-2185.593) (-2175.721) * (-2184.748) (-2181.332) [-2186.043] (-2177.719) -- 0:00:54
      18500 -- (-2182.349) (-2185.058) [-2181.799] (-2176.331) * (-2188.410) (-2179.342) (-2184.333) [-2177.662] -- 0:00:53
      19000 -- [-2182.302] (-2182.268) (-2180.189) (-2178.008) * (-2176.910) (-2179.069) (-2180.861) [-2177.903] -- 0:00:51
      19500 -- [-2177.030] (-2184.484) (-2189.179) (-2185.835) * (-2178.049) (-2177.124) (-2181.782) [-2175.172] -- 0:00:50
      20000 -- (-2187.289) [-2176.142] (-2179.732) (-2186.797) * (-2181.539) (-2177.412) (-2184.896) [-2177.831] -- 0:00:49

      Average standard deviation of split frequencies: 0.050987

      20500 -- (-2183.840) (-2176.738) [-2180.243] (-2186.465) * (-2187.181) (-2176.756) [-2178.877] (-2176.981) -- 0:00:47
      21000 -- [-2180.558] (-2180.880) (-2184.491) (-2175.156) * (-2189.065) (-2176.030) (-2177.397) [-2175.201] -- 0:00:46
      21500 -- (-2183.692) (-2184.744) [-2184.277] (-2177.796) * (-2185.873) (-2175.743) [-2176.057] (-2176.387) -- 0:00:45
      22000 -- (-2181.097) (-2178.116) [-2175.130] (-2176.407) * (-2200.048) (-2180.566) [-2175.195] (-2175.974) -- 0:00:44
      22500 -- [-2180.981] (-2182.606) (-2184.434) (-2178.442) * (-2179.873) (-2177.903) (-2182.175) [-2176.569] -- 0:00:43
      23000 -- (-2182.349) [-2177.540] (-2174.118) (-2176.544) * [-2177.477] (-2177.308) (-2182.683) (-2175.586) -- 0:00:42
      23500 -- (-2181.797) [-2179.581] (-2180.764) (-2176.628) * [-2178.217] (-2178.204) (-2178.467) (-2175.818) -- 0:00:41
      24000 -- (-2185.706) [-2178.336] (-2182.588) (-2177.040) * [-2177.921] (-2179.065) (-2176.578) (-2175.377) -- 0:00:40
      24500 -- [-2183.461] (-2184.183) (-2178.371) (-2177.713) * (-2184.369) (-2176.923) [-2181.956] (-2178.152) -- 0:00:39
      25000 -- (-2176.493) (-2185.099) (-2176.190) [-2179.830] * (-2177.487) (-2179.434) [-2175.847] (-2176.439) -- 0:00:39

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-2184.445) (-2195.876) [-2175.156] (-2176.739) * (-2174.078) (-2177.207) [-2176.113] (-2177.650) -- 0:00:38
      26000 -- (-2182.708) (-2177.503) (-2175.995) [-2176.552] * (-2183.121) (-2176.267) [-2184.212] (-2181.578) -- 0:01:14
      26500 -- (-2178.976) (-2176.437) [-2176.170] (-2176.068) * [-2177.191] (-2176.997) (-2178.696) (-2180.551) -- 0:01:13
      27000 -- (-2177.743) (-2180.035) [-2177.453] (-2174.467) * [-2182.554] (-2176.287) (-2177.271) (-2176.422) -- 0:01:12
      27500 -- (-2182.590) (-2178.801) (-2175.691) [-2174.023] * (-2181.112) (-2175.431) [-2178.929] (-2176.879) -- 0:01:10
      28000 -- (-2178.263) (-2175.452) [-2175.855] (-2181.998) * [-2177.830] (-2176.378) (-2179.922) (-2178.030) -- 0:01:09
      28500 -- (-2173.643) [-2179.988] (-2177.020) (-2177.969) * [-2176.735] (-2178.099) (-2179.603) (-2175.115) -- 0:01:08
      29000 -- (-2174.906) (-2175.039) (-2180.836) [-2175.287] * (-2176.680) (-2175.406) [-2186.607] (-2176.902) -- 0:01:06
      29500 -- (-2174.797) [-2175.794] (-2176.725) (-2176.507) * [-2182.092] (-2175.145) (-2177.581) (-2174.439) -- 0:01:05
      30000 -- (-2179.364) [-2174.844] (-2176.806) (-2175.051) * [-2178.058] (-2175.167) (-2186.625) (-2179.024) -- 0:01:04

      Average standard deviation of split frequencies: 0.044578

      30500 -- (-2178.808) [-2174.007] (-2177.589) (-2176.359) * (-2175.792) (-2174.246) [-2176.013] (-2178.223) -- 0:01:03
      31000 -- (-2175.622) [-2174.508] (-2176.586) (-2176.797) * (-2179.674) (-2175.400) [-2179.098] (-2177.606) -- 0:01:02
      31500 -- [-2174.330] (-2176.738) (-2176.230) (-2176.154) * (-2176.605) (-2174.204) [-2184.536] (-2175.718) -- 0:01:01
      32000 -- [-2175.783] (-2175.847) (-2176.284) (-2175.152) * [-2176.698] (-2173.440) (-2180.308) (-2180.223) -- 0:01:00
      32500 -- [-2176.528] (-2173.808) (-2177.478) (-2176.152) * [-2175.231] (-2175.255) (-2178.522) (-2175.645) -- 0:00:59
      33000 -- (-2176.113) [-2176.317] (-2177.943) (-2176.371) * (-2176.861) (-2175.859) (-2178.309) [-2179.652] -- 0:00:58
      33500 -- (-2175.626) (-2178.118) (-2177.854) [-2174.399] * (-2178.421) [-2175.984] (-2186.223) (-2181.166) -- 0:00:57
      34000 -- (-2179.618) [-2174.967] (-2177.810) (-2173.901) * [-2181.336] (-2176.132) (-2184.792) (-2178.117) -- 0:00:56
      34500 -- (-2176.326) (-2175.171) (-2175.089) [-2174.972] * (-2184.786) (-2175.949) [-2178.434] (-2177.132) -- 0:00:55
      35000 -- [-2173.384] (-2174.510) (-2175.165) (-2176.202) * (-2181.348) [-2175.472] (-2175.723) (-2174.871) -- 0:00:55

      Average standard deviation of split frequencies: 0.042921

      35500 -- (-2173.816) (-2175.967) (-2181.132) [-2176.324] * (-2176.794) (-2176.822) [-2185.001] (-2176.625) -- 0:00:54
      36000 -- (-2174.948) (-2180.765) (-2181.097) [-2173.821] * (-2186.611) (-2176.895) [-2188.523] (-2176.190) -- 0:00:53
      36500 -- (-2176.004) (-2177.584) (-2176.810) [-2180.032] * (-2176.220) (-2183.185) (-2183.357) [-2175.408] -- 0:00:52
      37000 -- (-2174.290) [-2177.250] (-2178.461) (-2175.448) * [-2180.404] (-2175.134) (-2183.032) (-2174.770) -- 0:00:52
      37500 -- (-2175.165) [-2175.068] (-2177.817) (-2176.592) * [-2178.541] (-2174.685) (-2179.274) (-2175.918) -- 0:00:51
      38000 -- (-2176.753) (-2179.473) [-2180.212] (-2177.708) * [-2176.757] (-2174.861) (-2175.635) (-2175.305) -- 0:00:50
      38500 -- (-2180.213) (-2177.699) [-2176.324] (-2174.654) * (-2174.811) [-2175.129] (-2175.987) (-2178.361) -- 0:00:49
      39000 -- (-2177.036) (-2174.936) (-2174.769) [-2172.982] * (-2179.087) [-2177.136] (-2177.081) (-2175.481) -- 0:00:49
      39500 -- (-2175.058) (-2175.817) (-2175.809) [-2172.802] * [-2182.741] (-2178.368) (-2174.749) (-2176.072) -- 0:00:48
      40000 -- (-2174.785) (-2174.712) [-2175.473] (-2177.910) * [-2185.695] (-2178.598) (-2174.881) (-2175.365) -- 0:01:12

      Average standard deviation of split frequencies: 0.044436

      40500 -- [-2176.248] (-2174.542) (-2175.212) (-2174.906) * [-2177.615] (-2175.769) (-2174.188) (-2175.763) -- 0:01:11
      41000 -- (-2175.239) (-2176.285) (-2175.212) [-2173.924] * [-2177.520] (-2179.845) (-2174.947) (-2177.938) -- 0:01:10
      41500 -- (-2175.890) (-2175.028) [-2175.027] (-2174.271) * [-2180.742] (-2177.958) (-2174.244) (-2177.444) -- 0:01:09
      42000 -- (-2176.418) (-2177.420) (-2175.137) [-2176.665] * [-2175.436] (-2177.652) (-2174.300) (-2175.179) -- 0:01:08
      42500 -- (-2184.024) [-2175.991] (-2175.604) (-2175.446) * (-2178.253) (-2178.107) [-2175.051] (-2177.787) -- 0:01:07
      43000 -- (-2174.757) (-2176.007) [-2173.341] (-2178.021) * [-2183.197] (-2180.321) (-2175.476) (-2175.469) -- 0:01:06
      43500 -- (-2176.512) [-2174.398] (-2175.198) (-2178.607) * [-2175.823] (-2180.724) (-2175.032) (-2179.253) -- 0:01:05
      44000 -- (-2176.156) (-2174.174) [-2176.357] (-2178.517) * (-2182.965) (-2178.630) [-2175.182] (-2178.259) -- 0:01:05
      44500 -- (-2175.381) (-2173.789) (-2180.086) [-2177.586] * (-2182.748) (-2181.237) [-2174.919] (-2176.748) -- 0:01:04
      45000 -- (-2175.392) [-2178.483] (-2176.818) (-2179.316) * (-2178.876) (-2179.785) (-2176.931) [-2175.532] -- 0:01:03

