--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:53:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1390/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -602.36          -604.83
2       -602.34          -607.37
--------------------------------------
TOTAL     -602.35          -606.75
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.904712    0.092399    0.373498    1.498828    0.870764   1338.26   1419.63    1.002
r(A<->C){all}   0.161972    0.018709    0.000022    0.439099    0.125089    261.16    281.87    1.003
r(A<->G){all}   0.164245    0.020235    0.000229    0.459012    0.123836    270.64    271.56    1.002
r(A<->T){all}   0.168962    0.020481    0.000091    0.460043    0.127567    237.53    251.55    1.006
r(C<->G){all}   0.164661    0.017870    0.000018    0.426145    0.130630    220.89    264.00    1.001
r(C<->T){all}   0.176134    0.021191    0.000025    0.482313    0.139652    184.20    246.36    1.000
r(G<->T){all}   0.164026    0.019815    0.000051    0.448639    0.126614    184.65    184.91    1.002
pi(A){all}      0.209059    0.000369    0.174908    0.248435    0.208783   1316.49   1321.90    1.000
pi(C){all}      0.273116    0.000449    0.232463    0.315812    0.272908   1301.96   1313.83    1.000
pi(G){all}      0.328526    0.000482    0.283033    0.368090    0.328464   1380.88   1440.94    1.000
pi(T){all}      0.189299    0.000343    0.155684    0.225835    0.189101   1308.82   1356.65    1.000
alpha{1,2}      0.422504    0.241666    0.000328    1.377334    0.247719   1152.80   1216.23    1.000
alpha{3}        0.454529    0.221748    0.000330    1.379971    0.306091   1270.88   1385.94    1.000
pinvar{all}     0.996263    0.000023    0.987522    0.999997    0.997747   1154.24   1283.42    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-570.158874
Model 2: PositiveSelection	-570.158855
Model 0: one-ratio	-570.158864
Model 7: beta	-570.158943
Model 8: beta&w>1	-570.158843


Model 0 vs 1	1.9999999949504854E-5

Model 2 vs 1	3.799999990405922E-5

Model 8 vs 7	1.999999999497959E-4
>C1
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C2
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C3
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C4
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C5
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C6
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147 

C1              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C2              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C3              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C4              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C5              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C6              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
                **************************************************

C1              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C2              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C3              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C4              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C5              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C6              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
                **************************************************

C1              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C2              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C3              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C4              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C5              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C6              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
                ***********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  147 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  147 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4410]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4410]--->[4410]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.680 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C2              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C3              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C4              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C5              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C6              MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
                **************************************************

C1              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C2              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C3              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C4              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C5              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C6              DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
                **************************************************

C1              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C2              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C3              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C4              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C5              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C6              LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C2              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C3              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C4              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C5              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C6              ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
                **************************************************

C1              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C2              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C3              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C4              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C5              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C6              GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
                **************************************************

C1              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C2              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C3              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C4              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C5              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C6              TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
                **************************************************

C1              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C2              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C3              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C4              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C5              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C6              GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
                **************************************************

C1              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C2              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C3              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C4              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C5              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C6              CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
                **************************************************

C1              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C2              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C3              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C4              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C5              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C6              ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
                **************************************************

C1              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C2              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C3              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C4              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C5              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C6              CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
                **************************************************

C1              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C2              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C3              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C4              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C5              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C6              GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
                **************************************************

C1              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C2              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C3              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C4              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C5              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C6              GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
                *****************************************



>C1
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C2
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C3
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C4
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C5
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C6
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C1
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C2
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C3
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C4
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C5
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C6
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 441 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859517
      Setting output file names to "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 343318872
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5438336661
      Seed = 2032503976
      Swapseed = 1579859517
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -986.979141 -- -24.965149
         Chain 2 -- -986.979085 -- -24.965149
         Chain 3 -- -986.979141 -- -24.965149
         Chain 4 -- -986.979141 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -986.979141 -- -24.965149
         Chain 2 -- -986.979141 -- -24.965149
         Chain 3 -- -986.979085 -- -24.965149
         Chain 4 -- -986.979141 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-986.979] (-986.979) (-986.979) (-986.979) * [-986.979] (-986.979) (-986.979) (-986.979) 
        500 -- [-616.984] (-611.274) (-616.968) (-616.981) * [-616.635] (-614.736) (-607.289) (-613.138) -- 0:00:00
       1000 -- [-615.059] (-615.890) (-614.403) (-622.655) * [-619.236] (-617.575) (-610.739) (-628.826) -- 0:00:00
       1500 -- (-611.696) [-618.461] (-608.214) (-609.061) * [-611.457] (-614.085) (-615.201) (-611.857) -- 0:00:00
       2000 -- (-614.475) (-607.742) [-606.848] (-616.059) * (-611.998) (-617.600) (-610.874) [-609.137] -- 0:00:00
       2500 -- (-616.143) (-608.698) (-611.073) [-608.316] * (-615.885) (-616.533) (-609.125) [-614.478] -- 0:00:00
       3000 -- [-607.498] (-612.744) (-615.084) (-618.955) * (-613.006) (-614.128) [-610.438] (-615.047) -- 0:00:00
       3500 -- (-606.114) [-609.130] (-612.779) (-618.100) * (-612.113) [-610.344] (-615.536) (-613.045) -- 0:00:00
       4000 -- (-608.236) [-608.392] (-615.409) (-624.354) * (-613.062) (-617.739) [-611.324] (-615.652) -- 0:04:09
       4500 -- (-609.800) (-617.658) (-616.268) [-613.214] * [-610.972] (-608.533) (-615.321) (-612.447) -- 0:03:41
       5000 -- (-614.146) (-612.301) [-612.180] (-612.806) * (-618.293) [-612.846] (-611.563) (-614.711) -- 0:03:19

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-611.280) (-609.232) (-606.412) [-614.376] * [-606.347] (-608.697) (-613.673) (-612.654) -- 0:03:00
       6000 -- [-610.473] (-616.209) (-613.220) (-610.774) * [-611.640] (-617.229) (-609.748) (-614.047) -- 0:02:45
       6500 -- (-613.053) (-609.669) (-625.060) [-610.947] * [-609.855] (-613.438) (-613.266) (-612.614) -- 0:02:32
       7000 -- (-614.959) [-611.273] (-616.246) (-612.495) * [-609.396] (-609.507) (-614.302) (-617.623) -- 0:02:21
       7500 -- (-612.369) [-615.831] (-603.107) (-614.240) * (-611.195) (-618.805) (-613.728) [-612.359] -- 0:02:12
       8000 -- (-608.366) [-609.488] (-604.165) (-616.132) * (-616.634) (-612.070) (-609.888) [-607.113] -- 0:02:04
       8500 -- (-611.311) [-611.659] (-602.973) (-608.513) * (-613.542) (-612.121) (-614.366) [-613.149] -- 0:01:56
       9000 -- (-612.643) (-617.020) [-604.841] (-606.289) * (-612.100) (-611.251) (-610.123) [-613.572] -- 0:01:50
       9500 -- (-606.431) [-612.071] (-602.304) (-617.510) * [-611.559] (-621.236) (-609.107) (-615.321) -- 0:01:44
      10000 -- (-612.674) (-618.816) [-601.408] (-611.529) * (-612.801) [-613.171] (-608.079) (-610.637) -- 0:01:39

      Average standard deviation of split frequencies: 0.066291

      10500 -- [-613.855] (-613.145) (-605.760) (-620.461) * (-618.251) [-616.253] (-619.631) (-615.768) -- 0:01:34
      11000 -- [-610.132] (-622.355) (-604.838) (-618.609) * [-614.671] (-616.365) (-610.458) (-620.379) -- 0:01:29
      11500 -- (-606.842) [-609.301] (-603.353) (-616.671) * [-610.152] (-604.646) (-615.089) (-609.756) -- 0:01:25
      12000 -- (-618.646) (-603.637) (-603.846) [-612.883] * (-613.153) [-604.557] (-610.740) (-612.770) -- 0:01:22
      12500 -- (-618.052) [-603.405] (-604.287) (-620.666) * (-612.612) [-603.111] (-608.755) (-612.627) -- 0:01:19
      13000 -- (-614.155) [-604.462] (-603.673) (-613.781) * (-612.431) [-603.123] (-612.811) (-619.753) -- 0:01:15
      13500 -- (-628.664) (-603.291) [-603.777] (-617.174) * (-614.090) (-601.249) (-623.210) [-614.662] -- 0:01:13
      14000 -- (-608.182) [-603.392] (-602.203) (-617.806) * (-610.852) (-605.754) (-606.159) [-613.113] -- 0:01:10
      14500 -- (-605.440) (-603.795) [-602.012] (-602.991) * [-609.698] (-603.708) (-611.886) (-614.389) -- 0:01:07
      15000 -- [-610.119] (-610.097) (-603.032) (-606.535) * (-619.691) (-601.817) [-612.193] (-624.588) -- 0:01:05

      Average standard deviation of split frequencies: 0.047702

      15500 -- [-604.637] (-603.178) (-605.311) (-606.859) * (-620.650) [-601.477] (-633.484) (-611.247) -- 0:01:03
      16000 -- (-612.768) [-604.754] (-603.303) (-602.593) * [-611.838] (-603.799) (-613.656) (-618.256) -- 0:01:01
      16500 -- (-606.095) [-603.752] (-604.917) (-603.166) * [-608.367] (-603.993) (-603.605) (-607.972) -- 0:00:59
      17000 -- (-606.501) [-601.367] (-601.273) (-604.972) * [-607.905] (-600.941) (-601.464) (-607.106) -- 0:00:57
      17500 -- (-610.471) (-603.810) [-601.466] (-604.693) * (-605.018) (-602.613) (-601.916) [-603.762] -- 0:00:56
      18000 -- (-615.673) (-603.278) (-601.559) [-608.757] * (-604.526) (-605.331) [-603.493] (-606.433) -- 0:00:54
      18500 -- (-613.375) (-602.976) (-602.140) [-601.678] * (-603.272) (-602.445) [-601.875] (-602.888) -- 0:00:53
      19000 -- [-607.525] (-606.404) (-603.194) (-604.114) * (-604.916) (-602.130) (-601.691) [-601.878] -- 0:00:51
      19500 -- (-617.924) (-601.285) (-603.829) [-602.722] * (-604.644) [-601.297] (-600.901) (-601.854) -- 0:00:50
      20000 -- (-626.481) [-602.858] (-604.702) (-605.089) * (-603.847) [-602.079] (-601.904) (-601.783) -- 0:00:49

      Average standard deviation of split frequencies: 0.038016

      20500 -- (-624.488) [-602.738] (-605.227) (-603.279) * [-603.320] (-602.339) (-603.546) (-601.294) -- 0:01:35
      21000 -- (-607.455) (-605.015) [-602.639] (-601.750) * [-603.815] (-602.279) (-602.322) (-602.705) -- 0:01:33
      21500 -- (-602.133) [-604.408] (-603.063) (-601.102) * (-603.253) (-607.818) [-605.013] (-604.884) -- 0:01:31
      22000 -- (-601.810) (-604.525) (-603.168) [-602.661] * [-603.973] (-610.141) (-603.367) (-602.766) -- 0:01:28
      22500 -- (-604.226) [-602.528] (-604.637) (-604.603) * (-604.444) (-601.330) [-606.881] (-604.524) -- 0:01:26
      23000 -- (-602.834) [-602.845] (-602.060) (-603.376) * (-603.080) (-601.161) [-602.918] (-603.881) -- 0:01:24
      23500 -- [-601.913] (-606.821) (-604.375) (-605.859) * (-601.422) (-600.876) [-602.274] (-602.630) -- 0:01:23
      24000 -- (-601.284) (-601.503) (-603.893) [-603.108] * (-601.761) (-601.207) [-602.087] (-603.748) -- 0:01:21
      24500 -- (-604.007) (-604.432) (-604.210) [-601.936] * (-602.448) [-602.076] (-604.390) (-605.101) -- 0:01:19
      25000 -- (-602.899) (-604.144) (-603.890) [-603.371] * (-604.532) [-601.296] (-603.203) (-604.003) -- 0:01:18

      Average standard deviation of split frequencies: 0.037989

      25500 -- (-604.788) (-603.985) (-603.530) [-607.776] * (-602.021) [-602.582] (-604.414) (-604.828) -- 0:01:16
      26000 -- [-601.783] (-602.658) (-603.329) (-601.641) * [-604.469] (-603.117) (-606.450) (-603.086) -- 0:01:14
      26500 -- (-603.113) (-601.919) [-603.307] (-602.917) * (-604.924) (-606.790) [-601.936] (-603.203) -- 0:01:13
      27000 -- (-603.186) [-606.185] (-604.594) (-604.679) * (-602.453) (-603.595) (-601.558) [-602.107] -- 0:01:12
      27500 -- (-602.340) (-610.626) (-602.187) [-604.781] * [-601.218] (-603.081) (-602.628) (-604.809) -- 0:01:10
      28000 -- (-603.792) (-604.137) (-602.803) [-603.263] * (-602.943) (-602.572) [-601.865] (-603.761) -- 0:01:09
      28500 -- (-602.498) (-604.728) (-605.005) [-602.417] * [-602.709] (-601.327) (-606.451) (-602.833) -- 0:01:08
      29000 -- (-604.872) (-603.426) (-603.056) [-602.646] * (-601.516) [-601.192] (-602.938) (-605.042) -- 0:01:06
      29500 -- (-601.857) [-601.709] (-601.913) (-601.736) * (-606.286) (-602.444) [-603.605] (-602.595) -- 0:01:05
      30000 -- [-602.754] (-602.632) (-602.381) (-602.159) * (-603.004) (-602.710) [-601.292] (-605.485) -- 0:01:04

      Average standard deviation of split frequencies: 0.032208

      30500 -- (-604.798) (-602.776) [-603.036] (-602.539) * [-604.628] (-602.752) (-604.240) (-605.711) -- 0:01:03
      31000 -- (-604.515) [-604.955] (-602.079) (-602.665) * (-604.292) (-603.041) (-602.276) [-604.780] -- 0:01:02
      31500 -- (-604.498) [-601.853] (-602.559) (-601.298) * (-602.396) (-606.483) (-603.604) [-607.281] -- 0:01:01
      32000 -- (-603.838) (-601.900) (-602.080) [-601.081] * (-601.605) (-608.027) [-603.317] (-612.727) -- 0:01:00
      32500 -- (-602.020) (-604.547) (-603.767) [-602.234] * (-603.885) (-604.839) (-602.876) [-604.252] -- 0:00:59
      33000 -- (-603.414) [-603.299] (-605.178) (-602.338) * [-601.580] (-604.309) (-601.055) (-602.164) -- 0:00:58
      33500 -- (-601.318) (-603.561) (-602.674) [-603.568] * (-607.609) (-603.100) (-600.940) [-601.325] -- 0:00:57
      34000 -- (-602.195) (-604.638) [-601.931] (-604.544) * (-603.254) [-602.514] (-601.601) (-606.759) -- 0:00:56
      34500 -- (-602.640) (-606.632) [-603.303] (-604.921) * [-605.699] (-602.281) (-601.408) (-603.615) -- 0:00:55
      35000 -- (-605.513) [-604.116] (-604.175) (-603.605) * (-606.609) (-602.520) (-601.758) [-603.135] -- 0:00:55

      Average standard deviation of split frequencies: 0.022448

      35500 -- (-603.595) (-607.664) (-602.660) [-602.623] * (-601.507) (-603.164) [-600.767] (-604.686) -- 0:00:54
      36000 -- (-602.672) (-601.230) [-602.247] (-604.235) * (-606.275) (-601.929) (-606.203) [-604.436] -- 0:00:53
      36500 -- (-609.284) [-601.839] (-602.844) (-601.241) * (-602.935) (-603.630) (-608.676) [-607.848] -- 0:00:52
      37000 -- (-604.554) [-603.463] (-602.282) (-603.571) * (-603.964) (-603.230) [-605.054] (-605.240) -- 0:00:52
      37500 -- [-603.991] (-604.591) (-606.031) (-605.866) * (-606.625) [-602.582] (-604.800) (-606.537) -- 0:01:17
      38000 -- (-602.003) [-602.178] (-603.813) (-603.412) * [-607.375] (-603.712) (-604.187) (-605.853) -- 0:01:15
      38500 -- (-601.528) (-603.810) [-602.736] (-603.172) * (-604.264) (-605.738) [-605.188] (-601.519) -- 0:01:14
      39000 -- (-603.661) [-605.737] (-601.704) (-601.465) * (-604.029) (-602.565) (-602.940) [-603.024] -- 0:01:13
      39500 -- (-601.673) (-601.587) [-601.720] (-602.026) * (-607.057) (-602.991) [-604.701] (-602.889) -- 0:01:12
      40000 -- (-604.460) [-601.671] (-602.646) (-604.523) * [-602.836] (-601.622) (-604.361) (-603.430) -- 0:01:12