      Average standard deviation of split frequencies: 0.036600

      45500 -- (-2176.732) (-2177.300) [-2176.169] (-2178.202) * [-2174.834] (-2180.027) (-2175.840) (-2176.597) -- 0:01:02
      46000 -- [-2176.723] (-2174.629) (-2177.628) (-2175.602) * (-2177.832) (-2179.881) [-2178.828] (-2177.099) -- 0:01:02
      46500 -- (-2176.379) (-2174.620) [-2174.543] (-2176.934) * [-2176.696] (-2181.489) (-2179.794) (-2177.045) -- 0:01:01
      47000 -- (-2183.836) (-2174.785) (-2175.120) [-2178.851] * [-2179.907] (-2179.667) (-2176.981) (-2174.262) -- 0:01:00
      47500 -- (-2178.360) [-2175.130] (-2175.536) (-2177.378) * [-2173.514] (-2175.711) (-2176.609) (-2176.475) -- 0:01:00
      48000 -- (-2179.167) (-2176.695) (-2175.128) [-2179.023] * (-2180.246) [-2176.046] (-2174.219) (-2176.759) -- 0:00:59
      48500 -- (-2177.582) (-2175.595) (-2177.942) [-2176.542] * (-2191.515) [-2178.734] (-2175.105) (-2178.597) -- 0:00:58
      49000 -- [-2177.475] (-2178.134) (-2178.117) (-2178.441) * (-2180.666) [-2175.852] (-2175.364) (-2175.116) -- 0:00:58
      49500 -- (-2178.394) (-2184.218) (-2176.380) [-2178.252] * (-2182.872) (-2175.848) [-2173.527] (-2176.693) -- 0:00:57
      50000 -- [-2176.032] (-2177.040) (-2178.169) (-2177.816) * (-2181.026) [-2176.925] (-2174.778) (-2176.292) -- 0:00:57

      Average standard deviation of split frequencies: 0.030570

      50500 -- (-2177.434) [-2176.635] (-2177.960) (-2176.710) * (-2178.254) (-2175.335) (-2180.065) [-2173.197] -- 0:00:56
      51000 -- (-2179.038) (-2176.420) [-2175.746] (-2177.151) * (-2174.212) [-2176.514] (-2180.826) (-2174.009) -- 0:00:55
      51500 -- (-2175.491) [-2174.970] (-2175.995) (-2175.016) * (-2179.113) (-2179.260) [-2174.947] (-2176.059) -- 0:00:55
      52000 -- (-2176.016) (-2174.094) (-2182.043) [-2174.998] * (-2178.219) (-2177.383) (-2176.397) [-2176.741] -- 0:00:54
      52500 -- (-2179.449) [-2174.081] (-2177.564) (-2176.791) * [-2176.091] (-2176.205) (-2174.915) (-2179.064) -- 0:00:54
      53000 -- (-2177.390) (-2175.640) [-2176.108] (-2176.461) * (-2178.318) (-2176.224) [-2174.372] (-2178.463) -- 0:00:53
      53500 -- (-2178.321) (-2176.860) (-2175.042) [-2175.844] * (-2178.293) (-2175.079) [-2173.861] (-2178.695) -- 0:01:10
      54000 -- [-2179.604] (-2174.796) (-2181.410) (-2176.231) * [-2186.705] (-2179.038) (-2175.916) (-2177.748) -- 0:01:10
      54500 -- [-2177.145] (-2177.372) (-2177.075) (-2176.331) * (-2184.080) (-2177.691) [-2174.727] (-2177.738) -- 0:01:09
      55000 -- (-2179.366) (-2179.123) (-2176.766) [-2179.972] * (-2174.137) (-2177.226) (-2173.638) [-2177.800] -- 0:01:08

      Average standard deviation of split frequencies: 0.029080

      55500 -- (-2175.560) [-2178.702] (-2180.326) (-2176.436) * (-2180.633) (-2177.725) [-2173.550] (-2177.690) -- 0:01:08
      56000 -- [-2176.319] (-2179.195) (-2174.852) (-2178.650) * [-2175.553] (-2177.303) (-2174.447) (-2177.554) -- 0:01:07
      56500 -- (-2177.755) [-2174.687] (-2173.486) (-2175.600) * (-2177.784) [-2177.302] (-2173.198) (-2179.757) -- 0:01:06
      57000 -- (-2175.419) (-2176.319) [-2174.848] (-2178.276) * (-2178.503) (-2176.400) (-2175.873) [-2175.954] -- 0:01:06
      57500 -- (-2174.933) (-2176.882) (-2176.703) [-2176.179] * (-2178.022) (-2176.418) [-2178.044] (-2175.799) -- 0:01:05
      58000 -- (-2175.384) [-2178.815] (-2176.432) (-2175.938) * [-2176.544] (-2177.660) (-2176.958) (-2178.583) -- 0:01:04
      58500 -- (-2178.852) [-2176.913] (-2179.761) (-2178.134) * (-2180.808) (-2179.499) [-2176.385] (-2177.209) -- 0:01:04
      59000 -- (-2175.711) (-2177.747) [-2176.294] (-2178.559) * (-2183.008) (-2179.283) [-2174.443] (-2179.865) -- 0:01:03
      59500 -- (-2176.859) (-2178.643) (-2175.867) [-2176.845] * (-2175.185) (-2176.846) (-2175.498) [-2177.365] -- 0:01:03
      60000 -- (-2175.268) (-2176.480) [-2175.675] (-2180.654) * [-2179.541] (-2175.454) (-2175.807) (-2175.892) -- 0:01:02

      Average standard deviation of split frequencies: 0.032494

      60500 -- (-2178.447) [-2176.384] (-2175.274) (-2181.590) * [-2179.396] (-2175.754) (-2176.105) (-2176.001) -- 0:01:02
      61000 -- [-2175.752] (-2175.750) (-2174.354) (-2179.205) * (-2183.052) [-2174.871] (-2178.022) (-2176.415) -- 0:01:01
      61500 -- (-2181.545) (-2178.007) (-2175.119) [-2179.819] * (-2177.568) (-2178.823) [-2175.984] (-2177.289) -- 0:01:01
      62000 -- (-2177.423) [-2176.404] (-2176.605) (-2178.220) * (-2176.046) (-2180.639) (-2175.035) [-2175.629] -- 0:01:00
      62500 -- (-2175.210) [-2176.209] (-2176.703) (-2178.061) * (-2182.430) (-2176.593) [-2175.836] (-2183.282) -- 0:01:00
      63000 -- [-2178.482] (-2173.351) (-2175.800) (-2178.749) * [-2181.356] (-2176.517) (-2175.626) (-2178.736) -- 0:00:59
      63500 -- (-2176.692) (-2177.177) [-2176.393] (-2174.705) * (-2191.988) [-2174.741] (-2176.029) (-2184.419) -- 0:00:58
      64000 -- (-2176.452) (-2176.884) [-2177.964] (-2176.036) * (-2183.285) (-2178.658) [-2175.976] (-2176.828) -- 0:00:58
      64500 -- (-2176.162) (-2176.086) (-2176.524) [-2175.195] * (-2179.757) (-2176.041) [-2179.101] (-2177.464) -- 0:00:58
      65000 -- (-2176.061) (-2176.708) (-2177.946) [-2175.239] * (-2175.033) (-2177.869) [-2177.466] (-2176.291) -- 0:00:57

      Average standard deviation of split frequencies: 0.030193

      65500 -- (-2178.370) (-2178.371) (-2179.264) [-2174.961] * (-2176.780) [-2177.357] (-2179.093) (-2177.959) -- 0:00:57
      66000 -- (-2176.148) [-2175.430] (-2178.315) (-2177.547) * (-2176.231) [-2176.357] (-2175.897) (-2176.829) -- 0:00:56
      66500 -- [-2175.995] (-2177.709) (-2177.544) (-2174.989) * (-2178.529) (-2175.182) [-2178.107] (-2180.556) -- 0:00:56
      67000 -- (-2174.718) [-2176.047] (-2177.365) (-2174.821) * (-2178.134) (-2176.081) [-2174.418] (-2177.474) -- 0:00:55
      67500 -- [-2175.994] (-2175.327) (-2176.540) (-2174.875) * (-2177.323) [-2177.147] (-2173.556) (-2178.671) -- 0:00:55
      68000 -- [-2178.225] (-2176.378) (-2174.240) (-2175.454) * (-2178.259) [-2176.214] (-2176.319) (-2177.524) -- 0:01:08
      68500 -- [-2175.468] (-2176.386) (-2175.539) (-2175.328) * [-2178.679] (-2177.854) (-2173.218) (-2175.781) -- 0:01:07
      69000 -- (-2174.884) [-2178.120] (-2178.224) (-2176.945) * [-2178.964] (-2176.913) (-2174.675) (-2175.730) -- 0:01:07
      69500 -- [-2175.514] (-2177.168) (-2179.560) (-2176.206) * (-2174.600) (-2176.825) [-2173.810] (-2176.425) -- 0:01:06
      70000 -- (-2176.502) (-2175.996) (-2175.974) [-2176.392] * [-2175.426] (-2178.434) (-2175.261) (-2175.535) -- 0:01:06