      Average standard deviation of split frequencies: 0.028152

      40500 -- [-604.374] (-604.452) (-604.472) (-602.201) * [-604.030] (-601.121) (-601.385) (-606.536) -- 0:01:11
      41000 -- (-601.378) [-601.854] (-603.007) (-601.279) * (-603.562) [-600.870] (-605.325) (-606.902) -- 0:01:10
      41500 -- (-604.094) [-603.573] (-603.123) (-600.755) * (-603.141) [-603.582] (-607.420) (-607.067) -- 0:01:09
      42000 -- [-601.371] (-603.669) (-604.914) (-601.733) * (-603.182) [-603.162] (-603.008) (-605.673) -- 0:01:08
      42500 -- [-601.280] (-604.974) (-603.649) (-603.449) * (-601.467) (-608.682) (-602.241) [-602.784] -- 0:01:07
      43000 -- (-602.343) (-601.631) [-602.354] (-601.731) * (-602.243) (-603.936) (-602.393) [-602.399] -- 0:01:06
      43500 -- (-606.457) [-607.726] (-603.837) (-601.628) * (-601.608) (-604.776) [-602.533] (-609.528) -- 0:01:05
      44000 -- (-603.181) [-601.703] (-602.800) (-601.357) * (-606.179) (-604.232) [-602.056] (-605.264) -- 0:01:05
      44500 -- (-603.256) (-603.678) [-606.146] (-603.189) * [-601.661] (-603.294) (-603.068) (-606.682) -- 0:01:04
      45000 -- [-602.618] (-601.979) (-604.771) (-601.898) * [-602.412] (-603.235) (-602.386) (-603.851) -- 0:01:03

      Average standard deviation of split frequencies: 0.025620

      45500 -- (-602.189) [-604.434] (-605.062) (-601.893) * [-604.058] (-601.433) (-609.258) (-601.198) -- 0:01:02
      46000 -- (-602.268) (-603.468) [-602.680] (-603.448) * (-601.471) (-602.955) [-601.427] (-601.189) -- 0:01:02
      46500 -- [-601.864] (-607.970) (-604.593) (-605.197) * (-601.509) [-604.129] (-603.535) (-603.621) -- 0:01:01
      47000 -- (-606.057) [-605.195] (-602.577) (-601.027) * (-602.638) [-603.046] (-607.592) (-604.755) -- 0:01:00
      47500 -- (-603.219) (-601.745) (-602.287) [-602.456] * [-601.763] (-603.307) (-604.742) (-603.221) -- 0:01:00
      48000 -- (-602.256) (-603.238) (-601.538) [-606.079] * (-602.058) (-603.429) [-604.543] (-606.387) -- 0:00:59
      48500 -- [-601.879] (-601.884) (-606.248) (-602.842) * (-605.692) [-604.898] (-608.687) (-604.210) -- 0:00:58
      49000 -- (-602.969) [-600.907] (-602.995) (-607.489) * [-605.048] (-603.475) (-601.549) (-603.236) -- 0:00:58
      49500 -- [-601.254] (-602.935) (-602.520) (-606.128) * (-601.865) (-603.853) [-602.055] (-602.229) -- 0:00:57
      50000 -- [-602.226] (-601.930) (-604.517) (-606.509) * (-601.823) (-603.052) [-604.815] (-603.342) -- 0:00:57

      Average standard deviation of split frequencies: 0.027447

      50500 -- (-603.003) (-601.941) [-602.243] (-607.362) * (-601.765) (-601.481) (-606.467) [-601.096] -- 0:00:56
      51000 -- (-602.659) [-601.353] (-601.724) (-601.953) * (-603.095) (-602.809) [-604.425] (-601.549) -- 0:00:55
      51500 -- (-602.101) (-601.528) [-601.470] (-602.548) * [-604.083] (-603.725) (-604.215) (-601.774) -- 0:00:55
      52000 -- [-603.058] (-604.096) (-602.387) (-605.403) * (-604.741) (-606.003) [-602.575] (-602.256) -- 0:00:54
      52500 -- (-602.428) (-603.949) [-602.284] (-604.978) * (-608.271) (-603.591) (-604.716) [-600.904] -- 0:00:54
      53000 -- (-604.011) [-602.029] (-605.155) (-600.935) * (-605.138) (-603.289) (-604.508) [-601.214] -- 0:00:53
      53500 -- (-602.783) [-602.710] (-601.982) (-601.359) * (-603.181) (-601.904) [-604.398] (-604.250) -- 0:00:53
      54000 -- (-602.212) (-607.071) [-602.383] (-601.489) * (-602.656) (-601.940) (-605.867) [-602.018] -- 0:01:10
      54500 -- (-602.112) (-603.059) (-604.086) [-601.066] * (-602.649) [-602.896] (-602.327) (-603.066) -- 0:01:09
      55000 -- (-602.017) [-602.527] (-601.776) (-605.070) * (-604.921) (-602.744) (-604.138) [-604.377] -- 0:01:08

      Average standard deviation of split frequencies: 0.024853

      55500 -- (-603.169) (-601.721) (-602.672) [-603.701] * [-605.499] (-601.702) (-603.891) (-604.870) -- 0:01:08
      56000 -- [-602.901] (-602.726) (-602.014) (-602.588) * (-602.894) (-603.877) (-604.377) [-603.661] -- 0:01:07
      56500 -- [-601.500] (-603.307) (-608.066) (-603.408) * [-603.197] (-601.279) (-603.952) (-602.002) -- 0:01:06
      57000 -- (-601.189) (-601.181) (-602.633) [-601.717] * (-603.248) (-600.924) (-604.096) [-601.587] -- 0:01:06
      57500 -- (-602.728) [-601.849] (-604.678) (-601.671) * (-603.652) (-605.106) [-603.583] (-601.906) -- 0:01:05
      58000 -- (-601.956) [-602.851] (-603.924) (-602.047) * (-603.293) (-602.375) (-602.486) [-601.555] -- 0:01:04
      58500 -- [-604.956] (-602.263) (-602.952) (-604.857) * (-603.718) (-604.069) (-603.006) [-602.451] -- 0:01:04
      59000 -- [-601.481] (-602.433) (-602.133) (-608.742) * (-603.235) (-602.824) (-601.913) [-607.278] -- 0:01:03
      59500 -- (-603.572) [-604.399] (-602.813) (-603.933) * (-605.063) [-602.208] (-602.712) (-603.283) -- 0:01:03
      60000 -- (-604.728) (-602.094) [-602.826] (-601.629) * [-603.447] (-605.367) (-602.434) (-604.003) -- 0:01:02

      Average standard deviation of split frequencies: 0.023700

      60500 -- (-602.786) (-604.604) (-604.843) [-602.900] * [-602.855] (-604.225) (-601.290) (-603.910) -- 0:01:02
      61000 -- (-603.051) [-606.599] (-608.068) (-603.907) * (-605.034) (-604.158) [-604.360] (-602.467) -- 0:01:01
      61500 -- (-601.782) (-602.324) [-603.814] (-603.188) * (-605.092) (-602.733) [-604.151] (-601.764) -- 0:01:01
      62000 -- (-601.804) (-600.675) (-605.428) [-604.752] * (-601.544) (-601.179) [-603.070] (-603.065) -- 0:01:00
      62500 -- (-601.259) (-606.622) [-602.578] (-603.379) * (-602.249) (-601.778) [-603.604] (-602.116) -- 0:01:00
      63000 -- (-601.804) [-601.237] (-604.584) (-602.031) * (-602.457) (-607.572) [-601.369] (-601.676) -- 0:00:59
      63500 -- (-604.384) (-601.590) [-602.495] (-603.186) * (-601.757) [-604.758] (-605.089) (-601.729) -- 0:00:58
      64000 -- (-604.660) [-601.342] (-601.838) (-601.414) * (-601.068) (-609.094) [-605.727] (-604.244) -- 0:00:58
      64500 -- [-604.621] (-603.040) (-602.820) (-601.680) * (-602.371) (-602.665) [-604.023] (-604.182) -- 0:00:58
      65000 -- [-602.206] (-602.669) (-608.516) (-603.227) * (-603.502) (-602.967) (-606.171) [-601.994] -- 0:00:57

      Average standard deviation of split frequencies: 0.024284

      65500 -- (-606.009) (-601.565) [-602.874] (-603.809) * (-602.345) (-603.975) [-601.634] (-603.969) -- 0:00:57
      66000 -- (-603.811) (-602.094) [-603.788] (-602.737) * (-601.612) (-603.173) [-603.341] (-603.745) -- 0:00:56
      66500 -- (-602.680) (-602.310) [-602.196] (-604.951) * (-601.122) (-602.951) (-601.660) [-603.461] -- 0:00:56
      67000 -- (-601.915) [-601.773] (-602.212) (-601.909) * (-603.631) (-603.655) [-602.390] (-605.623) -- 0:00:55
      67500 -- (-601.547) (-601.420) [-602.020] (-607.733) * (-603.236) (-604.143) [-603.352] (-603.711) -- 0:00:55
      68000 -- [-607.355] (-601.337) (-601.555) (-606.475) * (-608.551) [-604.033] (-602.940) (-607.672) -- 0:00:54
      68500 -- [-603.365] (-602.041) (-602.481) (-604.154) * (-602.949) (-601.958) [-601.310] (-605.183) -- 0:00:54
      69000 -- [-601.323] (-604.183) (-604.724) (-603.606) * (-604.986) (-601.412) (-601.543) [-601.091] -- 0:00:53
      69500 -- (-601.548) (-602.289) [-603.085] (-608.572) * (-605.272) (-603.282) (-601.738) [-602.714] -- 0:00:53
      70000 -- [-602.318] (-604.053) (-603.060) (-601.870) * (-605.388) (-602.364) (-602.803) [-601.044] -- 0:01:06

      Average standard deviation of split frequencies: 0.026016

      70500 -- (-601.828) (-602.205) (-603.170) [-601.372] * (-604.738) [-602.324] (-604.298) (-603.673) -- 0:01:05
      71000 -- (-602.765) (-601.938) (-602.417) [-601.519] * [-604.481] (-602.842) (-603.357) (-604.644) -- 0:01:05
      71500 -- [-601.546] (-603.249) (-605.152) (-604.980) * [-604.561] (-602.433) (-604.733) (-601.422) -- 0:01:04
      72000 -- [-602.081] (-602.596) (-602.355) (-605.864) * (-606.274) (-604.373) [-602.915] (-602.463) -- 0:01:04
      72500 -- (-605.823) (-604.185) (-602.830) [-605.558] * (-605.707) (-603.077) [-602.626] (-601.733) -- 0:01:03
      73000 -- (-605.100) [-602.519] (-605.673) (-602.347) * (-607.429) (-602.702) [-604.958] (-602.360) -- 0:01:03
      73500 -- (-604.646) (-601.625) (-601.874) [-604.319] * (-603.932) (-605.392) [-604.071] (-601.257) -- 0:01:03
      74000 -- (-602.296) (-603.724) (-604.885) [-603.540] * (-602.463) [-604.631] (-605.621) (-604.553) -- 0:01:02
      74500 -- (-602.943) [-605.133] (-603.955) (-602.347) * (-602.262) (-602.904) (-605.205) [-603.777] -- 0:01:02
      75000 -- (-602.824) (-605.646) (-607.533) [-603.086] * (-604.587) (-605.981) (-605.344) [-603.075] -- 0:01:01

      Average standard deviation of split frequencies: 0.026982

      75500 -- [-604.515] (-602.093) (-605.658) (-602.613) * [-602.799] (-605.438) (-605.282) (-604.913) -- 0:01:01
      76000 -- (-603.523) (-602.636) [-605.618] (-605.373) * (-601.763) (-603.949) [-602.537] (-602.620) -- 0:01:00
      76500 -- (-603.935) [-604.041] (-602.011) (-611.618) * (-603.970) (-602.269) [-602.997] (-603.059) -- 0:01:00
      77000 -- (-603.464) (-602.767) (-603.076) [-601.175] * (-603.512) [-601.868] (-603.916) (-603.563) -- 0:00:59
      77500 -- (-602.969) [-601.016] (-601.381) (-605.516) * (-603.409) [-604.276] (-601.676) (-601.974) -- 0:00:59
      78000 -- (-602.764) (-602.556) (-606.978) [-601.064] * [-601.706] (-605.883) (-602.842) (-600.866) -- 0:00:59
      78500 -- (-601.987) [-601.614] (-606.302) (-601.321) * (-608.020) (-602.805) [-600.979] (-602.082) -- 0:00:58
      79000 -- (-601.840) [-603.659] (-605.452) (-602.040) * [-602.931] (-602.037) (-602.229) (-601.889) -- 0:00:58
      79500 -- [-602.573] (-606.074) (-601.778) (-602.196) * (-601.481) [-601.451] (-601.546) (-607.238) -- 0:00:57
      80000 -- (-602.345) (-606.509) [-602.129] (-601.619) * (-601.708) [-602.659] (-602.913) (-603.844) -- 0:00:57

      Average standard deviation of split frequencies: 0.028941

      80500 -- [-602.440] (-605.829) (-603.445) (-601.479) * [-601.404] (-601.462) (-602.929) (-606.908) -- 0:00:57
      81000 -- [-603.008] (-602.918) (-603.602) (-602.831) * (-602.239) (-604.264) (-604.440) [-606.441] -- 0:00:56
      81500 -- (-601.822) (-606.196) (-603.792) [-605.074] * (-603.470) (-606.570) [-601.891] (-603.435) -- 0:00:56
      82000 -- (-603.662) (-602.632) [-601.816] (-603.397) * (-605.275) (-603.257) [-602.298] (-603.593) -- 0:00:55
      82500 -- [-602.851] (-602.478) (-607.087) (-606.808) * (-602.029) (-602.697) [-602.597] (-604.331) -- 0:00:55
      83000 -- (-600.883) [-605.539] (-604.936) (-604.686) * (-602.030) [-603.242] (-606.037) (-602.868) -- 0:00:55
      83500 -- (-601.313) (-601.922) [-603.390] (-601.501) * (-604.521) (-602.395) (-601.637) [-604.377] -- 0:00:54
      84000 -- (-603.572) [-601.538] (-601.569) (-603.716) * (-602.712) [-606.296] (-608.557) (-604.439) -- 0:00:54
      84500 -- (-603.519) (-601.916) (-602.485) [-601.430] * [-602.147] (-608.238) (-608.268) (-603.324) -- 0:00:54
      85000 -- (-602.765) (-602.978) [-603.689] (-603.565) * [-602.060] (-604.774) (-604.826) (-604.561) -- 0:00:53

      Average standard deviation of split frequencies: 0.024797

      85500 -- (-606.660) (-606.816) [-604.170] (-605.370) * (-602.454) (-601.698) [-602.187] (-601.649) -- 0:00:53
      86000 -- (-603.826) (-603.495) (-604.330) [-602.316] * (-603.955) [-602.341] (-602.319) (-602.198) -- 0:00:53
      86500 -- (-602.763) [-602.196] (-603.369) (-604.592) * (-604.180) (-603.950) [-602.120] (-602.560) -- 0:00:52
      87000 -- (-604.966) [-606.048] (-605.598) (-604.800) * [-603.018] (-601.555) (-602.546) (-603.326) -- 0:01:02
      87500 -- [-603.108] (-606.565) (-609.741) (-601.445) * (-604.727) (-601.613) [-603.552] (-603.848) -- 0:01:02
      88000 -- [-603.590] (-603.836) (-602.870) (-601.503) * [-601.644] (-602.394) (-609.301) (-603.442) -- 0:01:02
      88500 -- [-604.855] (-607.191) (-602.495) (-601.996) * (-605.225) (-603.506) (-601.563) [-603.827] -- 0:01:01
      89000 -- (-604.134) [-602.472] (-601.820) (-603.859) * (-606.125) (-602.211) (-607.475) [-603.921] -- 0:01:01
      89500 -- (-602.520) [-602.492] (-601.427) (-603.473) * [-603.152] (-601.340) (-603.126) (-606.681) -- 0:01:01
      90000 -- (-604.151) (-601.236) [-603.882] (-605.165) * (-602.813) (-601.371) (-602.775) [-602.918] -- 0:01:00