      Average standard deviation of split frequencies: 0.032083

      70500 -- (-2178.163) (-2180.530) (-2177.453) [-2177.237] * (-2178.424) [-2175.554] (-2175.438) (-2176.238) -- 0:01:05
      71000 -- (-2178.837) (-2176.769) [-2177.239] (-2175.040) * (-2177.372) [-2176.040] (-2173.690) (-2173.595) -- 0:01:05
      71500 -- [-2176.551] (-2175.934) (-2175.408) (-2179.292) * [-2178.202] (-2178.812) (-2174.064) (-2175.886) -- 0:01:04
      72000 -- (-2177.504) (-2175.765) [-2178.795] (-2178.573) * (-2180.203) [-2175.573] (-2175.308) (-2180.329) -- 0:01:04
      72500 -- (-2175.240) [-2173.399] (-2175.616) (-2174.418) * (-2180.190) (-2178.630) (-2179.156) [-2178.041] -- 0:01:03
      73000 -- (-2175.835) [-2175.609] (-2174.988) (-2177.449) * (-2175.577) (-2178.156) [-2177.312] (-2176.456) -- 0:01:03
      73500 -- [-2175.110] (-2174.883) (-2175.914) (-2175.946) * [-2177.378] (-2175.135) (-2173.885) (-2176.515) -- 0:01:03
      74000 -- (-2175.034) [-2175.265] (-2175.996) (-2175.477) * (-2175.926) (-2175.381) [-2175.685] (-2179.807) -- 0:01:02
      74500 -- (-2176.449) [-2177.012] (-2176.054) (-2174.589) * (-2175.787) [-2176.693] (-2176.210) (-2178.432) -- 0:01:02
      75000 -- [-2177.122] (-2175.034) (-2176.204) (-2176.792) * [-2174.863] (-2176.276) (-2176.187) (-2179.042) -- 0:01:01

      Average standard deviation of split frequencies: 0.032564

      75500 -- (-2176.708) (-2174.176) [-2176.145] (-2178.089) * [-2175.244] (-2176.898) (-2175.725) (-2178.862) -- 0:01:01
      76000 -- (-2179.493) (-2178.262) [-2176.104] (-2177.412) * (-2177.078) (-2176.379) (-2175.967) [-2176.157] -- 0:01:00
      76500 -- (-2180.697) [-2174.138] (-2180.727) (-2181.989) * (-2175.874) (-2176.042) [-2175.704] (-2177.166) -- 0:01:00
      77000 -- (-2179.132) [-2175.714] (-2180.804) (-2176.001) * (-2176.796) [-2177.549] (-2176.827) (-2181.927) -- 0:00:59
      77500 -- (-2178.982) [-2177.590] (-2173.445) (-2177.815) * (-2177.774) [-2177.392] (-2179.376) (-2178.859) -- 0:00:59
      78000 -- (-2179.564) [-2174.459] (-2175.256) (-2175.859) * (-2174.753) [-2176.885] (-2179.466) (-2176.833) -- 0:00:59
      78500 -- (-2183.501) [-2175.628] (-2177.553) (-2176.026) * (-2178.741) [-2175.558] (-2179.527) (-2176.934) -- 0:00:58
      79000 -- (-2179.675) [-2178.175] (-2177.703) (-2175.308) * (-2178.290) [-2175.764] (-2176.731) (-2176.923) -- 0:00:58
      79500 -- [-2176.842] (-2175.303) (-2182.807) (-2175.270) * (-2175.676) [-2175.455] (-2176.047) (-2179.708) -- 0:00:57
      80000 -- [-2177.131] (-2177.456) (-2183.717) (-2176.018) * (-2175.608) (-2174.930) [-2175.874] (-2176.832) -- 0:00:57

      Average standard deviation of split frequencies: 0.027758

      80500 -- (-2179.170) (-2176.719) (-2178.792) [-2175.556] * (-2176.223) [-2177.964] (-2175.633) (-2175.925) -- 0:00:57
      81000 -- (-2179.806) (-2175.977) [-2176.295] (-2176.708) * (-2177.605) [-2174.205] (-2174.141) (-2177.691) -- 0:00:56
      81500 -- (-2182.882) (-2178.020) (-2176.123) [-2177.221] * (-2176.083) (-2177.211) (-2173.067) [-2177.506] -- 0:00:56
      82000 -- (-2182.388) [-2175.520] (-2176.016) (-2177.441) * (-2184.315) (-2174.617) (-2176.350) [-2174.963] -- 0:01:07
      82500 -- (-2176.220) [-2173.251] (-2177.078) (-2175.278) * (-2177.373) [-2176.291] (-2176.509) (-2173.618) -- 0:01:06
      83000 -- (-2176.527) [-2174.720] (-2177.077) (-2175.538) * (-2176.330) (-2174.755) [-2176.805] (-2177.382) -- 0:01:06
      83500 -- (-2179.920) [-2177.167] (-2177.816) (-2177.110) * (-2176.454) [-2175.306] (-2175.751) (-2176.430) -- 0:01:05
      84000 -- (-2180.487) [-2174.300] (-2183.320) (-2177.201) * (-2173.726) (-2177.404) [-2178.474] (-2176.772) -- 0:01:05
      84500 -- (-2180.568) (-2180.678) (-2182.554) [-2179.422] * (-2176.095) (-2176.196) [-2176.437] (-2181.245) -- 0:01:05
      85000 -- (-2179.902) (-2177.445) (-2181.846) [-2174.598] * (-2177.727) (-2175.959) (-2176.125) [-2179.453] -- 0:01:04

      Average standard deviation of split frequencies: 0.026885

      85500 -- (-2177.007) (-2175.702) (-2182.749) [-2175.602] * (-2175.971) [-2176.818] (-2175.799) (-2178.336) -- 0:01:04
      86000 -- (-2174.640) [-2173.676] (-2183.944) (-2176.809) * (-2175.501) (-2175.629) (-2175.723) [-2178.291] -- 0:01:03
      86500 -- (-2181.403) (-2176.937) (-2179.201) [-2174.308] * [-2176.398] (-2176.024) (-2179.873) (-2174.990) -- 0:01:03
      87000 -- [-2175.577] (-2180.615) (-2179.239) (-2178.105) * (-2176.604) (-2176.048) (-2176.543) [-2174.026] -- 0:01:02
      87500 -- [-2176.495] (-2178.742) (-2175.225) (-2177.145) * (-2176.965) (-2178.752) [-2176.415] (-2175.288) -- 0:01:02
      88000 -- [-2174.859] (-2175.680) (-2175.210) (-2179.778) * (-2176.779) [-2178.497] (-2176.464) (-2177.129) -- 0:01:02
      88500 -- [-2174.839] (-2176.476) (-2175.345) (-2175.763) * (-2174.962) [-2177.184] (-2175.886) (-2175.508) -- 0:01:01
      89000 -- [-2177.095] (-2175.793) (-2175.420) (-2176.628) * (-2176.775) (-2176.761) (-2176.291) [-2174.197] -- 0:01:01
      89500 -- [-2176.382] (-2174.305) (-2175.853) (-2174.994) * (-2175.195) (-2177.210) (-2175.818) [-2176.679] -- 0:01:01
      90000 -- (-2177.452) (-2173.102) [-2176.288] (-2176.894) * (-2174.886) (-2175.290) [-2176.093] (-2176.793) -- 0:01:00

      Average standard deviation of split frequencies: 0.025006

      90500 -- (-2179.614) [-2176.209] (-2176.288) (-2174.783) * (-2175.290) (-2173.857) (-2175.284) [-2177.716] -- 0:01:00
      91000 -- [-2176.843] (-2179.121) (-2175.923) (-2175.308) * (-2175.364) (-2178.058) [-2175.043] (-2178.429) -- 0:00:59
      91500 -- (-2175.573) [-2175.561] (-2177.268) (-2175.249) * [-2174.883] (-2175.935) (-2175.342) (-2176.015) -- 0:00:59
      92000 -- (-2176.585) [-2174.580] (-2180.582) (-2176.603) * (-2175.614) (-2175.337) (-2175.396) [-2175.028] -- 0:00:59
      92500 -- (-2176.904) (-2174.531) [-2175.217] (-2178.004) * (-2175.479) (-2175.667) (-2179.687) [-2175.339] -- 0:00:58
      93000 -- (-2176.522) (-2176.816) (-2176.477) [-2175.632] * (-2176.693) [-2175.410] (-2175.918) (-2174.940) -- 0:00:58
      93500 -- (-2175.098) (-2178.569) (-2178.229) [-2175.653] * (-2176.074) (-2175.945) (-2174.634) [-2176.476] -- 0:00:58
      94000 -- [-2175.524] (-2176.869) (-2178.395) (-2175.498) * (-2176.492) (-2175.701) [-2174.993] (-2174.805) -- 0:00:57
      94500 -- (-2176.565) (-2175.602) [-2178.029] (-2174.952) * (-2181.905) (-2175.587) (-2175.175) [-2175.646] -- 0:00:57
      95000 -- (-2173.568) (-2175.395) [-2178.650] (-2175.608) * [-2174.692] (-2175.505) (-2174.064) (-2174.733) -- 0:00:57

      Average standard deviation of split frequencies: 0.023660

      95500 -- (-2175.529) (-2175.348) [-2175.295] (-2175.909) * (-2176.877) (-2175.540) (-2176.822) [-2175.446] -- 0:00:56
      96000 -- [-2177.089] (-2174.454) (-2175.425) (-2176.469) * (-2177.080) (-2175.682) [-2176.466] (-2177.198) -- 0:00:56
      96500 -- [-2175.698] (-2177.109) (-2175.324) (-2176.677) * [-2174.499] (-2175.654) (-2177.664) (-2176.575) -- 0:01:05
      97000 -- (-2176.423) (-2176.721) (-2178.686) [-2181.143] * [-2176.959] (-2178.688) (-2177.716) (-2174.899) -- 0:01:05
      97500 -- [-2177.173] (-2177.720) (-2178.527) (-2177.636) * (-2176.106) [-2175.819] (-2179.308) (-2175.732) -- 0:01:04
      98000 -- (-2174.908) (-2177.666) [-2175.985] (-2180.115) * (-2176.567) (-2176.499) [-2174.320] (-2175.468) -- 0:01:04
      98500 -- (-2176.580) (-2177.557) (-2177.887) [-2178.957] * (-2178.282) (-2175.623) (-2176.951) [-2175.713] -- 0:01:04
      99000 -- (-2178.657) [-2177.965] (-2178.867) (-2175.364) * (-2177.989) (-2177.609) [-2174.681] (-2180.008) -- 0:01:03
      99500 -- [-2176.039] (-2178.377) (-2179.461) (-2176.038) * (-2177.302) [-2175.982] (-2176.016) (-2176.263) -- 0:01:03
      100000 -- (-2176.031) (-2176.267) [-2175.588] (-2177.161) * (-2177.130) (-2177.074) [-2176.228] (-2175.920) -- 0:01:02

      Average standard deviation of split frequencies: 0.027863

      100500 -- (-2177.287) (-2174.788) [-2178.169] (-2175.793) * (-2175.863) (-2177.600) [-2175.478] (-2176.429) -- 0:01:02
      101000 -- (-2178.160) (-2175.110) (-2178.741) [-2173.765] * (-2175.320) (-2177.555) [-2176.061] (-2173.871) -- 0:01:02
      101500 -- [-2177.964] (-2175.351) (-2174.075) (-2176.170) * (-2173.738) [-2177.127] (-2177.411) (-2177.288) -- 0:01:01
      102000 -- (-2175.873) (-2175.455) (-2175.842) [-2173.721] * (-2177.475) (-2176.357) [-2174.024] (-2183.262) -- 0:01:01
      102500 -- (-2176.203) (-2176.490) (-2176.582) [-2175.916] * (-2176.776) (-2175.790) [-2176.448] (-2181.781) -- 0:01:01
      103000 -- (-2175.713) (-2177.503) (-2177.113) [-2175.416] * (-2177.067) [-2174.880] (-2180.964) (-2176.618) -- 0:01:00
      103500 -- (-2177.746) (-2175.918) (-2176.038) [-2177.976] * (-2175.780) [-2174.729] (-2175.546) (-2178.016) -- 0:01:00
      104000 -- (-2177.087) [-2176.644] (-2174.955) (-2176.918) * (-2179.546) (-2176.359) (-2175.252) [-2175.278] -- 0:01:00
      104500 -- (-2173.654) (-2175.455) (-2173.908) [-2175.743] * [-2179.614] (-2177.582) (-2177.182) (-2174.050) -- 0:00:59
      105000 -- (-2175.029) [-2175.964] (-2175.914) (-2173.291) * (-2179.794) (-2176.693) (-2176.929) [-2174.200] -- 0:00:59

      Average standard deviation of split frequencies: 0.027795

      105500 -- [-2175.199] (-2176.218) (-2178.955) (-2177.836) * (-2177.750) [-2180.524] (-2178.077) (-2173.542) -- 0:00:59
      106000 -- [-2176.898] (-2176.146) (-2180.877) (-2182.758) * (-2179.711) (-2180.530) [-2176.429] (-2173.462) -- 0:00:59
      106500 -- [-2174.809] (-2181.591) (-2176.191) (-2177.352) * (-2175.974) (-2176.188) (-2176.916) [-2176.155] -- 0:00:58
      107000 -- (-2174.829) (-2183.038) (-2174.825) [-2177.799] * (-2174.859) (-2177.320) [-2177.753] (-2174.000) -- 0:00:58
      107500 -- (-2175.950) (-2175.651) [-2175.694] (-2178.340) * (-2177.020) (-2179.103) [-2177.679] (-2175.270) -- 0:00:58
      108000 -- [-2175.782] (-2176.772) (-2175.186) (-2179.490) * (-2178.255) (-2174.816) (-2184.436) [-2175.407] -- 0:00:57
      108500 -- (-2175.859) [-2175.767] (-2173.745) (-2180.658) * [-2175.676] (-2178.086) (-2177.496) (-2176.693) -- 0:00:57
      109000 -- (-2177.440) (-2177.413) [-2174.318] (-2173.960) * (-2177.623) (-2175.835) [-2173.894] (-2180.710) -- 0:00:57
      109500 -- (-2178.530) (-2175.377) [-2175.700] (-2174.649) * (-2176.300) [-2174.272] (-2175.206) (-2174.395) -- 0:00:56
      110000 -- (-2181.618) (-2176.803) [-2172.053] (-2176.520) * (-2177.044) [-2174.484] (-2173.741) (-2176.327) -- 0:00:56

      Average standard deviation of split frequencies: 0.028248

      110500 -- (-2179.190) (-2175.676) [-2176.636] (-2174.623) * (-2180.263) [-2174.112] (-2174.876) (-2178.036) -- 0:01:04
      111000 -- (-2177.638) (-2177.802) [-2174.078] (-2177.806) * (-2178.863) (-2173.228) [-2177.339] (-2178.318) -- 0:01:04
      111500 -- (-2176.906) (-2175.910) [-2174.375] (-2178.021) * (-2174.809) (-2176.828) [-2173.920] (-2179.202) -- 0:01:03
      112000 -- (-2177.518) [-2177.806] (-2175.922) (-2176.259) * (-2176.396) [-2174.970] (-2174.457) (-2176.352) -- 0:01:03
      112500 -- (-2178.335) (-2176.467) [-2178.243] (-2177.244) * (-2178.363) [-2173.567] (-2176.289) (-2176.593) -- 0:01:03
      113000 -- (-2181.024) (-2177.163) [-2175.115] (-2177.239) * (-2177.121) [-2175.046] (-2175.206) (-2182.223) -- 0:01:02
      113500 -- (-2180.614) (-2175.749) (-2176.431) [-2176.869] * (-2181.181) [-2176.625] (-2174.790) (-2173.550) -- 0:01:02
      114000 -- (-2175.985) (-2178.572) [-2177.848] (-2176.204) * [-2175.846] (-2178.390) (-2178.329) (-2177.849) -- 0:01:02
      114500 -- (-2176.735) (-2179.977) [-2175.960] (-2176.822) * [-2175.213] (-2175.893) (-2176.939) (-2178.709) -- 0:01:01
      115000 -- [-2174.143] (-2177.915) (-2175.316) (-2175.492) * (-2176.971) (-2175.453) [-2178.406] (-2177.345) -- 0:01:01

      Average standard deviation of split frequencies: 0.025805

      115500 -- (-2174.876) (-2178.027) [-2175.493] (-2175.755) * (-2186.906) (-2178.133) (-2175.758) [-2176.717] -- 0:01:01
      116000 -- (-2175.513) (-2179.657) (-2178.233) [-2175.582] * [-2176.347] (-2176.451) (-2176.174) (-2177.572) -- 0:01:00
      116500 -- (-2177.542) (-2176.812) (-2175.407) [-2175.093] * [-2176.124] (-2176.751) (-2175.134) (-2177.932) -- 0:01:00
      117000 -- (-2174.985) (-2176.060) (-2177.105) [-2174.896] * [-2176.085] (-2178.175) (-2178.101) (-2175.549) -- 0:01:00
      117500 -- (-2175.549) (-2176.380) (-2175.906) [-2175.667] * [-2175.953] (-2179.042) (-2176.388) (-2176.652) -- 0:01:00
      118000 -- (-2176.165) (-2175.933) (-2176.814) [-2174.846] * (-2176.632) (-2175.266) (-2177.304) [-2174.370] -- 0:00:59
      118500 -- [-2177.856] (-2176.547) (-2177.751) (-2176.100) * (-2179.731) (-2177.292) [-2175.206] (-2177.775) -- 0:00:59
      119000 -- (-2180.904) (-2176.956) (-2176.836) [-2173.069] * (-2176.718) [-2178.069] (-2175.305) (-2177.275) -- 0:00:59
      119500 -- (-2176.058) (-2177.173) [-2176.851] (-2174.579) * (-2177.319) [-2177.356] (-2175.786) (-2175.356) -- 0:00:58
      120000 -- (-2176.790) [-2176.811] (-2176.402) (-2174.934) * (-2178.702) (-2179.102) (-2175.163) [-2175.485] -- 0:00:58

      Average standard deviation of split frequencies: 0.022206

      120500 -- (-2176.714) [-2175.277] (-2176.260) (-2172.897) * (-2179.805) (-2178.416) [-2174.441] (-2177.641) -- 0:00:58
      121000 -- (-2175.902) [-2177.211] (-2179.889) (-2176.478) * (-2178.331) [-2176.003] (-2175.605) (-2179.511) -- 0:00:58
      121500 -- (-2175.931) (-2179.574) [-2177.001] (-2176.539) * (-2177.416) (-2176.404) (-2175.584) [-2178.386] -- 0:00:57
      122000 -- (-2176.157) (-2179.525) (-2177.078) [-2176.099] * [-2179.144] (-2174.880) (-2183.846) (-2177.879) -- 0:00:57
      122500 -- [-2174.079] (-2176.304) (-2176.785) (-2175.368) * (-2180.809) [-2175.363] (-2182.125) (-2178.662) -- 0:00:57
      123000 -- (-2176.817) [-2177.365] (-2176.248) (-2178.320) * (-2177.830) [-2175.746] (-2182.267) (-2183.069) -- 0:00:57
      123500 -- (-2174.993) [-2177.102] (-2175.249) (-2175.089) * (-2182.555) (-2175.655) [-2178.919] (-2178.773) -- 0:00:56
      124000 -- (-2175.855) (-2178.147) (-2173.927) [-2174.143] * (-2182.292) [-2180.869] (-2175.064) (-2176.600) -- 0:00:56
      124500 -- (-2176.353) (-2178.389) [-2177.440] (-2175.353) * (-2179.652) (-2178.191) [-2175.938] (-2175.605) -- 0:01:03
      125000 -- (-2179.374) (-2181.245) [-2176.320] (-2176.495) * (-2179.476) (-2176.986) [-2176.069] (-2175.796) -- 0:01:03