      Average standard deviation of split frequencies: 0.023026

      90500 -- (-605.120) (-602.514) [-601.991] (-602.569) * [-602.667] (-601.186) (-602.930) (-602.362) -- 0:01:00
      91000 -- (-607.428) [-601.956] (-605.289) (-603.264) * [-605.238] (-603.507) (-602.014) (-604.551) -- 0:00:59
      91500 -- (-602.494) [-602.326] (-603.354) (-602.632) * [-602.767] (-603.094) (-600.794) (-605.431) -- 0:00:59
      92000 -- (-602.401) (-604.900) (-604.031) [-602.064] * (-602.244) (-601.570) [-601.399] (-606.637) -- 0:00:59
      92500 -- (-604.761) (-602.565) (-603.206) [-602.700] * (-604.947) [-601.369] (-602.023) (-606.567) -- 0:00:58
      93000 -- (-602.555) (-603.122) [-604.969] (-603.469) * (-603.649) (-603.031) [-603.610] (-602.505) -- 0:00:58
      93500 -- (-603.473) (-601.629) [-604.949] (-603.749) * (-606.654) (-603.000) (-603.537) [-601.216] -- 0:00:58
      94000 -- [-602.333] (-602.898) (-603.552) (-601.763) * (-606.176) (-603.503) (-601.780) [-602.623] -- 0:00:57
      94500 -- (-602.935) [-601.268] (-601.193) (-605.438) * (-606.440) (-602.155) [-603.705] (-605.593) -- 0:00:57
      95000 -- [-601.864] (-601.465) (-600.831) (-608.476) * (-602.801) (-605.761) (-603.504) [-605.294] -- 0:00:57

      Average standard deviation of split frequencies: 0.023383

      95500 -- (-604.900) (-601.561) (-600.761) [-601.337] * (-601.742) (-602.024) [-601.905] (-602.813) -- 0:00:56
      96000 -- (-604.100) (-614.398) (-601.458) [-600.853] * [-601.150] (-605.589) (-603.411) (-602.669) -- 0:00:56
      96500 -- [-605.376] (-603.285) (-601.705) (-604.545) * [-606.204] (-603.388) (-601.366) (-600.947) -- 0:00:56
      97000 -- (-603.102) (-602.177) (-601.885) [-605.567] * [-604.039] (-603.067) (-601.782) (-605.630) -- 0:00:55
      97500 -- (-602.706) (-603.719) [-601.845] (-605.467) * [-602.744] (-602.215) (-602.046) (-603.573) -- 0:00:55
      98000 -- [-600.915] (-602.937) (-602.867) (-603.434) * [-604.008] (-602.551) (-602.128) (-600.879) -- 0:00:55
      98500 -- [-603.477] (-606.357) (-603.624) (-603.483) * (-603.763) (-602.058) (-607.721) [-603.881] -- 0:00:54
      99000 -- [-602.095] (-604.511) (-604.259) (-601.739) * (-603.241) (-602.311) (-602.020) [-601.387] -- 0:00:54
      99500 -- [-602.744] (-604.313) (-601.828) (-602.749) * [-602.526] (-603.484) (-601.501) (-603.651) -- 0:00:54
      100000 -- (-602.880) (-602.293) (-601.960) [-606.134] * (-606.260) [-603.169] (-602.179) (-601.677) -- 0:00:54

      Average standard deviation of split frequencies: 0.025521

      100500 -- (-602.318) (-601.272) [-604.942] (-604.766) * (-608.257) [-604.481] (-603.021) (-600.812) -- 0:00:53
      101000 -- (-606.029) [-605.595] (-602.117) (-604.370) * (-601.496) (-606.173) (-601.349) [-602.752] -- 0:00:53
      101500 -- (-601.836) [-601.243] (-602.703) (-603.517) * (-602.583) (-601.164) [-601.316] (-603.432) -- 0:00:53
      102000 -- (-602.020) [-602.553] (-604.765) (-602.374) * (-601.310) [-602.020] (-604.067) (-607.120) -- 0:00:52
      102500 -- (-602.969) [-602.699] (-602.816) (-602.625) * [-604.015] (-602.130) (-601.713) (-606.820) -- 0:00:52
      103000 -- [-601.884] (-603.240) (-602.294) (-603.619) * (-601.423) (-601.804) [-602.968] (-606.954) -- 0:00:52
      103500 -- (-601.103) (-604.234) (-602.100) [-602.633] * (-601.545) [-605.781] (-606.242) (-602.317) -- 0:00:51
      104000 -- (-603.469) (-604.116) [-602.384] (-601.909) * (-601.780) (-604.266) [-601.651] (-602.238) -- 0:01:00
      104500 -- (-603.044) (-602.643) [-603.829] (-603.143) * [-603.064] (-603.896) (-606.954) (-602.308) -- 0:00:59
      105000 -- (-603.199) [-603.897] (-601.817) (-604.062) * (-606.306) [-603.454] (-601.450) (-604.593) -- 0:00:59

      Average standard deviation of split frequencies: 0.022448

      105500 -- (-601.427) (-602.231) (-602.114) [-604.590] * (-605.625) (-605.528) [-601.468] (-603.855) -- 0:00:59
      106000 -- (-601.733) (-603.206) (-603.595) [-602.306] * [-604.860] (-602.585) (-604.694) (-614.706) -- 0:00:59
      106500 -- (-601.411) (-604.486) [-604.429] (-603.107) * [-602.245] (-602.979) (-603.806) (-603.771) -- 0:00:58
      107000 -- (-605.901) (-603.276) (-601.250) [-602.420] * [-602.060] (-604.386) (-604.837) (-603.323) -- 0:00:58
      107500 -- [-602.131] (-602.950) (-602.332) (-604.940) * [-601.942] (-605.459) (-606.574) (-602.523) -- 0:00:58
      108000 -- (-602.228) [-604.029] (-603.695) (-603.728) * (-602.437) (-602.928) (-602.821) [-601.519] -- 0:00:57
      108500 -- (-603.165) [-601.571] (-602.627) (-601.621) * (-602.893) [-603.246] (-606.389) (-603.842) -- 0:00:57
      109000 -- (-601.347) [-604.781] (-603.142) (-602.183) * (-601.802) [-602.141] (-601.989) (-602.092) -- 0:00:57
      109500 -- (-601.919) (-606.909) [-601.717] (-602.494) * (-606.749) [-603.128] (-600.912) (-603.089) -- 0:00:56
      110000 -- (-601.198) [-603.856] (-601.325) (-603.569) * (-603.944) (-603.718) (-602.263) [-601.832] -- 0:00:56

      Average standard deviation of split frequencies: 0.020446

      110500 -- (-602.183) (-601.671) [-601.910] (-602.068) * [-604.026] (-603.220) (-602.598) (-600.863) -- 0:00:56
      111000 -- (-601.143) [-604.392] (-603.691) (-601.197) * (-601.314) [-603.675] (-602.184) (-601.204) -- 0:00:56
      111500 -- (-601.594) (-608.465) (-604.570) [-600.722] * (-601.122) (-602.919) (-601.708) [-600.925] -- 0:00:55
      112000 -- (-607.386) (-600.959) [-603.694] (-601.195) * (-602.191) (-600.875) [-605.863] (-601.370) -- 0:00:55
      112500 -- (-602.627) (-605.400) (-603.393) [-602.322] * (-602.431) (-601.534) (-605.466) [-601.595] -- 0:00:55
      113000 -- (-602.295) [-605.377] (-602.958) (-601.398) * (-602.436) (-604.773) (-602.530) [-603.070] -- 0:00:54
      113500 -- (-602.658) [-603.926] (-604.535) (-601.866) * (-604.374) (-603.536) (-603.319) [-602.506] -- 0:00:54
      114000 -- [-601.098] (-604.967) (-603.747) (-601.408) * (-602.413) (-601.499) (-603.482) [-602.123] -- 0:00:54
      114500 -- (-602.332) (-604.414) (-601.331) [-600.968] * (-604.881) [-606.235] (-602.169) (-602.378) -- 0:00:54
      115000 -- [-605.569] (-605.223) (-603.432) (-601.633) * [-605.178] (-603.320) (-603.263) (-606.251) -- 0:00:53

      Average standard deviation of split frequencies: 0.019464

      115500 -- (-602.587) (-607.806) (-601.063) [-604.243] * (-602.313) (-603.421) [-602.844] (-605.367) -- 0:00:53
      116000 -- [-601.704] (-601.820) (-605.815) (-602.896) * (-605.235) (-603.020) [-605.442] (-601.883) -- 0:00:53
      116500 -- (-605.096) (-601.933) [-601.451] (-603.555) * (-601.198) (-603.632) [-601.101] (-606.629) -- 0:00:53
      117000 -- [-603.279] (-604.033) (-604.856) (-602.109) * [-601.598] (-602.392) (-601.502) (-605.730) -- 0:00:52
      117500 -- (-602.119) (-602.828) [-606.415] (-602.666) * (-602.559) (-602.319) (-602.095) [-602.338] -- 0:00:52
      118000 -- (-605.707) (-602.810) [-601.876] (-606.543) * (-603.753) (-602.079) (-601.472) [-603.010] -- 0:00:52
      118500 -- (-601.633) (-602.387) [-602.229] (-603.049) * [-605.164] (-602.433) (-601.457) (-601.974) -- 0:00:52
      119000 -- (-603.607) [-603.229] (-603.731) (-605.021) * (-604.404) (-608.905) (-602.730) [-602.593] -- 0:00:51
      119500 -- (-601.241) (-601.578) [-605.176] (-603.449) * (-601.694) (-605.665) [-604.473] (-603.584) -- 0:00:51
      120000 -- [-601.683] (-602.532) (-602.033) (-601.868) * (-603.720) (-604.287) [-603.494] (-601.487) -- 0:00:51

      Average standard deviation of split frequencies: 0.020705

      120500 -- (-603.262) (-603.588) [-602.040] (-601.304) * [-602.946] (-602.303) (-605.730) (-602.672) -- 0:00:51
      121000 -- (-602.567) (-601.020) (-603.010) [-604.408] * (-604.748) (-603.805) (-602.978) [-601.612] -- 0:00:58
      121500 -- (-603.549) (-606.053) [-604.862] (-601.727) * [-604.230] (-604.633) (-602.689) (-604.073) -- 0:00:57
      122000 -- (-602.477) [-601.944] (-603.903) (-602.725) * [-602.833] (-603.933) (-605.874) (-605.141) -- 0:00:57
      122500 -- [-601.680] (-604.374) (-604.361) (-601.833) * (-602.637) (-604.006) [-605.131] (-607.425) -- 0:00:57
      123000 -- (-602.036) (-606.096) [-602.264] (-607.428) * (-601.424) [-605.206] (-601.605) (-603.816) -- 0:00:57
      123500 -- [-601.725] (-603.630) (-601.733) (-606.025) * (-604.845) (-600.733) (-608.755) [-601.922] -- 0:00:56
      124000 -- (-601.548) (-606.608) (-603.185) [-606.958] * (-602.979) (-601.436) (-602.879) [-611.410] -- 0:00:56
      124500 -- (-603.027) [-605.232] (-608.209) (-603.500) * [-603.454] (-606.585) (-602.292) (-605.595) -- 0:00:56
      125000 -- [-603.458] (-602.546) (-603.527) (-605.101) * (-602.932) (-604.132) [-602.264] (-605.571) -- 0:00:56

      Average standard deviation of split frequencies: 0.018172

      125500 -- [-602.172] (-604.171) (-603.811) (-603.445) * (-602.306) (-603.728) [-601.925] (-607.838) -- 0:00:55
      126000 -- [-605.756] (-604.172) (-604.423) (-602.546) * (-604.454) (-605.331) (-602.210) [-603.781] -- 0:00:55
      126500 -- [-602.832] (-603.334) (-608.168) (-601.331) * [-603.183] (-602.883) (-602.025) (-603.816) -- 0:00:55
      127000 -- [-604.317] (-606.385) (-604.161) (-603.005) * [-604.200] (-603.078) (-604.885) (-602.028) -- 0:00:54
      127500 -- (-605.086) (-604.269) [-603.038] (-603.079) * [-605.361] (-600.952) (-601.434) (-604.975) -- 0:00:54
      128000 -- [-603.207] (-601.932) (-605.072) (-603.624) * (-601.810) (-607.872) (-603.015) [-602.061] -- 0:00:54
      128500 -- (-602.642) (-603.757) [-604.166] (-604.666) * (-601.678) [-604.402] (-606.871) (-603.766) -- 0:00:54
      129000 -- [-602.296] (-603.121) (-605.483) (-602.920) * (-603.192) (-601.913) (-602.198) [-604.507] -- 0:00:54
      129500 -- [-604.975] (-603.378) (-605.416) (-606.596) * (-605.806) [-601.656] (-603.083) (-601.851) -- 0:00:53
      130000 -- (-603.094) (-602.561) (-605.870) [-604.717] * (-602.003) (-603.363) (-605.613) [-602.281] -- 0:00:53

      Average standard deviation of split frequencies: 0.018219

      130500 -- [-605.630] (-602.834) (-601.893) (-605.089) * (-602.394) (-605.600) (-601.848) [-602.259] -- 0:00:53
      131000 -- (-602.181) (-601.030) (-603.179) [-604.415] * (-602.498) [-606.072] (-600.888) (-603.199) -- 0:00:53
      131500 -- (-602.156) (-602.116) [-601.818] (-607.793) * (-603.222) (-602.302) [-601.373] (-602.131) -- 0:00:52
      132000 -- [-604.193] (-603.332) (-604.966) (-604.334) * [-603.758] (-603.273) (-602.241) (-606.395) -- 0:00:52
      132500 -- (-603.243) [-605.046] (-602.667) (-603.245) * (-602.261) (-602.622) (-605.302) [-603.200] -- 0:00:52
      133000 -- (-603.832) (-603.873) (-604.676) [-602.579] * [-605.628] (-602.116) (-601.719) (-604.724) -- 0:00:52
      133500 -- (-607.203) [-602.851] (-604.426) (-603.408) * (-608.577) [-601.832] (-604.411) (-601.352) -- 0:00:51
      134000 -- (-602.733) [-605.549] (-603.858) (-604.048) * (-607.897) [-603.418] (-601.593) (-603.014) -- 0:00:51
      134500 -- (-601.259) (-602.124) (-605.678) [-601.146] * (-603.109) (-601.383) [-601.886] (-601.691) -- 0:00:51
      135000 -- [-601.227] (-609.224) (-607.660) (-602.241) * [-601.198] (-603.393) (-604.541) (-602.491) -- 0:00:51

      Average standard deviation of split frequencies: 0.018198

      135500 -- (-601.646) (-605.961) (-604.076) [-609.023] * (-601.371) [-611.657] (-601.911) (-603.966) -- 0:00:51
      136000 -- (-601.445) (-603.327) (-604.150) [-605.235] * (-601.588) (-607.744) [-600.904] (-601.582) -- 0:00:50
      136500 -- (-601.089) (-602.753) (-601.079) [-601.865] * (-603.569) (-601.897) [-600.779] (-601.438) -- 0:00:50
      137000 -- (-604.526) (-603.576) (-601.399) [-602.907] * [-601.420] (-603.740) (-604.751) (-601.883) -- 0:00:50
      137500 -- [-604.100] (-603.832) (-603.251) (-603.613) * (-602.357) [-604.592] (-604.656) (-602.914) -- 0:00:50
      138000 -- (-602.318) [-601.519] (-602.800) (-603.673) * (-604.996) (-603.707) (-602.952) [-601.434] -- 0:00:56
      138500 -- (-607.801) (-603.172) [-605.289] (-602.613) * (-606.442) [-608.303] (-602.165) (-603.276) -- 0:00:55
      139000 -- (-605.120) (-601.716) [-602.562] (-603.116) * (-603.646) (-606.370) [-601.868] (-601.235) -- 0:00:55
      139500 -- (-606.225) (-607.333) (-603.417) [-604.537] * [-603.144] (-607.552) (-602.026) (-602.973) -- 0:00:55
      140000 -- (-604.924) (-604.356) [-601.184] (-600.988) * (-603.677) (-603.639) [-601.765] (-602.311) -- 0:00:55

      Average standard deviation of split frequencies: 0.016589

      140500 -- (-605.797) (-602.925) [-602.342] (-603.226) * (-602.762) (-601.422) [-601.325] (-602.785) -- 0:00:55
      141000 -- [-601.467] (-609.130) (-601.430) (-603.545) * (-604.169) (-602.141) (-603.255) [-603.510] -- 0:00:54
      141500 -- (-602.100) (-604.182) [-601.322] (-602.734) * (-603.334) (-602.837) (-601.413) [-602.754] -- 0:00:54
      142000 -- (-601.020) (-605.777) [-600.731] (-602.502) * (-603.860) (-601.900) (-608.344) [-603.189] -- 0:00:54
      142500 -- (-603.011) (-603.302) [-604.325] (-604.975) * (-603.149) (-606.793) [-606.478] (-602.399) -- 0:00:54
      143000 -- (-601.988) (-602.491) (-603.334) [-601.475] * [-602.613] (-602.375) (-605.663) (-602.437) -- 0:00:53
      143500 -- (-602.837) (-602.523) (-601.461) [-605.238] * (-601.597) (-603.011) [-603.241] (-602.288) -- 0:00:53
      144000 -- (-604.953) [-602.678] (-603.362) (-603.162) * [-602.471] (-602.346) (-603.021) (-601.821) -- 0:00:53
      144500 -- [-602.566] (-605.902) (-603.780) (-603.682) * (-602.649) (-605.387) (-601.641) [-603.725] -- 0:00:53
      145000 -- [-602.187] (-603.484) (-603.023) (-602.480) * (-604.193) (-603.432) (-603.562) [-608.297] -- 0:00:53