      Average standard deviation of split frequencies: 0.022251

      125500 -- [-2174.513] (-2176.405) (-2176.292) (-2176.733) * (-2179.046) [-2177.512] (-2178.483) (-2176.150) -- 0:01:02
      126000 -- (-2174.445) (-2176.776) [-2174.431] (-2175.110) * (-2176.534) [-2175.741] (-2177.274) (-2178.546) -- 0:01:02
      126500 -- (-2175.333) (-2177.810) [-2173.181] (-2174.161) * (-2178.310) (-2176.355) (-2174.002) [-2176.641] -- 0:01:02
      127000 -- (-2177.406) (-2175.164) [-2173.390] (-2176.003) * (-2179.122) (-2176.012) (-2175.935) [-2177.078] -- 0:01:01
      127500 -- (-2180.395) [-2174.600] (-2174.127) (-2174.266) * [-2176.659] (-2176.103) (-2174.742) (-2175.092) -- 0:01:01
      128000 -- (-2180.325) (-2177.732) (-2177.087) [-2173.968] * [-2174.139] (-2180.528) (-2176.719) (-2183.653) -- 0:01:01
      128500 -- (-2180.012) (-2177.109) [-2177.067] (-2178.377) * [-2175.721] (-2178.990) (-2176.016) (-2180.859) -- 0:01:01
      129000 -- (-2177.637) [-2175.314] (-2175.588) (-2177.398) * (-2175.758) (-2175.806) [-2174.965] (-2175.252) -- 0:01:00
      129500 -- (-2176.552) (-2175.256) [-2178.368] (-2179.534) * (-2179.475) (-2176.289) [-2174.587] (-2177.225) -- 0:01:00
      130000 -- (-2177.269) (-2176.459) (-2176.431) [-2175.389] * (-2179.375) (-2175.141) [-2178.084] (-2175.602) -- 0:01:00

      Average standard deviation of split frequencies: 0.020925

      130500 -- (-2176.842) [-2178.706] (-2176.640) (-2174.456) * (-2175.515) (-2176.200) (-2175.151) [-2180.929] -- 0:00:59
      131000 -- (-2176.306) (-2176.959) (-2176.812) [-2174.875] * [-2175.724] (-2175.198) (-2176.636) (-2177.030) -- 0:00:59
      131500 -- (-2176.358) [-2176.941] (-2176.233) (-2177.717) * (-2176.999) (-2175.500) (-2175.451) [-2178.459] -- 0:00:59
      132000 -- (-2175.034) [-2179.794] (-2177.399) (-2177.865) * [-2176.682] (-2175.522) (-2177.883) (-2175.927) -- 0:00:59
      132500 -- (-2174.831) [-2174.733] (-2175.926) (-2177.930) * [-2176.538] (-2177.663) (-2174.081) (-2176.119) -- 0:00:58
      133000 -- (-2174.980) [-2176.097] (-2175.335) (-2176.304) * (-2176.618) [-2176.833] (-2174.316) (-2178.051) -- 0:00:58
      133500 -- (-2176.439) [-2177.865] (-2172.979) (-2176.976) * (-2176.522) (-2177.321) [-2174.609] (-2176.950) -- 0:00:58
      134000 -- (-2180.113) [-2180.619] (-2175.679) (-2176.749) * (-2176.362) (-2175.611) [-2175.671] (-2180.214) -- 0:00:58
      134500 -- (-2176.862) (-2176.284) (-2173.777) [-2175.131] * (-2180.329) (-2175.874) (-2175.199) [-2179.153] -- 0:00:57
      135000 -- (-2176.675) [-2176.576] (-2174.207) (-2177.800) * [-2175.599] (-2176.144) (-2176.384) (-2179.218) -- 0:00:57

      Average standard deviation of split frequencies: 0.022704

      135500 -- (-2176.350) (-2177.381) (-2176.062) [-2175.744] * [-2176.851] (-2175.815) (-2176.512) (-2180.934) -- 0:00:57
      136000 -- [-2176.350] (-2174.550) (-2175.052) (-2178.210) * (-2175.823) [-2176.453] (-2177.360) (-2176.989) -- 0:01:03
      136500 -- (-2175.837) (-2174.636) (-2177.548) [-2177.633] * (-2179.258) [-2176.822] (-2175.147) (-2178.932) -- 0:01:03
      137000 -- (-2175.894) [-2174.990] (-2175.544) (-2181.447) * (-2179.128) (-2179.318) [-2176.443] (-2176.863) -- 0:01:02
      137500 -- (-2176.440) (-2174.741) [-2176.140] (-2175.412) * (-2177.149) [-2176.691] (-2175.460) (-2174.820) -- 0:01:02
      138000 -- [-2175.243] (-2173.970) (-2175.468) (-2175.040) * [-2177.168] (-2175.920) (-2174.906) (-2177.182) -- 0:01:02
      138500 -- (-2180.119) (-2175.789) [-2174.932] (-2175.037) * (-2175.639) (-2177.970) (-2177.626) [-2175.909] -- 0:01:02
      139000 -- (-2175.930) [-2173.504] (-2176.697) (-2175.029) * [-2176.628] (-2184.577) (-2178.633) (-2178.044) -- 0:01:01
      139500 -- [-2176.697] (-2173.690) (-2178.271) (-2178.032) * (-2176.925) (-2174.487) (-2177.385) [-2177.474] -- 0:01:01
      140000 -- (-2176.461) (-2175.875) [-2178.667] (-2175.397) * (-2175.781) (-2178.005) (-2174.940) [-2175.557] -- 0:01:01

      Average standard deviation of split frequencies: 0.020989

      140500 -- (-2176.954) (-2174.034) [-2176.372] (-2175.725) * (-2177.533) [-2176.744] (-2174.334) (-2176.927) -- 0:01:01
      141000 -- (-2180.524) (-2179.052) [-2175.299] (-2176.352) * [-2176.134] (-2175.063) (-2174.485) (-2176.051) -- 0:01:00
      141500 -- (-2175.962) [-2176.543] (-2175.972) (-2175.876) * (-2175.958) (-2174.761) (-2174.896) [-2174.992] -- 0:01:00
      142000 -- (-2175.708) (-2175.317) [-2174.570] (-2180.568) * (-2176.420) (-2178.806) (-2175.721) [-2175.214] -- 0:01:00
      142500 -- (-2175.708) (-2178.911) [-2173.825] (-2175.322) * [-2177.852] (-2174.894) (-2174.786) (-2175.717) -- 0:01:00
      143000 -- (-2176.404) (-2174.424) (-2178.455) [-2174.771] * (-2179.096) [-2174.243] (-2175.903) (-2176.383) -- 0:00:59
      143500 -- (-2175.928) (-2175.825) (-2179.630) [-2174.720] * (-2176.257) [-2173.336] (-2177.583) (-2177.053) -- 0:00:59
      144000 -- (-2176.798) [-2175.575] (-2176.547) (-2176.655) * (-2176.899) [-2178.155] (-2176.923) (-2177.372) -- 0:00:59
      144500 -- (-2178.541) [-2175.176] (-2177.420) (-2175.329) * [-2176.990] (-2176.300) (-2176.507) (-2177.484) -- 0:00:59
      145000 -- (-2176.165) [-2174.473] (-2176.260) (-2174.569) * [-2176.621] (-2174.468) (-2174.099) (-2177.971) -- 0:00:58

      Average standard deviation of split frequencies: 0.018353

      145500 -- [-2177.145] (-2175.985) (-2176.258) (-2175.626) * (-2175.525) (-2173.941) [-2176.320] (-2177.526) -- 0:00:58
      146000 -- (-2178.362) [-2177.278] (-2176.316) (-2175.637) * (-2174.950) [-2173.713] (-2174.668) (-2175.367) -- 0:00:58
      146500 -- (-2179.970) (-2175.320) (-2174.999) [-2176.212] * [-2175.985] (-2176.420) (-2175.990) (-2183.307) -- 0:00:58
      147000 -- (-2175.771) (-2173.898) [-2175.310] (-2177.570) * [-2177.774] (-2174.832) (-2177.433) (-2185.124) -- 0:00:58
      147500 -- (-2177.574) (-2176.802) (-2175.808) [-2177.374] * (-2175.652) (-2176.451) [-2177.130] (-2176.713) -- 0:00:57
      148000 -- (-2179.515) (-2176.430) [-2175.426] (-2175.043) * (-2175.795) (-2174.237) (-2181.277) [-2176.680] -- 0:00:57
      148500 -- (-2181.879) (-2174.655) (-2175.692) [-2175.238] * (-2175.224) (-2177.803) [-2175.331] (-2173.652) -- 0:00:57
      149000 -- (-2175.865) (-2176.120) [-2177.916] (-2175.076) * (-2174.849) [-2177.849] (-2178.588) (-2178.355) -- 0:01:02
      149500 -- (-2175.604) (-2177.084) (-2177.741) [-2176.009] * [-2174.533] (-2176.432) (-2175.160) (-2182.591) -- 0:01:02
      150000 -- [-2175.858] (-2175.883) (-2176.674) (-2175.407) * [-2177.236] (-2173.288) (-2176.033) (-2180.557) -- 0:01:02

      Average standard deviation of split frequencies: 0.020114

      150500 -- [-2176.316] (-2176.407) (-2175.894) (-2173.794) * (-2176.157) [-2173.895] (-2177.075) (-2176.199) -- 0:01:02
      151000 -- [-2176.002] (-2174.649) (-2177.021) (-2177.836) * [-2175.935] (-2174.741) (-2180.080) (-2172.915) -- 0:01:01
      151500 -- (-2176.315) (-2176.697) (-2176.583) [-2177.561] * (-2176.487) (-2176.799) (-2177.285) [-2174.190] -- 0:01:01
      152000 -- (-2176.307) [-2179.571] (-2174.866) (-2175.101) * (-2179.296) [-2176.010] (-2179.201) (-2177.346) -- 0:01:01
      152500 -- (-2176.424) [-2175.917] (-2178.903) (-2176.035) * (-2180.403) (-2175.070) [-2177.558] (-2180.181) -- 0:01:01
      153000 -- (-2176.282) (-2176.744) (-2175.173) [-2176.631] * (-2175.744) (-2177.804) [-2174.968] (-2176.902) -- 0:01:00
      153500 -- [-2174.518] (-2175.300) (-2176.772) (-2178.995) * (-2174.781) [-2175.844] (-2174.938) (-2177.252) -- 0:01:00
      154000 -- (-2176.425) (-2175.593) [-2179.624] (-2175.703) * (-2174.305) (-2179.081) [-2176.767] (-2177.943) -- 0:01:00
      154500 -- [-2175.586] (-2174.446) (-2174.369) (-2177.663) * (-2176.327) (-2179.830) (-2174.161) [-2176.953] -- 0:01:00
      155000 -- [-2174.380] (-2178.909) (-2173.107) (-2175.243) * (-2177.625) (-2176.015) (-2174.842) [-2175.297] -- 0:00:59

      Average standard deviation of split frequencies: 0.022059

      155500 -- (-2175.494) (-2174.001) [-2173.189] (-2176.285) * (-2176.869) (-2173.888) [-2176.252] (-2176.945) -- 0:00:59
      156000 -- (-2177.027) (-2176.987) [-2177.491] (-2176.551) * (-2176.303) (-2174.728) (-2175.354) [-2175.450] -- 0:00:59
      156500 -- [-2175.555] (-2176.440) (-2175.908) (-2177.242) * (-2179.640) [-2174.685] (-2176.718) (-2178.584) -- 0:00:59
      157000 -- [-2179.709] (-2179.483) (-2177.449) (-2179.098) * (-2176.420) [-2177.882] (-2177.565) (-2177.287) -- 0:00:59
      157500 -- (-2175.740) (-2177.844) (-2175.922) [-2175.343] * (-2176.348) [-2175.713] (-2181.462) (-2176.631) -- 0:00:58
      158000 -- [-2178.301] (-2177.089) (-2176.453) (-2180.214) * (-2176.218) (-2174.026) [-2180.096] (-2178.483) -- 0:00:58
      158500 -- [-2175.617] (-2177.419) (-2174.682) (-2175.306) * (-2174.474) (-2174.717) [-2176.870] (-2176.223) -- 0:00:58
      159000 -- [-2174.656] (-2176.656) (-2175.682) (-2175.869) * (-2177.841) [-2173.616] (-2176.694) (-2175.573) -- 0:00:58
      159500 -- (-2175.138) (-2176.556) [-2173.824] (-2176.205) * (-2173.886) [-2173.363] (-2175.816) (-2177.971) -- 0:00:57
      160000 -- (-2176.500) (-2178.581) [-2175.074] (-2175.713) * (-2177.923) (-2177.654) (-2178.219) [-2177.752] -- 0:00:57

      Average standard deviation of split frequencies: 0.022592

      160500 -- [-2175.835] (-2179.149) (-2172.945) (-2178.591) * (-2174.001) [-2175.249] (-2177.491) (-2178.625) -- 0:00:57
      161000 -- (-2176.415) (-2177.526) (-2175.794) [-2175.524] * (-2173.945) (-2175.731) (-2176.015) [-2177.977] -- 0:00:57
      161500 -- (-2177.922) (-2176.627) (-2178.909) [-2176.454] * (-2176.747) (-2174.920) [-2175.278] (-2177.434) -- 0:00:57
      162000 -- (-2178.661) [-2175.192] (-2180.191) (-2175.571) * (-2175.121) (-2175.767) (-2176.826) [-2175.845] -- 0:01:02
      162500 -- (-2177.979) (-2175.989) (-2177.452) [-2176.174] * (-2173.801) (-2176.407) [-2176.845] (-2174.585) -- 0:01:01
      163000 -- (-2181.577) (-2177.602) [-2174.947] (-2176.350) * (-2175.240) (-2176.452) [-2177.895] (-2175.506) -- 0:01:01
      163500 -- (-2182.649) [-2182.000] (-2173.751) (-2178.678) * [-2172.980] (-2175.103) (-2178.178) (-2179.026) -- 0:01:01
      164000 -- (-2181.977) (-2177.555) [-2174.206] (-2176.276) * [-2173.253] (-2177.018) (-2179.126) (-2176.110) -- 0:01:01
      164500 -- (-2176.824) (-2175.780) [-2173.741] (-2176.072) * [-2174.611] (-2176.121) (-2178.635) (-2176.146) -- 0:01:00
      165000 -- (-2176.194) (-2175.926) (-2179.704) [-2175.365] * (-2178.848) (-2174.575) [-2178.547] (-2181.323) -- 0:01:00

      Average standard deviation of split frequencies: 0.022348

      165500 -- (-2176.329) [-2175.686] (-2175.937) (-2172.711) * [-2177.158] (-2178.019) (-2176.689) (-2179.679) -- 0:01:00
      166000 -- (-2178.366) (-2177.814) [-2176.579] (-2177.293) * (-2177.489) (-2176.512) [-2176.728] (-2180.402) -- 0:01:00
      166500 -- (-2176.682) (-2179.462) [-2176.588] (-2178.914) * [-2175.464] (-2175.628) (-2175.454) (-2177.297) -- 0:01:00
      167000 -- (-2185.446) (-2179.365) [-2174.444] (-2177.795) * (-2177.518) (-2176.450) (-2175.366) [-2176.164] -- 0:00:59
      167500 -- (-2180.123) (-2179.876) [-2175.427] (-2174.013) * (-2177.617) (-2174.902) (-2175.162) [-2174.801] -- 0:00:59
      168000 -- (-2178.263) (-2176.822) (-2174.096) [-2173.868] * [-2176.151] (-2176.976) (-2176.409) (-2176.032) -- 0:00:59
      168500 -- [-2177.971] (-2176.352) (-2176.163) (-2174.312) * [-2176.774] (-2177.118) (-2179.185) (-2174.294) -- 0:00:59
      169000 -- (-2179.250) (-2176.382) [-2177.432] (-2175.761) * (-2177.528) [-2176.062] (-2181.158) (-2176.751) -- 0:00:59
      169500 -- (-2179.017) (-2178.977) [-2176.005] (-2174.440) * (-2177.605) (-2176.910) (-2175.660) [-2181.204] -- 0:00:58
      170000 -- [-2176.880] (-2178.112) (-2178.077) (-2174.794) * (-2177.967) (-2177.028) (-2175.261) [-2176.153] -- 0:00:58

      Average standard deviation of split frequencies: 0.023298

      170500 -- (-2174.032) (-2178.489) (-2178.273) [-2174.714] * [-2177.423] (-2175.973) (-2175.044) (-2177.547) -- 0:00:58
      171000 -- [-2176.387] (-2176.673) (-2179.158) (-2175.439) * (-2176.803) [-2173.480] (-2174.953) (-2176.435) -- 0:00:58
      171500 -- [-2178.317] (-2176.320) (-2176.377) (-2173.970) * (-2176.221) (-2173.399) (-2177.509) [-2178.584] -- 0:00:57
      172000 -- (-2177.382) (-2177.878) (-2178.740) [-2175.441] * (-2178.245) (-2177.156) (-2177.092) [-2178.080] -- 0:00:57
      172500 -- [-2176.883] (-2175.935) (-2174.947) (-2177.956) * (-2176.158) [-2175.233] (-2176.072) (-2177.308) -- 0:00:57
      173000 -- (-2176.006) (-2181.620) (-2176.802) [-2177.370] * (-2176.221) (-2176.445) (-2176.245) [-2175.996] -- 0:00:57
      173500 -- (-2178.566) (-2173.409) (-2176.546) [-2174.618] * [-2174.208] (-2177.685) (-2175.924) (-2176.025) -- 0:00:57
      174000 -- (-2177.145) [-2175.706] (-2177.269) (-2177.323) * (-2175.272) (-2177.142) [-2176.314] (-2179.865) -- 0:01:01
      174500 -- (-2176.169) [-2177.727] (-2175.939) (-2176.543) * (-2173.822) (-2175.679) [-2176.583] (-2181.321) -- 0:01:01
      175000 -- (-2176.240) [-2178.275] (-2176.683) (-2179.271) * (-2179.342) (-2181.203) [-2177.870] (-2179.052) -- 0:01:01