      Average standard deviation of split frequencies: 0.016628

      145500 -- (-604.596) (-602.135) [-603.056] (-601.498) * (-606.198) (-603.309) [-603.649] (-603.945) -- 0:00:52
      146000 -- (-603.940) (-601.720) [-602.513] (-604.583) * (-604.888) (-602.220) (-602.934) [-603.617] -- 0:00:52
      146500 -- (-603.956) (-605.445) [-601.875] (-602.726) * (-603.232) [-603.273] (-604.453) (-604.790) -- 0:00:52
      147000 -- (-603.920) [-601.774] (-606.861) (-604.101) * (-602.618) [-602.867] (-603.808) (-603.021) -- 0:00:52
      147500 -- (-607.414) [-603.002] (-602.054) (-603.464) * (-606.362) (-603.240) [-601.635] (-604.707) -- 0:00:52
      148000 -- (-603.232) (-602.107) (-602.085) [-602.345] * (-608.048) [-602.427] (-604.290) (-603.909) -- 0:00:51
      148500 -- (-603.942) [-600.719] (-601.958) (-601.323) * (-605.310) (-601.444) (-603.048) [-605.923] -- 0:00:51
      149000 -- (-602.537) (-601.691) [-603.047] (-604.305) * (-605.327) [-601.655] (-604.271) (-604.358) -- 0:00:51
      149500 -- [-602.196] (-601.955) (-602.457) (-602.075) * (-601.542) (-602.059) [-602.801] (-601.509) -- 0:00:51
      150000 -- [-602.237] (-602.203) (-603.408) (-602.841) * (-602.865) (-601.699) (-603.404) [-604.702] -- 0:00:51

      Average standard deviation of split frequencies: 0.015018

      150500 -- [-601.514] (-601.836) (-602.819) (-601.890) * (-605.895) (-602.660) (-604.880) [-601.668] -- 0:00:50
      151000 -- [-601.853] (-601.968) (-601.093) (-601.694) * (-604.796) [-601.034] (-602.248) (-601.579) -- 0:00:50
      151500 -- [-601.342] (-602.079) (-601.436) (-602.934) * (-604.447) (-602.322) (-603.992) [-602.024] -- 0:00:50
      152000 -- [-603.019] (-607.391) (-602.402) (-601.772) * (-604.760) (-605.506) [-605.943] (-610.172) -- 0:00:50
      152500 -- [-602.209] (-605.533) (-603.655) (-601.709) * [-604.194] (-602.273) (-601.991) (-605.881) -- 0:00:50
      153000 -- (-601.904) [-604.351] (-606.249) (-601.536) * (-604.476) (-601.580) [-604.915] (-602.699) -- 0:00:49
      153500 -- (-606.013) (-604.996) [-603.788] (-604.185) * (-604.359) (-606.661) [-603.743] (-602.838) -- 0:00:49
      154000 -- (-602.762) (-602.249) [-604.097] (-604.099) * (-604.117) [-604.169] (-606.720) (-603.964) -- 0:00:49
      154500 -- (-605.438) (-602.147) [-602.076] (-601.247) * (-604.124) (-602.409) [-601.354] (-602.588) -- 0:00:54
      155000 -- (-605.384) [-603.862] (-602.749) (-603.883) * (-601.970) (-603.141) (-605.028) [-601.614] -- 0:00:54

      Average standard deviation of split frequencies: 0.013749

      155500 -- [-600.966] (-601.952) (-602.189) (-603.981) * (-610.386) [-601.782] (-601.164) (-601.685) -- 0:00:54
      156000 -- (-602.488) (-603.648) [-601.917] (-604.694) * (-601.582) (-602.750) (-601.377) [-601.452] -- 0:00:54
      156500 -- (-604.283) (-601.468) [-603.401] (-609.710) * (-603.407) (-602.167) (-603.085) [-601.936] -- 0:00:53
      157000 -- (-605.370) (-602.455) [-603.991] (-606.659) * (-602.128) (-604.705) (-604.751) [-603.065] -- 0:00:53
      157500 -- (-607.076) (-603.370) (-602.170) [-606.131] * (-601.927) (-601.158) (-602.176) [-605.152] -- 0:00:53
      158000 -- (-605.059) (-603.365) [-602.896] (-602.278) * [-603.477] (-601.610) (-601.983) (-602.388) -- 0:00:53
      158500 -- (-606.808) (-602.564) [-604.831] (-602.205) * (-603.576) [-606.061] (-603.352) (-604.323) -- 0:00:53
      159000 -- (-606.903) [-601.767] (-601.255) (-602.242) * (-603.165) (-602.093) [-605.837] (-602.940) -- 0:00:52
      159500 -- (-608.345) [-603.375] (-602.274) (-602.898) * (-602.039) [-602.391] (-603.184) (-601.230) -- 0:00:52
      160000 -- (-608.305) (-604.699) [-603.433] (-607.545) * (-605.104) (-602.645) (-603.528) [-601.176] -- 0:00:52

      Average standard deviation of split frequencies: 0.011736

      160500 -- (-602.635) (-602.015) (-603.114) [-603.039] * (-604.262) (-605.848) [-601.789] (-601.635) -- 0:00:52
      161000 -- [-603.429] (-600.808) (-605.452) (-603.624) * (-603.031) (-603.155) [-601.722] (-601.578) -- 0:00:52
      161500 -- (-602.722) (-603.141) (-601.683) [-603.174] * (-608.488) (-601.607) (-605.019) [-600.798] -- 0:00:51
      162000 -- (-608.580) (-602.628) (-601.990) [-601.783] * (-602.870) [-601.536] (-604.682) (-601.184) -- 0:00:51
      162500 -- (-604.565) (-604.872) (-601.685) [-602.799] * (-606.063) [-601.328] (-602.780) (-601.483) -- 0:00:51
      163000 -- (-604.915) [-601.686] (-601.886) (-603.268) * (-604.895) [-601.749] (-605.536) (-604.838) -- 0:00:51
      163500 -- (-602.410) (-602.966) (-601.284) [-602.023] * (-603.341) (-601.704) [-600.783] (-605.007) -- 0:00:51
      164000 -- [-602.998] (-602.643) (-602.326) (-601.444) * (-601.731) (-603.476) (-601.317) [-603.002] -- 0:00:50
      164500 -- (-602.361) [-601.472] (-601.903) (-601.046) * [-603.500] (-601.944) (-605.844) (-603.803) -- 0:00:50
      165000 -- (-605.286) [-605.274] (-602.336) (-606.178) * [-606.054] (-602.654) (-604.841) (-603.801) -- 0:00:50

      Average standard deviation of split frequencies: 0.013063

      165500 -- (-602.262) (-604.935) (-601.302) [-607.660] * (-602.400) (-603.423) [-601.798] (-601.411) -- 0:00:50
      166000 -- (-605.690) (-602.419) (-602.917) [-602.744] * [-601.741] (-606.829) (-602.534) (-602.652) -- 0:00:50
      166500 -- (-603.693) [-601.437] (-601.668) (-601.013) * [-602.419] (-602.729) (-607.465) (-603.438) -- 0:00:50
      167000 -- (-604.523) [-601.578] (-604.801) (-603.375) * [-602.196] (-602.244) (-602.860) (-601.421) -- 0:00:49
      167500 -- (-602.477) [-603.975] (-604.014) (-605.466) * [-603.282] (-601.328) (-603.360) (-601.339) -- 0:00:49
      168000 -- (-603.224) (-601.535) (-603.767) [-604.005] * (-604.588) (-601.367) [-601.680] (-600.855) -- 0:00:49
      168500 -- [-602.146] (-602.404) (-602.721) (-605.427) * (-604.728) [-601.250] (-602.102) (-604.370) -- 0:00:49
      169000 -- (-605.324) [-602.088] (-603.139) (-602.557) * [-601.942] (-601.917) (-602.030) (-604.880) -- 0:00:49
      169500 -- (-604.854) (-602.988) [-606.265] (-601.810) * (-602.393) (-601.483) [-603.426] (-605.618) -- 0:00:48
      170000 -- (-603.002) (-602.898) [-608.209] (-602.171) * (-603.221) [-604.957] (-602.875) (-605.021) -- 0:00:48

      Average standard deviation of split frequencies: 0.015054

      170500 -- (-604.354) (-602.972) (-603.790) [-601.958] * (-602.628) (-602.273) [-605.406] (-604.461) -- 0:00:48
      171000 -- (-602.573) (-603.296) [-603.215] (-606.137) * (-604.844) (-601.200) (-601.376) [-601.854] -- 0:00:48
      171500 -- (-602.907) (-606.138) [-602.349] (-601.594) * (-602.733) (-602.689) [-604.029] (-602.024) -- 0:00:48
      172000 -- [-603.966] (-603.103) (-604.087) (-602.692) * (-602.803) (-601.754) (-602.221) [-601.835] -- 0:00:52
      172500 -- [-604.511] (-601.392) (-602.192) (-604.389) * (-607.389) (-601.437) [-600.726] (-602.531) -- 0:00:52
      173000 -- (-604.232) (-602.487) (-603.914) [-601.527] * (-605.402) (-601.390) [-600.909] (-601.897) -- 0:00:52
      173500 -- (-602.672) (-606.649) (-601.142) [-604.535] * (-601.702) (-603.240) [-600.706] (-605.180) -- 0:00:52
      174000 -- (-601.637) [-604.018] (-601.590) (-602.073) * [-608.746] (-601.088) (-601.832) (-603.254) -- 0:00:52
      174500 -- (-601.914) [-603.106] (-605.111) (-603.218) * [-604.851] (-601.523) (-601.858) (-604.034) -- 0:00:52
      175000 -- (-602.101) (-606.076) [-601.719] (-603.350) * (-606.485) (-603.920) (-603.723) [-604.913] -- 0:00:51

      Average standard deviation of split frequencies: 0.014330

      175500 -- (-602.400) (-603.423) [-601.956] (-601.714) * (-602.249) (-601.010) (-601.734) [-606.250] -- 0:00:51
      176000 -- [-602.502] (-604.857) (-606.385) (-605.954) * (-603.297) (-602.105) (-601.478) [-602.404] -- 0:00:51
      176500 -- (-604.926) (-601.039) (-605.630) [-602.834] * (-603.017) (-610.773) [-601.960] (-607.380) -- 0:00:51
      177000 -- [-603.701] (-600.877) (-604.038) (-603.032) * (-602.806) (-605.860) [-606.573] (-602.495) -- 0:00:51
      177500 -- (-601.847) (-606.161) (-601.193) [-602.155] * (-607.112) [-603.245] (-603.363) (-602.641) -- 0:00:50
      178000 -- (-601.767) [-602.914] (-604.938) (-602.364) * (-603.604) (-602.413) [-606.652] (-602.381) -- 0:00:50
      178500 -- (-600.988) (-602.597) [-602.413] (-604.713) * (-603.517) [-610.474] (-603.455) (-604.672) -- 0:00:50
      179000 -- (-601.015) (-601.614) (-602.223) [-605.242] * (-601.569) (-603.070) [-602.116] (-604.711) -- 0:00:50
      179500 -- (-603.051) [-602.129] (-603.458) (-602.884) * [-601.417] (-608.932) (-605.325) (-603.611) -- 0:00:50
      180000 -- (-607.125) [-603.428] (-603.217) (-601.025) * [-601.467] (-608.594) (-604.224) (-603.304) -- 0:00:50

      Average standard deviation of split frequencies: 0.014612

      180500 -- (-604.039) (-602.286) [-601.181] (-601.083) * (-601.775) (-601.928) (-603.252) [-603.220] -- 0:00:49
      181000 -- (-604.581) [-602.174] (-604.433) (-609.307) * (-606.622) [-602.651] (-604.546) (-602.836) -- 0:00:49
      181500 -- [-602.638] (-601.590) (-606.704) (-606.975) * (-602.621) [-603.651] (-603.370) (-605.945) -- 0:00:49
      182000 -- (-602.920) [-601.461] (-601.896) (-605.165) * [-601.391] (-607.321) (-602.574) (-604.292) -- 0:00:49
      182500 -- (-601.917) [-602.484] (-601.160) (-602.362) * [-604.356] (-602.068) (-602.381) (-602.914) -- 0:00:49
      183000 -- (-606.520) [-603.415] (-601.392) (-601.907) * (-605.498) [-603.243] (-603.179) (-602.262) -- 0:00:49
      183500 -- (-602.774) (-602.594) (-602.810) [-603.938] * (-607.173) [-601.200] (-604.352) (-602.141) -- 0:00:48
      184000 -- (-606.308) [-601.840] (-603.432) (-602.840) * (-603.336) [-601.508] (-604.569) (-602.837) -- 0:00:48
      184500 -- [-602.359] (-601.968) (-602.586) (-603.148) * [-604.411] (-603.859) (-602.610) (-602.495) -- 0:00:48
      185000 -- (-601.867) (-603.782) [-602.226] (-607.423) * (-603.031) (-608.164) [-604.555] (-602.335) -- 0:00:48

      Average standard deviation of split frequencies: 0.014700

      185500 -- (-602.260) (-603.771) [-604.794] (-603.950) * [-602.487] (-604.958) (-604.015) (-601.227) -- 0:00:48
      186000 -- (-602.337) [-605.401] (-603.386) (-604.032) * (-601.201) (-603.170) (-603.115) [-601.136] -- 0:00:48
      186500 -- [-601.626] (-603.734) (-603.515) (-606.416) * (-602.110) (-603.891) (-601.868) [-603.838] -- 0:00:47
      187000 -- (-601.487) (-604.731) [-602.765] (-605.440) * (-602.969) (-601.825) [-604.362] (-602.251) -- 0:00:47
      187500 -- (-602.334) (-604.478) [-603.261] (-603.492) * (-603.799) (-602.280) [-601.499] (-602.896) -- 0:00:47
      188000 -- [-602.152] (-602.698) (-601.591) (-603.492) * [-602.669] (-608.501) (-603.447) (-601.682) -- 0:00:47
      188500 -- (-604.411) (-601.571) (-602.915) [-604.184] * (-604.683) (-603.436) [-603.747] (-601.310) -- 0:00:47
      189000 -- (-600.880) (-601.363) [-603.989] (-604.460) * (-606.568) (-603.410) [-604.226] (-601.043) -- 0:00:47
      189500 -- (-605.136) (-601.435) (-602.162) [-602.598] * (-604.759) [-602.751] (-602.722) (-603.403) -- 0:00:51
      190000 -- [-602.780] (-604.581) (-602.189) (-602.900) * (-603.348) (-602.205) [-603.282] (-603.593) -- 0:00:51

      Average standard deviation of split frequencies: 0.015947

      190500 -- (-603.201) [-601.753] (-600.935) (-603.944) * [-606.152] (-604.889) (-602.784) (-605.458) -- 0:00:50
      191000 -- [-602.519] (-603.103) (-604.897) (-601.624) * (-602.234) (-607.329) [-601.786] (-603.933) -- 0:00:50
      191500 -- (-604.610) (-603.089) [-601.720] (-601.868) * (-604.759) (-600.805) (-602.449) [-606.396] -- 0:00:50
      192000 -- (-606.567) (-605.236) [-603.610] (-605.001) * (-602.280) (-603.187) (-605.772) [-603.652] -- 0:00:50
      192500 -- (-604.487) [-605.206] (-603.608) (-605.798) * (-602.484) (-603.883) [-602.660] (-603.009) -- 0:00:50
      193000 -- (-601.538) (-605.304) [-604.457] (-605.073) * [-600.849] (-602.983) (-612.245) (-601.940) -- 0:00:50
      193500 -- (-602.370) [-602.754] (-603.021) (-601.888) * [-601.017] (-603.621) (-605.065) (-605.517) -- 0:00:50
      194000 -- (-601.723) (-601.124) [-602.530] (-607.288) * (-604.758) (-602.897) [-602.394] (-603.352) -- 0:00:49
      194500 -- [-602.220] (-601.754) (-603.054) (-601.945) * (-603.338) (-601.305) (-605.598) [-605.301] -- 0:00:49
      195000 -- (-604.115) (-602.553) [-603.354] (-603.881) * [-602.390] (-602.070) (-607.065) (-604.019) -- 0:00:49