      Average standard deviation of split frequencies: 0.024339

      175500 -- (-2176.005) (-2177.794) [-2175.306] (-2178.184) * [-2177.806] (-2178.935) (-2174.576) (-2178.219) -- 0:01:01
      176000 -- (-2177.283) (-2177.832) (-2176.036) [-2177.673] * (-2176.499) (-2178.864) (-2175.501) [-2176.444] -- 0:01:00
      176500 -- (-2176.344) [-2175.799] (-2176.700) (-2176.408) * (-2173.873) (-2177.331) (-2177.257) [-2174.674] -- 0:01:00
      177000 -- (-2176.293) (-2176.403) (-2179.176) [-2178.987] * (-2179.072) (-2177.355) [-2174.938] (-2175.136) -- 0:01:00
      177500 -- [-2176.291] (-2177.107) (-2176.887) (-2178.015) * (-2179.246) (-2179.224) [-2174.680] (-2175.086) -- 0:01:00
      178000 -- (-2177.205) (-2175.939) [-2177.203] (-2176.375) * (-2175.328) [-2176.709] (-2174.016) (-2176.738) -- 0:01:00
      178500 -- (-2179.915) (-2174.453) (-2177.277) [-2176.272] * (-2175.174) (-2175.095) (-2175.102) [-2174.093] -- 0:00:59
      179000 -- (-2176.753) (-2175.599) (-2177.240) [-2176.345] * (-2176.244) (-2176.482) [-2174.816] (-2175.550) -- 0:00:59
      179500 -- (-2177.100) (-2175.669) [-2175.931] (-2174.343) * (-2175.872) (-2175.739) [-2177.882] (-2177.294) -- 0:00:59
      180000 -- [-2174.268] (-2174.574) (-2175.931) (-2174.382) * [-2176.467] (-2174.637) (-2174.628) (-2179.978) -- 0:00:59

      Average standard deviation of split frequencies: 0.023732

      180500 -- (-2175.231) (-2177.720) (-2178.905) [-2176.700] * (-2176.005) (-2175.483) [-2175.214] (-2176.942) -- 0:00:59
      181000 -- [-2177.199] (-2176.933) (-2177.717) (-2178.279) * (-2175.437) [-2178.235] (-2175.508) (-2175.078) -- 0:00:58
      181500 -- (-2176.625) (-2176.099) (-2177.170) [-2174.316] * [-2175.553] (-2178.431) (-2175.278) (-2175.536) -- 0:00:58
      182000 -- [-2176.227] (-2175.336) (-2176.143) (-2176.971) * (-2178.264) [-2175.508] (-2175.211) (-2176.505) -- 0:00:58
      182500 -- (-2178.081) (-2175.436) (-2176.455) [-2176.012] * [-2174.890] (-2175.540) (-2174.259) (-2174.176) -- 0:00:58
      183000 -- (-2176.395) (-2178.339) (-2176.514) [-2174.219] * [-2175.956] (-2174.515) (-2178.039) (-2176.123) -- 0:00:58
      183500 -- [-2176.941] (-2176.174) (-2175.073) (-2174.034) * (-2175.539) (-2176.607) (-2180.363) [-2176.613] -- 0:00:57
      184000 -- (-2173.898) (-2178.217) (-2178.084) [-2175.791] * [-2179.517] (-2176.901) (-2175.686) (-2176.504) -- 0:00:57
      184500 -- (-2184.610) (-2175.273) [-2178.503] (-2177.262) * (-2175.782) (-2173.593) (-2176.903) [-2176.475] -- 0:00:57
      185000 -- (-2176.027) (-2176.265) (-2179.630) [-2175.552] * (-2177.175) [-2176.157] (-2176.849) (-2175.070) -- 0:00:57

      Average standard deviation of split frequencies: 0.023172

      185500 -- (-2175.941) (-2176.173) [-2181.830] (-2174.956) * (-2177.149) (-2174.413) [-2176.850] (-2176.374) -- 0:00:57
      186000 -- [-2176.430] (-2173.586) (-2176.301) (-2175.744) * [-2176.946] (-2174.362) (-2176.469) (-2174.731) -- 0:00:56
      186500 -- (-2175.705) (-2176.481) (-2175.565) [-2174.673] * (-2176.143) (-2175.366) [-2175.040] (-2175.413) -- 0:01:01
      187000 -- [-2174.058] (-2176.866) (-2176.101) (-2177.290) * (-2175.493) [-2176.686] (-2174.535) (-2174.134) -- 0:01:00
      187500 -- (-2177.590) (-2176.873) (-2176.625) [-2179.194] * (-2177.317) (-2179.449) [-2177.694] (-2175.961) -- 0:01:00
      188000 -- (-2175.772) (-2174.360) [-2176.087] (-2177.930) * (-2178.934) (-2179.146) [-2178.616] (-2175.648) -- 0:01:00
      188500 -- (-2175.455) [-2175.768] (-2176.040) (-2178.285) * (-2176.009) (-2174.403) (-2178.509) [-2174.734] -- 0:01:00
      189000 -- [-2175.869] (-2176.458) (-2175.269) (-2175.360) * (-2173.797) [-2175.876] (-2177.170) (-2176.085) -- 0:01:00
      189500 -- (-2174.163) (-2181.746) (-2174.739) [-2175.921] * (-2173.241) (-2176.715) [-2176.248] (-2173.989) -- 0:00:59
      190000 -- (-2176.190) [-2178.835] (-2174.873) (-2179.263) * (-2176.331) (-2176.471) [-2175.011] (-2175.377) -- 0:00:59

      Average standard deviation of split frequencies: 0.022958

      190500 -- (-2174.283) [-2176.928] (-2176.434) (-2177.850) * (-2173.517) (-2176.955) (-2175.635) [-2177.972] -- 0:00:59
      191000 -- (-2175.383) (-2178.000) (-2177.165) [-2176.498] * [-2175.402] (-2176.790) (-2175.637) (-2180.445) -- 0:00:59
      191500 -- [-2174.690] (-2179.077) (-2174.426) (-2174.715) * (-2175.198) [-2178.275] (-2176.514) (-2178.134) -- 0:00:59
      192000 -- (-2175.784) (-2179.391) [-2174.044] (-2175.792) * (-2177.752) (-2181.423) [-2174.830] (-2176.931) -- 0:00:58
      192500 -- (-2176.132) (-2176.646) (-2176.958) [-2174.548] * (-2176.865) (-2179.278) (-2175.227) [-2177.106] -- 0:00:58
      193000 -- (-2175.328) [-2177.585] (-2178.440) (-2178.727) * [-2175.333] (-2176.555) (-2177.606) (-2177.580) -- 0:00:58
      193500 -- (-2174.736) [-2180.167] (-2176.689) (-2174.743) * (-2173.647) [-2176.449] (-2179.670) (-2176.356) -- 0:00:58
      194000 -- (-2176.475) (-2175.577) [-2174.862] (-2176.097) * (-2178.228) [-2176.683] (-2177.099) (-2176.279) -- 0:00:58
      194500 -- [-2177.482] (-2176.150) (-2176.247) (-2177.417) * (-2175.065) (-2176.639) (-2179.381) [-2177.339] -- 0:00:57
      195000 -- (-2178.133) (-2176.864) [-2176.030] (-2176.926) * (-2176.269) (-2175.928) [-2177.129] (-2178.116) -- 0:00:57

      Average standard deviation of split frequencies: 0.022127

      195500 -- (-2184.684) (-2177.718) [-2174.188] (-2178.924) * (-2179.151) (-2176.596) [-2176.307] (-2177.801) -- 0:00:57
      196000 -- (-2182.069) (-2175.103) [-2175.329] (-2179.037) * [-2176.178] (-2176.179) (-2176.494) (-2177.695) -- 0:00:57
      196500 -- (-2175.963) (-2175.962) (-2175.367) [-2174.730] * (-2175.473) [-2175.895] (-2176.369) (-2177.093) -- 0:00:57
      197000 -- (-2179.555) (-2177.285) [-2177.105] (-2176.476) * (-2177.994) (-2175.477) [-2175.967] (-2177.356) -- 0:00:57
      197500 -- (-2179.459) [-2178.523] (-2177.757) (-2176.730) * (-2179.460) (-2176.144) (-2177.412) [-2176.983] -- 0:00:56
      198000 -- (-2179.836) (-2177.089) [-2175.464] (-2179.293) * (-2178.525) [-2176.629] (-2176.015) (-2177.998) -- 0:00:56
      198500 -- (-2180.056) (-2172.810) [-2175.709] (-2180.222) * (-2176.455) [-2174.841] (-2177.473) (-2176.263) -- 0:00:56
      199000 -- [-2177.790] (-2180.919) (-2177.425) (-2176.501) * (-2176.460) (-2176.701) [-2176.561] (-2178.867) -- 0:00:56
      199500 -- (-2176.284) [-2179.633] (-2177.663) (-2174.250) * (-2175.209) (-2177.158) (-2176.044) [-2174.545] -- 0:01:00
      200000 -- (-2174.293) [-2177.687] (-2176.616) (-2174.784) * (-2175.786) (-2176.648) [-2175.581] (-2174.493) -- 0:00:59

      Average standard deviation of split frequencies: 0.020555

      200500 -- (-2177.883) [-2174.840] (-2177.631) (-2174.735) * [-2179.498] (-2177.533) (-2176.028) (-2175.852) -- 0:00:59
      201000 -- [-2176.952] (-2176.487) (-2177.155) (-2178.848) * (-2173.843) (-2176.371) (-2175.521) [-2179.036] -- 0:00:59
      201500 -- (-2175.874) [-2180.873] (-2176.757) (-2180.504) * [-2174.008] (-2177.896) (-2174.614) (-2176.051) -- 0:00:59
      202000 -- (-2175.711) [-2177.212] (-2177.038) (-2176.327) * (-2176.571) (-2175.969) [-2174.576] (-2175.478) -- 0:00:59
      202500 -- (-2175.969) [-2173.727] (-2180.236) (-2177.444) * (-2174.179) (-2177.583) (-2177.199) [-2174.661] -- 0:00:59
      203000 -- [-2176.128] (-2183.052) (-2178.485) (-2178.573) * (-2175.477) (-2177.068) (-2177.886) [-2179.260] -- 0:00:58
      203500 -- (-2175.890) (-2175.606) [-2178.707] (-2177.634) * (-2176.310) (-2175.423) [-2179.972] (-2177.000) -- 0:00:58
      204000 -- (-2177.248) (-2176.503) [-2178.599] (-2178.250) * (-2175.360) (-2175.659) (-2175.104) [-2176.926] -- 0:00:58
      204500 -- [-2177.412] (-2174.345) (-2185.350) (-2174.954) * (-2176.197) (-2177.056) (-2174.443) [-2175.328] -- 0:00:58
      205000 -- [-2176.592] (-2175.659) (-2176.108) (-2174.307) * (-2173.809) [-2175.603] (-2176.935) (-2178.660) -- 0:00:58