      Average standard deviation of split frequencies: 0.016456

      195500 -- (-603.880) (-604.113) (-605.724) [-602.798] * [-602.063] (-602.275) (-602.490) (-603.376) -- 0:00:49
      196000 -- (-607.248) (-602.607) (-604.946) [-603.480] * (-602.347) (-605.101) [-605.150] (-601.640) -- 0:00:49
      196500 -- [-602.136] (-601.132) (-603.931) (-604.851) * (-603.630) [-603.081] (-604.406) (-602.237) -- 0:00:49
      197000 -- (-601.633) [-602.684] (-604.504) (-602.615) * [-606.931] (-602.567) (-605.750) (-602.589) -- 0:00:48
      197500 -- (-602.328) (-602.476) [-606.267] (-601.353) * (-607.958) (-601.073) (-602.332) [-601.395] -- 0:00:48
      198000 -- (-602.465) [-601.356] (-606.115) (-604.017) * (-607.739) (-601.814) [-602.191] (-601.728) -- 0:00:48
      198500 -- (-603.435) (-603.533) (-606.694) [-603.574] * [-603.417] (-604.972) (-602.851) (-602.319) -- 0:00:48
      199000 -- (-604.983) (-602.866) (-602.905) [-604.913] * (-604.030) (-602.714) [-602.799] (-602.041) -- 0:00:48
      199500 -- (-602.085) (-605.841) [-603.960] (-604.852) * (-602.378) (-605.363) [-602.136] (-601.228) -- 0:00:48
      200000 -- [-602.931] (-602.520) (-603.073) (-602.597) * (-604.385) (-602.389) [-604.540] (-603.043) -- 0:00:48

      Average standard deviation of split frequencies: 0.014342

      200500 -- (-601.520) [-603.689] (-604.834) (-601.662) * [-602.234] (-605.469) (-608.606) (-604.403) -- 0:00:47
      201000 -- (-601.748) (-602.018) (-600.830) [-602.264] * (-603.172) (-602.896) (-603.128) [-603.213] -- 0:00:47
      201500 -- (-606.645) (-604.017) [-603.383] (-606.197) * (-603.934) (-603.471) [-602.815] (-604.542) -- 0:00:47
      202000 -- (-606.833) (-602.394) (-607.644) [-601.778] * (-603.386) (-602.962) (-602.642) [-602.038] -- 0:00:47
      202500 -- (-607.274) (-603.418) [-602.449] (-603.599) * (-602.389) [-605.403] (-603.892) (-602.414) -- 0:00:51
      203000 -- (-602.297) [-602.333] (-605.828) (-602.212) * (-604.899) (-609.878) (-604.423) [-601.033] -- 0:00:51
      203500 -- (-602.637) (-603.344) (-603.040) [-602.966] * (-609.748) (-602.451) [-604.659] (-604.899) -- 0:00:50
      204000 -- (-603.244) [-604.108] (-601.027) (-601.377) * (-604.124) (-603.436) [-601.380] (-602.911) -- 0:00:50
      204500 -- (-601.908) (-601.944) [-601.144] (-601.920) * (-608.754) [-601.936] (-603.040) (-602.988) -- 0:00:50
      205000 -- (-602.541) [-602.313] (-601.752) (-603.148) * (-607.459) (-601.640) [-602.013] (-601.172) -- 0:00:50

      Average standard deviation of split frequencies: 0.013008

      205500 -- [-605.950] (-601.105) (-601.215) (-601.503) * [-604.305] (-602.075) (-601.234) (-602.711) -- 0:00:50
      206000 -- (-602.861) (-614.882) [-601.931] (-601.942) * (-605.427) (-605.178) [-601.939] (-604.440) -- 0:00:50
      206500 -- (-606.483) [-603.005] (-604.455) (-603.567) * [-603.191] (-604.682) (-602.041) (-601.407) -- 0:00:49
      207000 -- [-604.954] (-604.731) (-603.369) (-607.688) * [-601.708] (-604.415) (-604.152) (-602.422) -- 0:00:49
      207500 -- (-606.136) (-603.133) (-601.221) [-606.438] * (-604.398) (-602.922) [-602.353] (-605.533) -- 0:00:49
      208000 -- (-603.732) [-602.447] (-602.003) (-605.118) * (-601.491) [-603.786] (-605.173) (-602.191) -- 0:00:49
      208500 -- (-604.188) [-602.215] (-601.021) (-602.840) * [-602.259] (-604.559) (-607.695) (-607.788) -- 0:00:49
      209000 -- [-603.415] (-606.881) (-601.925) (-601.334) * [-604.182] (-604.244) (-603.344) (-602.234) -- 0:00:49
      209500 -- (-606.777) (-602.490) [-604.589] (-602.326) * (-604.474) (-604.175) (-603.145) [-602.067] -- 0:00:49
      210000 -- [-602.349] (-602.099) (-602.493) (-601.298) * (-602.223) (-601.504) (-602.351) [-601.774] -- 0:00:48

      Average standard deviation of split frequencies: 0.012719

      210500 -- (-601.700) (-605.850) (-602.519) [-601.657] * (-601.975) (-602.262) (-608.186) [-602.009] -- 0:00:48
      211000 -- (-601.381) [-602.920] (-603.452) (-603.535) * [-604.102] (-603.389) (-603.359) (-601.702) -- 0:00:48
      211500 -- (-602.487) [-604.347] (-602.868) (-601.902) * (-603.658) [-604.195] (-602.875) (-603.973) -- 0:00:48
      212000 -- (-603.618) (-603.497) (-602.006) [-603.308] * (-601.253) (-608.979) (-607.635) [-606.113] -- 0:00:48
      212500 -- (-605.710) (-606.716) (-601.957) [-601.829] * [-603.086] (-604.719) (-603.532) (-608.858) -- 0:00:48
      213000 -- [-606.479] (-605.957) (-608.147) (-602.459) * (-608.030) (-602.941) [-604.854] (-605.275) -- 0:00:48
      213500 -- (-605.438) [-604.344] (-602.237) (-603.665) * (-601.554) [-601.571] (-602.669) (-602.788) -- 0:00:47
      214000 -- (-603.859) (-604.716) (-604.692) [-602.225] * (-602.405) (-603.540) [-602.257] (-605.436) -- 0:00:47
      214500 -- [-601.697] (-603.514) (-603.419) (-602.047) * (-604.898) (-603.887) (-601.933) [-603.177] -- 0:00:47
      215000 -- (-602.886) (-603.020) [-601.956] (-602.220) * (-601.791) (-604.019) (-602.434) [-601.877] -- 0:00:47

      Average standard deviation of split frequencies: 0.013899

      215500 -- (-602.062) (-606.207) (-601.225) [-603.116] * (-602.557) (-604.136) (-601.857) [-600.840] -- 0:00:47
      216000 -- [-601.968] (-603.107) (-604.171) (-605.557) * (-604.828) (-605.081) (-602.605) [-605.049] -- 0:00:47
      216500 -- (-603.450) (-602.752) (-613.484) [-600.793] * (-601.961) [-604.391] (-601.194) (-601.247) -- 0:00:47
      217000 -- (-608.139) [-601.094] (-602.879) (-603.634) * (-601.774) (-603.622) [-604.738] (-603.500) -- 0:00:46
      217500 -- (-607.354) [-601.153] (-603.789) (-602.125) * (-606.206) (-607.155) [-605.348] (-601.091) -- 0:00:46
      218000 -- (-603.236) (-601.498) (-600.984) [-606.493] * (-607.020) (-603.530) (-601.112) [-602.570] -- 0:00:46
      218500 -- [-604.633] (-601.703) (-602.838) (-602.453) * [-607.825] (-602.713) (-602.248) (-601.657) -- 0:00:50
      219000 -- (-606.971) (-604.837) (-602.732) [-602.318] * (-602.543) [-601.751] (-604.562) (-603.029) -- 0:00:49
      219500 -- (-601.860) [-604.306] (-601.624) (-604.017) * (-603.493) [-603.650] (-605.767) (-602.722) -- 0:00:49
      220000 -- [-601.722] (-604.027) (-603.188) (-606.342) * (-605.203) (-602.292) (-606.730) [-601.972] -- 0:00:49

      Average standard deviation of split frequencies: 0.014717

      220500 -- (-601.622) (-605.159) [-603.073] (-604.430) * (-603.369) (-605.001) [-605.018] (-603.060) -- 0:00:49
      221000 -- (-602.187) (-604.864) (-605.237) [-601.898] * (-604.643) [-608.757] (-603.285) (-602.350) -- 0:00:49
      221500 -- (-601.879) (-601.651) (-602.490) [-603.914] * (-604.260) (-606.983) [-604.206] (-603.598) -- 0:00:49
      222000 -- (-605.735) [-604.497] (-600.942) (-605.331) * [-602.723] (-606.446) (-605.631) (-604.946) -- 0:00:49
      222500 -- (-604.014) [-602.848] (-601.450) (-601.896) * (-602.893) (-603.596) (-603.099) [-602.164] -- 0:00:48
      223000 -- (-602.943) [-601.358] (-602.604) (-602.482) * (-602.910) (-604.267) (-603.970) [-602.899] -- 0:00:48
      223500 -- (-601.896) (-603.644) (-601.702) [-604.051] * (-607.281) [-602.898] (-602.339) (-603.983) -- 0:00:48
      224000 -- (-601.093) (-604.901) [-601.841] (-603.403) * (-605.005) (-602.903) (-602.254) [-605.067] -- 0:00:48
      224500 -- (-600.695) (-609.682) [-600.988] (-603.398) * (-606.104) (-602.732) (-600.813) [-604.167] -- 0:00:48
      225000 -- (-601.219) (-605.280) [-602.148] (-602.157) * (-602.825) [-601.807] (-600.885) (-603.462) -- 0:00:48

      Average standard deviation of split frequencies: 0.013767

      225500 -- (-600.809) (-603.085) [-604.058] (-602.308) * [-607.252] (-601.467) (-602.617) (-605.433) -- 0:00:48
      226000 -- [-602.086] (-602.904) (-602.720) (-601.669) * (-606.281) [-601.722] (-601.933) (-601.778) -- 0:00:47
      226500 -- [-600.884] (-602.083) (-600.718) (-602.159) * [-603.739] (-601.196) (-604.200) (-601.906) -- 0:00:47
      227000 -- (-603.533) (-602.921) (-606.294) [-604.358] * (-605.205) (-604.349) (-603.633) [-602.870] -- 0:00:47
      227500 -- (-604.402) [-603.813] (-605.117) (-600.929) * [-601.946] (-602.809) (-604.659) (-602.990) -- 0:00:47
      228000 -- (-605.759) (-601.245) [-604.202] (-604.456) * (-602.600) (-605.289) [-603.248] (-602.281) -- 0:00:47
      228500 -- (-604.178) [-601.224] (-606.483) (-601.223) * [-601.853] (-602.686) (-602.021) (-602.937) -- 0:00:47
      229000 -- (-604.165) (-604.638) [-602.538] (-601.269) * [-606.500] (-602.524) (-601.874) (-603.977) -- 0:00:47
      229500 -- (-601.529) (-604.375) (-602.658) [-605.151] * (-603.232) (-604.249) [-601.962] (-603.896) -- 0:00:47
      230000 -- (-603.000) (-606.247) (-603.689) [-601.787] * (-605.245) (-604.397) [-601.407] (-601.558) -- 0:00:46

      Average standard deviation of split frequencies: 0.014646

      230500 -- (-603.827) (-604.544) (-603.299) [-601.620] * (-601.528) (-604.442) (-602.025) [-601.491] -- 0:00:46
      231000 -- (-604.627) (-601.324) [-602.111] (-604.373) * [-603.216] (-601.167) (-604.046) (-601.499) -- 0:00:46
      231500 -- (-603.350) (-602.631) (-602.337) [-604.222] * [-602.402] (-603.227) (-603.455) (-601.534) -- 0:00:46
      232000 -- (-604.400) (-603.006) [-604.894] (-605.173) * (-603.003) [-601.416] (-607.109) (-602.264) -- 0:00:46
      232500 -- (-602.108) (-603.815) [-603.308] (-602.395) * [-603.294] (-601.177) (-601.184) (-602.770) -- 0:00:46
      233000 -- (-602.584) (-609.025) [-603.268] (-602.603) * (-602.872) (-601.395) (-605.065) [-604.644] -- 0:00:46
      233500 -- (-603.081) [-603.155] (-604.598) (-601.598) * (-603.822) (-602.335) [-601.777] (-605.638) -- 0:00:45
      234000 -- (-602.388) [-601.817] (-604.645) (-604.125) * (-607.349) (-603.669) (-604.331) [-602.981] -- 0:00:45
      234500 -- (-602.774) (-603.445) [-603.876] (-601.960) * (-601.759) (-604.395) (-603.281) [-601.880] -- 0:00:45
      235000 -- [-601.669] (-601.707) (-604.081) (-602.371) * (-601.247) (-601.749) (-602.497) [-602.045] -- 0:00:45

      Average standard deviation of split frequencies: 0.013141

      235500 -- (-604.661) (-603.016) [-604.176] (-603.710) * (-602.586) (-604.337) (-602.728) [-602.843] -- 0:00:48
      236000 -- [-608.243] (-600.986) (-605.291) (-602.745) * (-601.381) (-603.517) (-607.314) [-608.279] -- 0:00:48
      236500 -- (-601.444) (-601.148) (-602.581) [-602.357] * (-601.132) [-601.243] (-607.586) (-605.539) -- 0:00:48
      237000 -- (-603.955) [-602.357] (-604.506) (-602.142) * (-604.163) [-603.063] (-606.286) (-601.557) -- 0:00:48
      237500 -- (-601.858) (-603.522) [-603.417] (-601.688) * [-600.905] (-605.918) (-603.884) (-609.317) -- 0:00:48
      238000 -- (-603.670) [-604.285] (-606.464) (-602.141) * (-602.254) [-601.489] (-602.958) (-602.340) -- 0:00:48
      238500 -- (-604.018) [-602.371] (-604.975) (-604.627) * (-603.739) (-601.882) (-608.067) [-602.531] -- 0:00:47
      239000 -- (-602.140) (-604.041) (-604.576) [-601.672] * (-602.966) (-602.464) [-610.394] (-601.602) -- 0:00:47
      239500 -- [-602.147] (-603.385) (-603.255) (-602.046) * (-602.616) (-604.865) [-602.694] (-602.106) -- 0:00:47
      240000 -- [-603.241] (-602.949) (-602.618) (-605.342) * (-604.320) (-603.450) (-602.764) [-605.105] -- 0:00:47

      Average standard deviation of split frequencies: 0.012487

      240500 -- (-601.685) [-604.692] (-605.824) (-604.839) * (-602.474) (-602.398) (-604.271) [-602.380] -- 0:00:47
      241000 -- [-601.450] (-604.393) (-604.759) (-601.594) * [-605.254] (-602.480) (-602.443) (-602.731) -- 0:00:47
      241500 -- [-602.393] (-601.827) (-602.007) (-601.344) * [-602.178] (-605.313) (-601.868) (-601.623) -- 0:00:47
      242000 -- (-605.956) [-602.543] (-605.974) (-602.716) * (-601.019) (-602.294) (-602.200) [-605.772] -- 0:00:46
      242500 -- (-603.085) (-602.954) (-603.019) [-608.799] * (-603.925) (-605.504) (-602.536) [-604.218] -- 0:00:46
      243000 -- (-601.959) (-604.046) (-602.095) [-601.537] * (-602.407) [-604.520] (-601.761) (-606.113) -- 0:00:46
      243500 -- [-601.246] (-607.628) (-604.153) (-603.513) * (-603.285) (-605.283) [-606.366] (-601.960) -- 0:00:46
      244000 -- (-601.870) (-606.745) (-602.274) [-602.160] * (-604.034) (-602.069) (-601.959) [-603.327] -- 0:00:46
      244500 -- (-601.870) (-602.780) (-603.713) [-602.639] * (-607.049) [-603.591] (-601.870) (-601.595) -- 0:00:46
      245000 -- (-605.158) (-604.563) (-601.384) [-604.247] * [-601.858] (-602.551) (-603.635) (-602.300) -- 0:00:46

      Average standard deviation of split frequencies: 0.013989

      245500 -- (-604.417) [-605.079] (-603.642) (-601.965) * [-601.458] (-602.155) (-602.605) (-604.246) -- 0:00:46
      246000 -- (-603.983) [-604.221] (-604.664) (-605.824) * (-603.475) [-603.397] (-607.990) (-601.615) -- 0:00:45
      246500 -- (-605.525) (-601.955) [-602.254] (-606.300) * (-604.274) (-601.398) [-605.856] (-607.866) -- 0:00:45
      247000 -- (-603.333) (-604.665) [-605.052] (-603.248) * (-605.277) (-603.610) [-602.571] (-602.559) -- 0:00:45
      247500 -- (-605.409) (-601.581) [-601.767] (-604.779) * (-604.685) (-602.060) [-602.724] (-601.861) -- 0:00:45
      248000 -- (-604.788) [-601.948] (-604.710) (-602.802) * [-604.662] (-601.521) (-603.361) (-605.369) -- 0:00:45
      248500 -- [-604.977] (-605.511) (-602.742) (-601.871) * (-602.763) (-603.546) [-605.664] (-606.130) -- 0:00:45
      249000 -- (-601.388) (-603.740) [-602.820] (-605.443) * (-606.394) (-602.566) (-602.801) [-603.925] -- 0:00:45
      249500 -- (-601.740) [-604.574] (-602.428) (-605.893) * (-603.145) [-601.100] (-605.046) (-602.451) -- 0:00:45
      250000 -- (-602.681) (-607.161) (-606.218) [-602.420] * (-602.387) (-601.566) (-601.906) [-601.404] -- 0:00:45

      Average standard deviation of split frequencies: 0.013446

      250500 -- (-601.067) (-602.078) (-604.108) [-601.631] * (-604.756) (-601.598) [-601.779] (-604.054) -- 0:00:44
      251000 -- [-603.015] (-603.995) (-603.350) (-603.505) * (-604.184) [-604.069] (-601.407) (-602.067) -- 0:00:44
      251500 -- (-604.029) (-601.914) [-601.626] (-606.166) * (-604.940) (-601.053) (-603.463) [-604.184] -- 0:00:44
      252000 -- (-601.418) (-604.537) (-602.855) [-603.190] * [-602.752] (-600.875) (-601.649) (-602.327) -- 0:00:44
      252500 -- [-603.550] (-605.241) (-601.905) (-608.387) * (-601.978) [-600.732] (-601.880) (-604.067) -- 0:00:47
      253000 -- (-607.858) [-602.086] (-603.325) (-609.041) * (-605.316) (-600.887) (-607.313) [-603.030] -- 0:00:47
      253500 -- (-603.349) [-602.338] (-602.675) (-603.422) * (-602.492) (-601.977) [-608.634] (-604.818) -- 0:00:47
      254000 -- (-603.338) (-603.964) (-601.185) [-602.862] * [-602.373] (-601.644) (-601.163) (-602.811) -- 0:00:46
      254500 -- (-604.647) (-609.805) (-606.248) [-607.072] * (-601.388) [-604.603] (-601.751) (-601.937) -- 0:00:46
      255000 -- [-601.896] (-613.307) (-602.260) (-604.823) * (-604.243) [-602.939] (-601.520) (-602.427) -- 0:00:46

      Average standard deviation of split frequencies: 0.013166

      255500 -- (-603.505) (-602.236) (-602.768) [-605.663] * [-604.985] (-605.881) (-603.975) (-602.409) -- 0:00:46
      256000 -- [-603.284] (-602.331) (-602.219) (-601.600) * [-603.429] (-604.645) (-604.205) (-601.976) -- 0:00:46
      256500 -- (-602.534) (-605.052) [-602.524] (-601.390) * (-603.212) [-604.512] (-601.605) (-602.024) -- 0:00:46
      257000 -- (-601.093) (-604.080) (-602.905) [-601.124] * [-606.636] (-608.984) (-605.127) (-601.430) -- 0:00:46
      257500 -- (-601.323) (-603.953) (-604.780) [-602.418] * (-601.814) (-604.467) (-607.992) [-600.952] -- 0:00:46
      258000 -- (-603.682) (-601.338) [-601.977] (-603.903) * [-603.947] (-606.973) (-606.243) (-603.270) -- 0:00:46
      258500 -- (-605.257) [-603.424] (-603.050) (-602.933) * (-605.938) [-603.013] (-605.008) (-604.327) -- 0:00:45
      259000 -- [-603.937] (-604.258) (-613.629) (-602.048) * (-602.182) [-601.301] (-606.547) (-601.570) -- 0:00:45
      259500 -- (-602.872) (-603.806) (-608.040) [-604.349] * (-603.844) (-601.646) [-603.722] (-601.308) -- 0:00:45
      260000 -- [-602.705] (-605.937) (-603.636) (-606.288) * (-601.896) (-602.215) (-601.521) [-602.114] -- 0:00:45

      Average standard deviation of split frequencies: 0.015419

      260500 -- (-600.834) (-603.830) [-602.498] (-605.168) * (-604.379) [-605.511] (-601.187) (-606.275) -- 0:00:45
      261000 -- (-604.551) [-601.180] (-604.165) (-603.164) * (-603.160) (-604.053) [-602.543] (-603.274) -- 0:00:45
      261500 -- (-602.004) (-601.571) (-602.726) [-601.297] * (-601.680) (-605.771) (-602.452) [-602.063] -- 0:00:45
      262000 -- (-602.409) (-604.344) (-607.221) [-602.918] * (-604.619) (-605.903) [-603.950] (-601.876) -- 0:00:45
      262500 -- (-603.102) (-605.043) [-603.242] (-602.877) * (-607.025) (-602.460) [-602.462] (-602.179) -- 0:00:44
      263000 -- [-602.836] (-602.660) (-604.476) (-605.685) * (-601.048) (-609.540) (-606.124) [-601.287] -- 0:00:44
      263500 -- (-601.312) (-604.200) (-603.982) [-603.525] * (-602.652) [-601.157] (-602.471) (-604.911) -- 0:00:44
      264000 -- (-601.246) (-601.115) (-605.140) [-601.462] * (-601.675) [-602.853] (-602.430) (-602.610) -- 0:00:44
      264500 -- [-602.827] (-603.969) (-605.303) (-602.621) * [-601.027] (-601.963) (-602.571) (-603.791) -- 0:00:44
      265000 -- [-602.644] (-604.126) (-600.976) (-603.994) * (-601.203) (-603.561) [-601.763] (-605.718) -- 0:00:44

      Average standard deviation of split frequencies: 0.015670

      265500 -- (-603.587) (-601.454) (-604.040) [-601.690] * [-601.392] (-601.364) (-601.454) (-601.810) -- 0:00:44
      266000 -- (-605.542) [-602.122] (-601.996) (-608.241) * (-601.351) [-602.149] (-602.900) (-601.461) -- 0:00:44
      266500 -- (-605.294) [-601.265] (-607.026) (-603.644) * [-602.984] (-601.978) (-601.326) (-602.088) -- 0:00:44
      267000 -- (-600.788) (-601.953) [-607.577] (-606.262) * (-604.568) (-601.603) [-601.571] (-603.013) -- 0:00:43
      267500 -- [-601.287] (-603.889) (-604.421) (-604.183) * (-605.115) [-602.540] (-607.731) (-604.853) -- 0:00:43
      268000 -- (-606.037) (-605.462) (-605.299) [-604.255] * [-603.081] (-602.070) (-602.923) (-603.326) -- 0:00:43
      268500 -- (-606.011) (-606.603) [-603.239] (-603.425) * (-601.723) (-601.077) [-602.491] (-604.342) -- 0:00:43
      269000 -- (-603.988) [-606.324] (-602.167) (-606.470) * [-602.077] (-601.385) (-603.532) (-604.730) -- 0:00:43
      269500 -- (-602.291) [-602.453] (-602.928) (-602.855) * (-603.160) [-602.536] (-602.216) (-603.458) -- 0:00:46
      270000 -- (-603.749) [-602.746] (-602.247) (-604.724) * (-607.540) [-603.279] (-600.857) (-602.116) -- 0:00:45

      Average standard deviation of split frequencies: 0.015288

      270500 -- (-602.629) [-604.083] (-601.412) (-603.283) * [-602.884] (-601.046) (-601.119) (-609.747) -- 0:00:45
      271000 -- [-602.744] (-601.803) (-605.073) (-605.999) * (-601.808) (-601.162) (-605.935) [-605.970] -- 0:00:45
      271500 -- (-604.048) (-601.791) [-602.482] (-609.668) * (-601.435) (-602.355) (-606.680) [-605.253] -- 0:00:45
      272000 -- (-606.037) [-602.900] (-602.107) (-611.040) * (-602.844) (-602.397) [-601.371] (-605.122) -- 0:00:45
      272500 -- (-603.368) (-604.053) (-604.903) [-603.982] * (-604.190) [-602.458] (-602.567) (-608.896) -- 0:00:45
      273000 -- (-605.179) (-606.808) (-602.481) [-605.058] * (-606.852) (-607.477) (-604.677) [-602.572] -- 0:00:45
      273500 -- (-605.253) (-602.420) [-603.312] (-603.016) * (-601.429) (-604.948) [-603.759] (-604.043) -- 0:00:45
      274000 -- (-606.503) [-604.082] (-602.290) (-601.117) * (-601.884) [-604.858] (-601.925) (-603.135) -- 0:00:45
      274500 -- (-605.386) (-602.385) (-602.140) [-601.284] * [-603.771] (-603.706) (-603.083) (-602.148) -- 0:00:44
      275000 -- [-601.688] (-605.094) (-604.060) (-601.877) * (-603.037) (-604.040) [-604.745] (-603.648) -- 0:00:44

      Average standard deviation of split frequencies: 0.016036

      275500 -- [-601.707] (-602.721) (-602.830) (-601.549) * (-604.321) (-605.976) (-602.423) [-601.940] -- 0:00:44
      276000 -- [-604.151] (-602.447) (-605.250) (-601.071) * (-604.488) [-603.558] (-602.130) (-603.131) -- 0:00:44
      276500 -- (-601.239) [-601.580] (-602.915) (-602.844) * (-604.357) (-604.289) [-608.442] (-604.212) -- 0:00:44
      277000 -- (-604.611) [-603.515] (-603.585) (-604.902) * (-603.416) [-602.591] (-603.198) (-604.281) -- 0:00:44
      277500 -- [-601.167] (-603.536) (-602.957) (-603.804) * (-606.058) [-601.405] (-602.215) (-604.968) -- 0:00:44
      278000 -- [-603.163] (-602.935) (-606.864) (-607.114) * (-602.758) (-604.305) (-601.367) [-608.015] -- 0:00:44
      278500 -- [-603.292] (-604.873) (-603.187) (-603.564) * (-601.967) (-608.318) [-601.211] (-605.501) -- 0:00:44
      279000 -- (-603.733) (-601.400) [-605.797] (-601.613) * (-602.989) (-604.346) (-601.055) [-610.222] -- 0:00:43
      279500 -- [-604.666] (-605.432) (-604.666) (-601.437) * (-602.021) (-607.471) [-604.866] (-608.346) -- 0:00:43
      280000 -- [-605.457] (-603.938) (-604.133) (-601.457) * (-602.531) [-604.360] (-601.470) (-608.792) -- 0:00:43

      Average standard deviation of split frequencies: 0.015769

      280500 -- [-603.548] (-603.904) (-602.976) (-602.895) * (-603.340) [-601.353] (-603.209) (-609.278) -- 0:00:43
      281000 -- [-603.156] (-603.038) (-605.426) (-602.439) * (-603.507) [-601.738] (-604.868) (-609.021) -- 0:00:43
      281500 -- (-604.027) (-601.502) (-602.891) [-602.327] * (-602.223) (-602.572) (-602.390) [-603.770] -- 0:00:43
      282000 -- [-606.247] (-603.583) (-602.706) (-601.025) * (-603.272) (-606.667) (-602.323) [-602.330] -- 0:00:43
      282500 -- [-602.302] (-603.436) (-602.083) (-603.931) * (-602.127) [-603.960] (-601.984) (-602.090) -- 0:00:43
      283000 -- (-601.989) [-601.768] (-601.557) (-605.994) * (-602.373) [-605.113] (-604.524) (-602.323) -- 0:00:43
      283500 -- [-602.523] (-605.147) (-601.683) (-601.411) * (-608.587) (-606.259) (-609.331) [-603.913] -- 0:00:42
      284000 -- (-602.446) (-601.492) [-602.556] (-603.044) * (-606.792) (-602.099) (-607.758) [-601.075] -- 0:00:42
      284500 -- [-602.544] (-603.629) (-603.561) (-603.701) * [-604.374] (-603.954) (-603.038) (-601.905) -- 0:00:42
      285000 -- [-601.534] (-603.790) (-601.999) (-601.540) * (-606.715) (-602.741) (-603.874) [-603.533] -- 0:00:42

      Average standard deviation of split frequencies: 0.016222

      285500 -- [-602.253] (-603.248) (-601.225) (-601.627) * (-604.057) [-603.268] (-605.392) (-602.629) -- 0:00:42
      286000 -- [-601.207] (-602.233) (-603.410) (-604.007) * (-603.223) [-601.746] (-603.246) (-603.518) -- 0:00:42
      286500 -- (-602.715) (-603.137) [-602.692] (-604.196) * (-603.236) (-603.054) [-602.569] (-603.498) -- 0:00:44
      287000 -- (-602.248) [-601.544] (-601.837) (-601.905) * (-602.958) (-602.197) [-603.983] (-607.389) -- 0:00:44
      287500 -- (-601.437) [-601.751] (-606.825) (-605.296) * [-602.588] (-608.011) (-602.016) (-604.303) -- 0:00:44
      288000 -- (-602.538) [-601.313] (-602.698) (-602.876) * (-601.951) (-601.759) [-603.338] (-601.448) -- 0:00:44
      288500 -- (-604.376) [-600.926] (-601.838) (-602.975) * (-600.830) [-602.169] (-601.816) (-603.116) -- 0:00:44
      289000 -- (-605.303) (-601.018) [-602.514] (-601.614) * (-603.396) (-604.373) (-603.250) [-603.044] -- 0:00:44
      289500 -- (-605.545) (-601.340) [-604.880] (-603.428) * [-603.696] (-605.986) (-604.568) (-602.643) -- 0:00:44
      290000 -- [-603.568] (-602.057) (-603.566) (-605.547) * [-603.283] (-607.270) (-603.918) (-605.527) -- 0:00:44

      Average standard deviation of split frequencies: 0.016559

      290500 -- [-603.251] (-602.870) (-605.013) (-604.667) * (-602.214) (-606.550) [-603.044] (-608.085) -- 0:00:43
      291000 -- (-606.617) (-602.655) (-606.508) [-604.062] * (-603.119) [-601.719] (-600.774) (-607.045) -- 0:00:43
      291500 -- (-604.957) (-601.579) [-604.119] (-602.005) * (-601.439) (-602.256) [-602.769] (-603.214) -- 0:00:43
      292000 -- (-603.378) [-603.131] (-604.832) (-601.648) * (-603.936) (-603.871) [-603.275] (-602.689) -- 0:00:43
      292500 -- (-602.805) (-605.812) [-606.910] (-601.655) * (-601.684) (-601.480) [-606.993] (-605.051) -- 0:00:43
      293000 -- (-604.381) (-605.992) (-603.237) [-601.579] * (-602.930) (-602.117) (-602.922) [-602.749] -- 0:00:43
      293500 -- (-601.407) [-602.498] (-601.036) (-602.462) * (-603.446) [-602.093] (-603.775) (-601.926) -- 0:00:43
      294000 -- [-604.050] (-602.318) (-602.102) (-605.583) * [-602.650] (-601.637) (-605.440) (-603.935) -- 0:00:43
      294500 -- (-604.085) (-603.746) (-604.616) [-603.642] * (-601.951) (-601.933) (-604.039) [-604.509] -- 0:00:43
      295000 -- (-608.226) (-603.117) (-604.254) [-602.863] * (-605.267) (-602.968) [-602.541] (-603.381) -- 0:00:43

      Average standard deviation of split frequencies: 0.017015

      295500 -- [-603.786] (-602.548) (-605.065) (-601.696) * [-603.008] (-602.916) (-602.062) (-603.489) -- 0:00:42
      296000 -- (-602.806) (-603.329) [-602.710] (-603.424) * (-604.363) [-601.985] (-603.686) (-606.858) -- 0:00:42
      296500 -- (-607.618) (-605.250) (-604.226) [-601.744] * (-603.866) (-601.126) [-602.801] (-605.625) -- 0:00:42
      297000 -- (-602.667) (-602.478) (-606.217) [-604.238] * (-603.434) [-602.780] (-601.838) (-605.307) -- 0:00:42
      297500 -- (-604.931) [-603.185] (-601.601) (-604.614) * (-601.392) [-605.298] (-602.776) (-603.741) -- 0:00:42
      298000 -- (-603.935) (-603.974) [-602.335] (-604.789) * (-604.113) (-602.244) [-601.304] (-602.587) -- 0:00:42
      298500 -- (-604.486) (-604.042) (-601.060) [-604.132] * (-605.369) (-602.560) (-601.509) [-603.875] -- 0:00:42
      299000 -- (-601.840) [-602.466] (-601.466) (-603.272) * (-603.589) [-605.706] (-607.351) (-601.049) -- 0:00:42
      299500 -- (-603.141) (-602.554) [-602.119] (-602.130) * (-602.652) (-607.354) (-605.662) [-601.155] -- 0:00:42
      300000 -- (-604.161) (-602.722) [-601.439] (-605.644) * (-604.051) (-601.383) [-602.960] (-603.873) -- 0:00:42