      Average standard deviation of split frequencies: 0.020486

      205500 -- (-2177.355) (-2174.432) [-2176.449] (-2175.089) * (-2180.038) (-2174.917) (-2182.372) [-2175.867] -- 0:00:57
      206000 -- (-2176.138) [-2175.640] (-2178.820) (-2174.567) * (-2174.589) [-2175.999] (-2176.589) (-2175.542) -- 0:00:57
      206500 -- (-2177.201) (-2173.928) (-2178.400) [-2178.173] * [-2177.542] (-2175.020) (-2175.476) (-2175.655) -- 0:00:57
      207000 -- (-2178.716) [-2173.043] (-2176.872) (-2179.088) * [-2177.137] (-2176.883) (-2176.441) (-2177.320) -- 0:00:57
      207500 -- (-2177.668) (-2174.241) (-2176.053) [-2175.441] * (-2175.455) (-2176.930) (-2177.258) [-2179.319] -- 0:00:57
      208000 -- (-2176.288) (-2177.672) (-2176.816) [-2178.552] * (-2175.023) [-2177.279] (-2175.827) (-2178.819) -- 0:00:57
      208500 -- (-2175.888) (-2178.087) [-2175.983] (-2176.312) * [-2176.065] (-2177.706) (-2177.961) (-2176.385) -- 0:00:56
      209000 -- (-2175.940) [-2176.870] (-2176.445) (-2177.439) * (-2180.627) [-2178.612] (-2178.909) (-2175.491) -- 0:00:56
      209500 -- (-2175.406) (-2173.944) (-2179.793) [-2175.064] * [-2176.297] (-2176.615) (-2177.096) (-2173.992) -- 0:00:56
      210000 -- (-2175.948) [-2177.638] (-2177.523) (-2174.600) * (-2176.456) [-2176.805] (-2176.581) (-2175.718) -- 0:00:56

      Average standard deviation of split frequencies: 0.018013

      210500 -- (-2175.759) (-2176.747) [-2176.702] (-2176.763) * [-2176.827] (-2177.344) (-2176.461) (-2176.216) -- 0:00:56
      211000 -- (-2174.053) [-2178.572] (-2178.123) (-2176.851) * (-2178.489) (-2174.635) [-2176.288] (-2174.592) -- 0:00:59
      211500 -- (-2174.945) [-2176.459] (-2175.070) (-2177.657) * [-2174.278] (-2173.986) (-2176.881) (-2174.837) -- 0:00:59
      212000 -- (-2181.379) (-2177.427) [-2176.694] (-2175.640) * (-2176.274) (-2176.665) [-2174.847] (-2176.697) -- 0:00:59
      212500 -- (-2177.163) (-2180.831) [-2176.130] (-2174.631) * [-2176.800] (-2177.104) (-2175.848) (-2177.131) -- 0:00:59
      213000 -- [-2176.031] (-2179.453) (-2175.269) (-2175.393) * (-2172.984) (-2176.742) (-2176.984) [-2175.614] -- 0:00:59
      213500 -- [-2177.051] (-2178.214) (-2181.712) (-2177.004) * (-2176.202) [-2174.807] (-2176.522) (-2179.310) -- 0:00:58
      214000 -- (-2178.823) (-2178.210) [-2180.074] (-2177.336) * (-2180.367) [-2178.247] (-2183.415) (-2176.827) -- 0:00:58
      214500 -- (-2175.992) (-2177.281) [-2178.788] (-2175.403) * [-2174.806] (-2177.418) (-2176.096) (-2177.080) -- 0:00:58
      215000 -- (-2178.267) (-2177.471) [-2174.570] (-2176.131) * [-2174.671] (-2175.123) (-2176.245) (-2175.503) -- 0:00:58

      Average standard deviation of split frequencies: 0.018149

      215500 -- [-2175.415] (-2177.009) (-2177.249) (-2178.207) * (-2175.211) (-2176.472) [-2175.162] (-2175.741) -- 0:00:58
      216000 -- [-2176.870] (-2176.922) (-2177.558) (-2178.102) * (-2174.948) (-2174.616) (-2176.397) [-2176.202] -- 0:00:58
      216500 -- (-2177.886) (-2174.195) (-2177.132) [-2177.598] * (-2175.612) (-2175.849) (-2178.636) [-2176.154] -- 0:00:57
      217000 -- (-2178.091) (-2174.810) (-2174.473) [-2177.612] * (-2177.565) (-2174.271) (-2176.673) [-2177.137] -- 0:00:57
      217500 -- (-2175.981) [-2173.853] (-2175.399) (-2177.055) * [-2176.824] (-2176.351) (-2177.185) (-2175.631) -- 0:00:57
      218000 -- (-2177.024) (-2178.055) [-2176.501] (-2178.801) * (-2175.263) [-2176.485] (-2175.793) (-2176.651) -- 0:00:57
      218500 -- (-2176.149) (-2178.229) [-2175.133] (-2176.768) * [-2175.948] (-2177.573) (-2178.515) (-2176.605) -- 0:00:57
      219000 -- [-2175.527] (-2181.718) (-2175.136) (-2175.274) * [-2176.186] (-2174.374) (-2176.360) (-2177.102) -- 0:00:57
      219500 -- (-2177.527) [-2176.950] (-2176.697) (-2175.943) * [-2175.399] (-2179.272) (-2176.964) (-2176.392) -- 0:00:56
      220000 -- (-2177.680) [-2176.241] (-2177.212) (-2176.454) * (-2177.689) (-2179.989) [-2175.164] (-2175.602) -- 0:00:56

      Average standard deviation of split frequencies: 0.019013

      220500 -- (-2174.929) (-2175.589) (-2179.107) [-2177.536] * (-2178.179) [-2176.856] (-2174.877) (-2178.808) -- 0:00:56
      221000 -- [-2177.013] (-2176.374) (-2176.086) (-2176.300) * [-2177.498] (-2174.389) (-2175.007) (-2177.430) -- 0:00:59
      221500 -- [-2176.925] (-2175.951) (-2177.162) (-2177.944) * (-2178.701) (-2174.896) (-2176.215) [-2176.209] -- 0:00:59
      222000 -- (-2176.047) (-2174.405) [-2176.728] (-2178.002) * (-2179.689) (-2177.018) [-2177.898] (-2176.112) -- 0:00:59
      222500 -- (-2178.401) (-2173.862) (-2178.787) [-2176.437] * (-2176.906) (-2178.229) [-2178.065] (-2175.938) -- 0:00:59
      223000 -- [-2178.352] (-2173.448) (-2174.617) (-2179.679) * (-2174.336) [-2175.497] (-2175.725) (-2174.511) -- 0:00:59
      223500 -- (-2174.669) [-2174.482] (-2175.211) (-2176.586) * (-2176.994) (-2177.163) [-2176.554] (-2176.372) -- 0:00:59
      224000 -- (-2174.484) (-2176.263) [-2175.261] (-2177.839) * (-2179.273) (-2174.742) [-2176.642] (-2176.189) -- 0:00:58
      224500 -- (-2176.091) [-2175.343] (-2175.221) (-2177.161) * (-2176.348) [-2177.170] (-2176.412) (-2176.497) -- 0:00:58
      225000 -- (-2176.133) (-2175.338) [-2176.179] (-2175.893) * (-2177.610) [-2174.987] (-2181.541) (-2176.876) -- 0:00:58

      Average standard deviation of split frequencies: 0.019190

      225500 -- (-2176.102) (-2174.016) (-2178.961) [-2175.504] * (-2177.767) (-2174.928) [-2176.687] (-2177.573) -- 0:00:58
      226000 -- (-2175.545) [-2173.709] (-2180.572) (-2176.140) * (-2176.838) [-2173.946] (-2175.249) (-2176.230) -- 0:00:58
      226500 -- (-2180.577) (-2177.052) [-2182.386] (-2174.957) * (-2175.234) (-2176.300) (-2175.592) [-2175.567] -- 0:00:58
      227000 -- (-2177.351) [-2174.210] (-2184.521) (-2175.957) * (-2176.910) (-2176.914) [-2176.030] (-2174.710) -- 0:00:57
      227500 -- (-2175.736) (-2175.938) (-2181.572) [-2175.468] * [-2175.116] (-2174.243) (-2178.591) (-2175.341) -- 0:00:57
      228000 -- (-2174.743) [-2174.962] (-2175.215) (-2178.884) * [-2175.007] (-2184.804) (-2179.034) (-2177.654) -- 0:00:57
      228500 -- (-2179.693) (-2179.470) (-2177.096) [-2177.521] * (-2176.250) (-2186.287) [-2174.331] (-2175.690) -- 0:00:57
      229000 -- (-2174.356) [-2176.795] (-2177.065) (-2177.474) * (-2175.016) [-2177.933] (-2175.064) (-2178.284) -- 0:00:57