      Average standard deviation of split frequencies: 0.018538

      300500 -- (-603.276) [-602.547] (-601.415) (-601.660) * (-607.300) (-602.212) [-602.028] (-603.232) -- 0:00:41
      301000 -- (-601.807) (-601.566) [-602.144] (-603.693) * (-602.988) [-604.403] (-603.191) (-605.673) -- 0:00:41
      301500 -- [-601.332] (-606.568) (-604.760) (-602.162) * (-603.644) (-601.368) (-602.565) [-602.213] -- 0:00:41
      302000 -- (-601.541) (-602.816) (-601.539) [-602.006] * (-602.766) (-602.731) [-603.540] (-605.580) -- 0:00:41
      302500 -- (-607.026) (-601.459) [-601.352] (-613.636) * (-602.622) (-602.765) (-603.673) [-603.802] -- 0:00:41
      303000 -- (-604.225) (-604.601) (-602.512) [-602.784] * (-603.291) [-601.412] (-608.732) (-603.613) -- 0:00:41
      303500 -- (-603.445) (-602.810) (-602.692) [-604.638] * (-604.464) (-601.492) (-601.515) [-601.145] -- 0:00:43
      304000 -- [-603.908] (-602.066) (-603.001) (-603.956) * [-601.508] (-604.862) (-603.839) (-604.974) -- 0:00:43
      304500 -- [-602.718] (-603.451) (-608.153) (-602.728) * (-603.866) (-601.523) (-601.154) [-602.584] -- 0:00:43
      305000 -- (-604.314) (-603.253) [-603.387] (-603.786) * (-605.122) (-605.532) [-602.773] (-602.418) -- 0:00:43

      Average standard deviation of split frequencies: 0.018396

      305500 -- [-605.021] (-602.530) (-602.228) (-601.286) * (-605.690) (-604.974) (-602.946) [-603.154] -- 0:00:43
      306000 -- (-605.703) (-601.827) [-602.523] (-605.001) * (-606.950) [-605.446] (-606.393) (-602.796) -- 0:00:43
      306500 -- [-604.593] (-605.384) (-602.775) (-605.689) * (-604.161) [-601.561] (-604.007) (-603.062) -- 0:00:42
      307000 -- (-602.548) (-602.054) (-603.971) [-603.092] * [-601.538] (-603.151) (-600.686) (-601.782) -- 0:00:42
      307500 -- (-608.565) [-601.929] (-604.974) (-602.793) * (-601.151) [-603.284] (-602.305) (-600.953) -- 0:00:42
      308000 -- [-604.100] (-603.729) (-606.421) (-606.612) * [-602.849] (-607.383) (-601.894) (-607.535) -- 0:00:42
      308500 -- (-602.480) [-603.500] (-605.036) (-605.969) * [-603.401] (-608.238) (-601.457) (-606.054) -- 0:00:42
      309000 -- [-604.721] (-602.725) (-602.787) (-600.846) * (-604.799) [-603.362] (-601.447) (-603.500) -- 0:00:42
      309500 -- [-602.690] (-605.185) (-601.958) (-603.597) * (-604.251) (-603.312) (-602.756) [-602.468] -- 0:00:42
      310000 -- (-603.380) [-602.615] (-602.357) (-601.419) * (-603.581) (-602.510) (-604.046) [-602.411] -- 0:00:42

      Average standard deviation of split frequencies: 0.017787

      310500 -- [-602.847] (-601.182) (-601.901) (-605.301) * (-602.655) [-602.775] (-602.566) (-604.025) -- 0:00:42
      311000 -- (-603.489) (-600.941) (-602.429) [-601.960] * (-603.113) (-603.292) (-605.384) [-606.174] -- 0:00:42
      311500 -- (-602.191) [-601.894] (-604.551) (-602.268) * [-604.746] (-603.909) (-603.534) (-603.507) -- 0:00:41
      312000 -- [-605.651] (-604.764) (-606.351) (-603.404) * (-604.486) (-601.846) [-601.533] (-604.488) -- 0:00:41
      312500 -- (-601.240) (-603.886) (-600.909) [-602.814] * (-603.400) (-601.979) [-602.486] (-603.503) -- 0:00:41
      313000 -- [-602.579] (-602.798) (-601.586) (-602.707) * [-603.154] (-604.806) (-601.640) (-602.548) -- 0:00:41
      313500 -- [-602.852] (-602.643) (-601.592) (-602.323) * (-601.110) (-601.930) [-602.391] (-604.027) -- 0:00:41
      314000 -- (-602.664) [-605.403] (-602.795) (-601.077) * (-602.093) (-602.094) [-602.535] (-603.144) -- 0:00:41
      314500 -- [-607.735] (-602.582) (-603.810) (-604.120) * [-605.466] (-603.227) (-604.124) (-601.516) -- 0:00:41
      315000 -- (-602.934) (-602.129) [-602.027] (-605.307) * (-603.202) (-602.931) [-601.843] (-604.709) -- 0:00:41

      Average standard deviation of split frequencies: 0.019218

      315500 -- [-603.920] (-601.257) (-601.958) (-604.375) * (-603.839) (-604.324) (-603.689) [-603.781] -- 0:00:41
      316000 -- (-603.283) (-605.240) (-602.910) [-603.906] * (-602.633) [-601.706] (-601.719) (-604.093) -- 0:00:41
      316500 -- [-606.900] (-603.342) (-602.321) (-607.027) * (-602.036) [-602.153] (-603.720) (-602.178) -- 0:00:41
      317000 -- (-604.384) (-607.385) [-602.673] (-603.518) * (-602.745) (-604.259) (-605.265) [-601.815] -- 0:00:40
      317500 -- (-601.376) [-605.533] (-604.506) (-601.529) * (-603.879) (-603.156) (-601.743) [-603.564] -- 0:00:40
      318000 -- [-607.257] (-606.273) (-602.393) (-604.914) * (-604.911) [-602.737] (-603.456) (-602.186) -- 0:00:40
      318500 -- (-602.103) [-602.617] (-602.714) (-607.330) * (-601.794) (-604.547) (-604.738) [-603.508] -- 0:00:40
      319000 -- [-605.732] (-601.661) (-601.964) (-601.266) * (-600.983) (-604.310) (-608.250) [-602.046] -- 0:00:40
      319500 -- (-602.526) (-603.262) (-605.837) [-601.103] * [-606.309] (-602.607) (-603.640) (-601.016) -- 0:00:40
      320000 -- (-601.434) (-601.891) (-602.111) [-601.631] * [-601.945] (-602.363) (-603.801) (-602.157) -- 0:00:40

      Average standard deviation of split frequencies: 0.019025

      320500 -- (-602.491) (-610.284) (-602.848) [-604.165] * [-602.214] (-604.397) (-602.828) (-604.493) -- 0:00:42
      321000 -- (-602.592) (-601.461) (-601.742) [-602.800] * (-604.961) (-601.961) (-602.129) [-602.412] -- 0:00:42
      321500 -- (-605.495) (-603.180) (-603.257) [-608.028] * (-606.262) (-602.658) (-605.208) [-605.948] -- 0:00:42
      322000 -- [-606.066] (-601.809) (-605.009) (-601.910) * (-605.824) [-604.429] (-604.608) (-606.174) -- 0:00:42
      322500 -- (-601.373) [-601.220] (-605.152) (-602.119) * (-601.913) (-601.915) [-602.655] (-603.653) -- 0:00:42
      323000 -- (-601.436) (-602.056) (-608.944) [-603.636] * [-603.049] (-604.769) (-607.857) (-606.849) -- 0:00:41
      323500 -- [-602.396] (-605.350) (-605.865) (-602.727) * [-603.166] (-604.586) (-605.031) (-602.277) -- 0:00:41
      324000 -- (-602.227) (-601.520) [-603.406] (-603.675) * (-603.877) [-603.090] (-602.002) (-602.583) -- 0:00:41
      324500 -- (-602.808) (-602.693) [-602.565] (-602.650) * (-601.677) (-600.948) (-602.161) [-607.346] -- 0:00:41
      325000 -- [-602.509] (-602.165) (-601.498) (-603.373) * [-603.988] (-602.746) (-602.514) (-606.769) -- 0:00:41

      Average standard deviation of split frequencies: 0.019361

      325500 -- (-605.179) [-601.966] (-602.435) (-602.858) * (-602.432) [-602.691] (-603.334) (-606.149) -- 0:00:41
      326000 -- (-602.043) (-601.619) (-604.767) [-602.786] * (-605.944) (-602.787) [-601.065] (-602.945) -- 0:00:41
      326500 -- [-601.583] (-602.575) (-603.475) (-600.815) * (-603.569) [-602.401] (-602.433) (-603.019) -- 0:00:41
      327000 -- (-608.292) [-605.125] (-602.793) (-602.681) * [-604.322] (-605.011) (-603.047) (-602.879) -- 0:00:41
      327500 -- (-606.669) [-607.058] (-603.777) (-603.311) * (-602.004) [-604.630] (-601.825) (-602.112) -- 0:00:41
      328000 -- [-607.112] (-605.268) (-604.150) (-604.271) * (-605.240) (-602.838) [-605.244] (-604.326) -- 0:00:40
      328500 -- (-605.483) (-602.816) (-603.040) [-602.528] * (-602.019) (-601.010) (-605.558) [-601.533] -- 0:00:40
      329000 -- (-608.444) (-602.620) [-601.577] (-604.148) * [-606.290] (-600.900) (-602.176) (-605.670) -- 0:00:40
      329500 -- [-601.708] (-603.910) (-601.573) (-603.432) * [-601.927] (-601.989) (-601.500) (-604.801) -- 0:00:40
      330000 -- (-605.132) [-601.506] (-603.439) (-603.019) * [-603.720] (-602.455) (-602.011) (-603.408) -- 0:00:40

      Average standard deviation of split frequencies: 0.018454

      330500 -- (-602.989) [-603.043] (-602.225) (-601.800) * (-604.408) [-603.948] (-603.039) (-602.554) -- 0:00:40
      331000 -- [-603.361] (-602.793) (-602.789) (-604.278) * [-602.056] (-602.749) (-604.296) (-601.721) -- 0:00:40
      331500 -- (-601.370) (-603.865) (-601.322) [-602.767] * [-604.529] (-605.463) (-602.127) (-603.893) -- 0:00:40
      332000 -- (-603.090) [-602.851] (-602.583) (-601.960) * (-606.481) (-605.205) (-602.832) [-607.928] -- 0:00:40
      332500 -- [-602.092] (-603.141) (-602.478) (-608.826) * (-604.080) [-603.668] (-606.810) (-604.448) -- 0:00:40
      333000 -- [-603.909] (-602.576) (-602.817) (-602.241) * (-604.824) (-601.642) (-604.692) [-604.359] -- 0:00:40
      333500 -- (-608.035) [-602.155] (-603.234) (-601.619) * (-601.038) (-608.312) (-603.360) [-601.676] -- 0:00:39
      334000 -- (-604.846) [-601.366] (-604.340) (-602.857) * (-604.946) (-603.416) (-601.259) [-603.690] -- 0:00:39
      334500 -- (-602.706) (-607.278) [-602.963] (-603.040) * (-602.286) (-612.936) (-601.988) [-601.741] -- 0:00:39
      335000 -- [-603.049] (-605.920) (-602.912) (-602.536) * (-605.373) (-608.504) (-602.540) [-601.122] -- 0:00:39

      Average standard deviation of split frequencies: 0.018005

      335500 -- (-603.610) (-603.934) (-601.128) [-603.638] * (-603.019) (-609.232) [-601.674] (-602.320) -- 0:00:39
      336000 -- (-602.327) (-604.163) [-601.427] (-601.176) * (-603.349) (-601.270) (-602.951) [-601.773] -- 0:00:39
      336500 -- (-603.438) [-604.182] (-602.209) (-601.177) * (-601.341) (-603.391) [-604.174] (-602.965) -- 0:00:39
      337000 -- [-602.955] (-602.326) (-602.520) (-605.415) * (-601.341) [-604.053] (-604.545) (-601.890) -- 0:00:39
      337500 -- (-603.917) (-603.610) (-604.662) [-605.299] * [-602.155] (-602.401) (-602.626) (-601.579) -- 0:00:41
      338000 -- (-603.185) (-602.424) (-601.565) [-603.488] * [-601.155] (-602.547) (-606.629) (-602.986) -- 0:00:41
      338500 -- (-602.084) (-602.738) [-603.041] (-602.649) * (-601.432) (-604.319) [-606.453] (-603.982) -- 0:00:41
      339000 -- (-601.997) (-601.268) [-603.139] (-601.575) * (-603.565) (-605.509) [-601.005] (-601.338) -- 0:00:40
      339500 -- (-605.987) [-606.140] (-602.646) (-602.963) * [-603.327] (-602.579) (-601.503) (-602.941) -- 0:00:40
      340000 -- (-612.288) (-601.973) (-603.938) [-602.404] * (-602.892) (-602.286) [-601.418] (-601.588) -- 0:00:40

      Average standard deviation of split frequencies: 0.018233

      340500 -- (-605.886) (-605.757) (-602.626) [-602.772] * (-606.059) [-601.150] (-601.497) (-604.367) -- 0:00:40
      341000 -- (-603.436) (-600.970) (-604.409) [-603.891] * (-602.800) (-602.422) [-603.779] (-602.253) -- 0:00:40
      341500 -- [-601.412] (-601.766) (-605.049) (-605.358) * (-600.923) [-603.463] (-606.214) (-602.942) -- 0:00:40
      342000 -- (-602.189) [-602.059] (-604.620) (-601.271) * (-612.579) [-605.159] (-601.459) (-603.712) -- 0:00:40
      342500 -- (-602.992) (-606.410) [-601.925] (-601.503) * (-605.364) (-607.733) [-605.533] (-601.608) -- 0:00:40
      343000 -- (-605.375) [-602.026] (-603.710) (-601.373) * (-601.790) (-606.759) [-602.297] (-603.966) -- 0:00:40
      343500 -- (-602.931) [-609.195] (-604.134) (-602.538) * (-601.171) [-604.603] (-602.749) (-601.962) -- 0:00:40
      344000 -- (-603.309) (-603.572) (-603.706) [-603.574] * (-603.935) [-602.391] (-602.145) (-605.419) -- 0:00:40
      344500 -- (-601.688) (-604.900) (-604.517) [-601.202] * (-603.570) (-602.522) [-602.718] (-603.059) -- 0:00:39
      345000 -- (-602.475) (-602.082) (-605.845) [-602.127] * (-601.543) [-604.874] (-602.385) (-602.032) -- 0:00:39

      Average standard deviation of split frequencies: 0.017863

      345500 -- [-604.133] (-603.333) (-606.725) (-603.412) * (-603.222) (-604.364) (-604.461) [-601.400] -- 0:00:39
      346000 -- (-604.008) (-602.901) (-606.407) [-601.269] * (-604.946) (-604.914) [-600.838] (-606.070) -- 0:00:39
      346500 -- (-603.923) [-603.333] (-605.644) (-607.217) * [-603.011] (-601.787) (-607.525) (-602.778) -- 0:00:39
      347000 -- (-603.597) (-601.905) [-602.512] (-603.433) * [-603.165] (-602.198) (-606.311) (-603.573) -- 0:00:39
      347500 -- [-602.816] (-601.519) (-601.533) (-603.168) * [-604.613] (-602.786) (-605.158) (-605.024) -- 0:00:39
      348000 -- (-603.313) (-601.277) (-604.111) [-605.981] * (-605.511) [-602.704] (-605.536) (-602.097) -- 0:00:39
      348500 -- (-605.723) [-603.006] (-602.223) (-605.066) * (-605.270) (-602.567) (-602.271) [-603.308] -- 0:00:39
      349000 -- (-604.095) [-607.806] (-601.601) (-604.700) * (-607.535) (-601.980) [-604.254] (-600.796) -- 0:00:39
      349500 -- (-603.694) (-603.470) (-603.064) [-601.752] * (-602.604) (-606.251) (-603.221) [-601.241] -- 0:00:39
      350000 -- (-601.885) (-603.859) (-602.743) [-602.951] * (-604.015) (-604.020) [-605.168] (-602.742) -- 0:00:39

      Average standard deviation of split frequencies: 0.018267

      350500 -- (-602.142) [-602.072] (-603.896) (-601.614) * (-603.195) (-603.409) (-606.115) [-601.619] -- 0:00:38
      351000 -- (-603.535) [-603.665] (-608.195) (-604.489) * (-603.994) (-602.213) (-605.192) [-602.265] -- 0:00:38
      351500 -- (-605.324) (-602.613) (-602.770) [-603.557] * (-610.817) (-602.392) (-602.650) [-601.546] -- 0:00:38
      352000 -- (-604.870) [-604.626] (-601.849) (-607.276) * [-604.168] (-603.338) (-601.943) (-603.372) -- 0:00:38
      352500 -- (-602.753) (-601.573) (-601.348) [-602.024] * (-604.692) (-603.583) (-602.127) [-605.203] -- 0:00:38
      353000 -- (-603.811) (-603.346) (-601.522) [-603.831] * [-603.971] (-603.307) (-602.750) (-606.319) -- 0:00:38
      353500 -- (-602.833) [-603.942] (-601.987) (-604.612) * [-602.224] (-606.267) (-603.698) (-607.233) -- 0:00:38
      354000 -- (-604.550) (-603.966) [-603.551] (-601.573) * (-603.449) (-604.235) [-603.738] (-602.755) -- 0:00:38
      354500 -- (-602.213) (-605.067) [-606.449] (-601.263) * (-604.478) (-608.020) (-601.828) [-602.736] -- 0:00:40
      355000 -- [-603.951] (-602.710) (-608.155) (-603.590) * [-602.585] (-604.176) (-602.742) (-605.808) -- 0:00:39

      Average standard deviation of split frequencies: 0.016825

      355500 -- (-605.438) [-603.038] (-602.336) (-602.005) * (-601.106) (-607.460) [-601.041] (-614.239) -- 0:00:39
      356000 -- (-604.306) [-602.505] (-602.703) (-602.061) * [-600.885] (-602.194) (-607.072) (-615.762) -- 0:00:39
      356500 -- (-602.881) (-604.462) (-601.917) [-601.632] * (-600.797) (-602.286) [-607.412] (-609.992) -- 0:00:39
      357000 -- (-606.399) [-601.393] (-602.608) (-603.129) * (-606.430) (-602.064) (-602.792) [-602.700] -- 0:00:39
      357500 -- (-604.263) (-603.589) [-602.112] (-602.270) * [-605.298] (-603.518) (-605.144) (-603.187) -- 0:00:39
      358000 -- [-601.008] (-605.504) (-601.758) (-602.824) * (-606.829) (-606.228) [-601.621] (-603.123) -- 0:00:39
      358500 -- [-602.237] (-606.050) (-604.747) (-606.347) * [-605.322] (-602.908) (-601.946) (-602.151) -- 0:00:39
      359000 -- (-604.286) (-607.642) [-601.026] (-604.881) * [-604.456] (-601.540) (-602.641) (-604.804) -- 0:00:39
      359500 -- (-603.849) (-601.909) (-606.473) [-606.791] * (-602.127) (-604.751) (-601.823) [-605.990] -- 0:00:39
      360000 -- (-602.683) (-604.613) [-602.363] (-608.786) * (-606.620) [-601.938] (-601.776) (-605.083) -- 0:00:39

      Average standard deviation of split frequencies: 0.017299

      360500 -- (-601.937) [-601.261] (-601.878) (-613.338) * (-604.166) (-602.516) [-602.714] (-606.689) -- 0:00:39
      361000 -- [-601.948] (-601.614) (-603.143) (-601.362) * [-602.837] (-602.164) (-602.152) (-606.024) -- 0:00:38
      361500 -- [-604.003] (-605.086) (-603.375) (-602.738) * (-602.364) (-601.840) (-603.142) [-603.783] -- 0:00:38
      362000 -- (-603.768) [-602.410] (-603.877) (-602.752) * (-602.292) (-606.231) (-603.569) [-605.369] -- 0:00:38
      362500 -- [-601.199] (-604.175) (-603.182) (-604.347) * [-605.769] (-602.913) (-607.276) (-604.527) -- 0:00:38
      363000 -- (-603.239) (-607.135) [-603.006] (-603.007) * (-602.860) (-604.943) [-604.550] (-601.497) -- 0:00:38
      363500 -- [-604.446] (-603.867) (-604.021) (-604.462) * [-603.282] (-608.712) (-603.647) (-602.815) -- 0:00:38
      364000 -- (-603.303) [-603.269] (-601.249) (-603.193) * [-601.712] (-604.615) (-606.333) (-603.501) -- 0:00:38
      364500 -- [-601.616] (-602.272) (-602.585) (-600.804) * (-601.453) [-601.440] (-601.951) (-605.908) -- 0:00:38
      365000 -- [-600.840] (-603.438) (-603.853) (-602.792) * (-604.293) [-606.288] (-603.510) (-602.701) -- 0:00:38

      Average standard deviation of split frequencies: 0.017388

      365500 -- (-601.460) [-603.580] (-603.311) (-603.807) * (-603.505) (-609.762) (-602.942) [-601.678] -- 0:00:38
      366000 -- (-601.566) [-603.967] (-604.154) (-602.796) * (-601.844) (-607.120) (-601.833) [-602.930] -- 0:00:38
      366500 -- (-604.142) (-603.521) [-602.541] (-604.111) * (-606.294) [-606.623] (-605.391) (-605.876) -- 0:00:38
      367000 -- (-608.443) [-602.335] (-603.879) (-600.889) * (-602.672) (-607.217) [-604.090] (-603.639) -- 0:00:37
      367500 -- (-606.194) (-603.189) (-602.966) [-601.804] * (-605.077) [-604.403] (-602.585) (-602.442) -- 0:00:37
      368000 -- (-603.607) (-603.747) [-603.896] (-601.910) * (-602.687) (-602.856) [-604.466] (-602.465) -- 0:00:37
      368500 -- [-601.897] (-603.003) (-602.395) (-602.678) * (-602.628) [-604.140] (-603.096) (-608.327) -- 0:00:37
      369000 -- (-602.817) (-600.982) (-604.765) [-604.295] * (-603.967) (-603.484) (-602.874) [-601.374] -- 0:00:37
      369500 -- (-604.727) (-601.019) (-610.369) [-601.803] * (-601.404) (-603.497) (-603.514) [-605.017] -- 0:00:37
      370000 -- (-601.763) [-602.522] (-603.508) (-602.130) * (-601.928) (-603.791) (-603.597) [-603.821] -- 0:00:37

      Average standard deviation of split frequencies: 0.016982

      370500 -- (-604.013) (-602.578) [-603.695] (-603.602) * (-602.300) [-602.617] (-601.320) (-604.096) -- 0:00:37
      371000 -- (-608.603) (-602.328) (-604.394) [-601.696] * [-603.218] (-602.655) (-602.406) (-602.396) -- 0:00:38
      371500 -- (-607.861) [-602.442] (-602.799) (-603.751) * (-603.251) [-602.180] (-603.831) (-602.356) -- 0:00:38
      372000 -- (-602.336) (-603.321) [-602.380] (-601.680) * (-601.638) (-607.309) [-602.384] (-601.704) -- 0:00:38
      372500 -- [-602.573] (-602.484) (-601.657) (-602.116) * [-605.459] (-604.562) (-601.160) (-603.849) -- 0:00:38
      373000 -- [-601.919] (-601.363) (-602.066) (-600.803) * (-604.236) [-602.654] (-603.356) (-605.420) -- 0:00:38
      373500 -- [-601.839] (-601.786) (-601.744) (-603.893) * (-602.588) (-604.232) (-604.480) [-601.226] -- 0:00:38
      374000 -- [-601.649] (-604.110) (-606.616) (-600.846) * [-603.650] (-602.881) (-605.274) (-601.798) -- 0:00:38
      374500 -- [-602.326] (-605.707) (-603.096) (-602.992) * (-601.773) (-604.752) (-603.902) [-601.384] -- 0:00:38
      375000 -- (-604.822) [-603.653] (-603.672) (-603.073) * (-606.687) (-602.718) (-603.006) [-601.796] -- 0:00:38

      Average standard deviation of split frequencies: 0.016004

      375500 -- (-603.110) (-602.651) (-604.948) [-602.815] * (-604.508) [-607.615] (-602.739) (-602.700) -- 0:00:38
      376000 -- (-606.129) (-602.804) (-603.174) [-601.491] * (-602.285) (-603.188) [-601.327] (-606.411) -- 0:00:38
      376500 -- (-603.659) [-602.383] (-602.726) (-602.849) * (-601.675) (-604.253) [-601.312] (-604.813) -- 0:00:38
      377000 -- (-604.750) (-603.163) (-601.300) [-602.553] * [-602.733] (-602.783) (-604.471) (-605.236) -- 0:00:38
      377500 -- [-605.239] (-601.228) (-602.701) (-604.911) * (-602.393) (-601.440) [-604.531] (-602.843) -- 0:00:37
      378000 -- (-602.075) (-602.774) (-603.146) [-604.387] * (-601.731) (-601.771) [-601.470] (-603.292) -- 0:00:37
      378500 -- [-602.367] (-602.556) (-603.231) (-601.655) * [-603.738] (-603.101) (-600.995) (-604.559) -- 0:00:37
      379000 -- (-605.252) [-603.058] (-602.426) (-601.946) * (-601.789) (-602.313) [-601.145] (-603.184) -- 0:00:37
      379500 -- (-602.328) [-601.296] (-603.687) (-602.653) * (-602.327) (-606.297) [-605.534] (-602.488) -- 0:00:37
      380000 -- (-604.811) [-601.360] (-602.912) (-602.055) * (-601.330) (-603.264) (-605.103) [-602.179] -- 0:00:37

      Average standard deviation of split frequencies: 0.015880

      380500 -- (-605.052) (-604.542) (-603.558) [-603.262] * [-601.958] (-603.971) (-609.365) (-602.410) -- 0:00:37
      381000 -- (-606.634) (-603.229) (-602.004) [-604.423] * [-604.294] (-603.750) (-605.838) (-603.214) -- 0:00:37
      381500 -- (-604.042) [-603.652] (-602.995) (-600.824) * (-602.852) [-602.403] (-603.714) (-603.005) -- 0:00:37
      382000 -- (-606.880) (-602.541) (-602.339) [-604.188] * (-601.449) (-601.788) (-602.763) [-604.441] -- 0:00:37
      382500 -- (-603.354) [-601.930] (-602.752) (-601.751) * (-603.087) (-603.016) [-603.492] (-602.055) -- 0:00:37
      383000 -- (-603.529) (-603.923) [-606.156] (-603.929) * (-602.363) (-601.696) (-603.578) [-601.182] -- 0:00:37
      383500 -- (-603.285) (-604.831) (-603.840) [-602.349] * [-603.274] (-603.839) (-603.897) (-601.229) -- 0:00:36
      384000 -- (-608.564) (-603.541) [-604.631] (-606.757) * (-604.213) [-601.764] (-601.575) (-603.192) -- 0:00:36
      384500 -- [-604.031] (-606.089) (-603.303) (-601.192) * (-602.636) (-603.103) (-605.574) [-601.524] -- 0:00:36
      385000 -- [-602.824] (-602.933) (-604.046) (-601.685) * (-600.726) (-602.985) [-601.867] (-605.113) -- 0:00:36

      Average standard deviation of split frequencies: 0.015130

      385500 -- (-605.185) (-602.758) [-603.271] (-605.159) * [-600.726] (-603.437) (-601.774) (-603.607) -- 0:00:36
      386000 -- [-604.386] (-600.720) (-604.513) (-604.225) * (-600.921) (-601.455) [-601.681] (-601.200) -- 0:00:36
      386500 -- (-600.784) (-603.972) (-604.825) [-606.205] * (-611.174) (-601.003) (-601.250) [-601.425] -- 0:00:36
      387000 -- (-601.524) (-604.645) (-602.729) [-603.856] * [-601.625] (-603.301) (-606.793) (-603.716) -- 0:00:36
      387500 -- (-603.122) (-605.918) [-602.354] (-604.517) * (-607.867) (-604.894) (-603.177) [-601.605] -- 0:00:37
      388000 -- (-601.675) (-603.720) (-601.454) [-602.842] * (-602.528) (-605.727) [-605.416] (-605.960) -- 0:00:37
      388500 -- (-601.182) (-603.671) (-601.583) [-602.778] * (-602.060) (-605.394) (-603.985) [-603.362] -- 0:00:37
      389000 -- (-603.441) [-602.565] (-602.072) (-608.797) * (-602.014) (-605.976) (-602.806) [-601.924] -- 0:00:37
      389500 -- [-601.959] (-604.574) (-601.205) (-602.181) * (-602.004) (-601.301) [-602.040] (-607.568) -- 0:00:37
      390000 -- (-604.831) (-601.783) (-602.758) [-601.118] * [-601.161] (-603.666) (-601.073) (-602.794) -- 0:00:37

      Average standard deviation of split frequencies: 0.014906

      390500 -- (-602.184) [-603.695] (-604.981) (-601.319) * (-606.403) [-604.378] (-601.554) (-602.648) -- 0:00:37
      391000 -- [-602.739] (-604.342) (-601.702) (-604.394) * (-602.980) [-602.396] (-603.697) (-604.311) -- 0:00:37
      391500 -- (-601.130) (-604.224) (-604.753) [-604.277] * (-605.581) (-602.684) (-605.606) [-602.657] -- 0:00:37
      392000 -- (-603.471) [-603.205] (-605.742) (-604.615) * (-600.917) [-604.174] (-602.151) (-603.567) -- 0:00:37
      392500 -- (-603.251) (-604.776) (-604.001) [-602.245] * [-602.319] (-606.946) (-605.937) (-602.309) -- 0:00:37
      393000 -- [-604.246] (-603.607) (-605.651) (-602.681) * [-601.825] (-602.025) (-602.566) (-602.992) -- 0:00:37
      393500 -- [-601.887] (-602.586) (-603.999) (-601.821) * [-602.831] (-602.739) (-601.765) (-601.898) -- 0:00:36
      394000 -- (-609.218) [-602.453] (-605.223) (-601.333) * [-602.513] (-603.940) (-601.493) (-601.585) -- 0:00:36
      394500 -- (-604.535) (-603.246) (-601.277) [-602.349] * (-605.518) [-601.303] (-604.093) (-603.929) -- 0:00:36
      395000 -- (-602.906) [-603.064] (-603.372) (-604.198) * [-603.754] (-602.489) (-603.196) (-602.078) -- 0:00:36

      Average standard deviation of split frequencies: 0.014915

      395500 -- (-602.145) [-602.068] (-602.220) (-604.063) * (-602.926) [-604.727] (-606.053) (-604.616) -- 0:00:36
      396000 -- (-601.620) [-606.814] (-602.410) (-603.030) * (-603.899) (-601.075) (-605.217) [-607.501] -- 0:00:36
      396500 -- [-602.817] (-604.109) (-601.651) (-602.919) * (-602.319) (-602.601) [-604.300] (-605.547) -- 0:00:36
      397000 -- [-603.255] (-602.836) (-601.618) (-604.167) * [-604.619] (-603.592) (-605.608) (-602.658) -- 0:00:36
      397500 -- [-601.876] (-604.567) (-604.469) (-602.283) * [-605.358] (-603.106) (-602.872) (-602.464) -- 0:00:36
      398000 -- (-605.388) [-603.653] (-603.830) (-602.231) * [-605.022] (-604.456) (-603.782) (-601.203) -- 0:00:36
      398500 -- (-601.602) [-602.870] (-604.275) (-602.000) * (-602.132) [-601.737] (-604.807) (-604.137) -- 0:00:36
      399000 -- (-601.111) [-601.687] (-604.104) (-603.107) * (-607.177) (-602.200) [-602.547] (-601.160) -- 0:00:36
      399500 -- (-602.975) [-601.327] (-602.637) (-601.717) * (-607.633) (-601.740) (-606.788) [-602.122] -- 0:00:36
      400000 -- (-601.476) [-603.726] (-601.482) (-602.048) * (-605.074) [-601.763] (-605.647) (-602.553) -- 0:00:36

      Average standard deviation of split frequencies: 0.014672

      400500 -- [-602.554] (-601.376) (-602.561) (-607.261) * (-605.804) (-603.008) [-606.133] (-601.603) -- 0:00:35
      401000 -- (-602.818) (-603.346) (-602.388) [-602.872] * (-608.690) (-605.135) [-602.571] (-601.139) -- 0:00:35
      401500 -- (-602.757) [-603.969] (-601.810) (-601.519) * (-605.454) (-602.713) [-603.921] (-601.015) -- 0:00:35
      402000 -- (-603.317) (-602.410) (-601.353) [-601.868] * (-603.207) (-603.250) (-605.989) [-604.409] -- 0:00:35
      402500 -- [-601.839] (-603.348) (-600.860) (-604.502) * [-608.957] (-602.750) (-603.837) (-603.041) -- 0:00:35
      403000 -- [-601.460] (-601.488) (-601.535) (-603.538) * [-606.549] (-606.263) (-601.229) (-603.192) -- 0:00:35
      403500 -- (-603.616) (-602.651) [-604.490] (-601.780) * (-603.076) [-604.178] (-602.150) (-606.500) -- 0:00:35
      404000 -- (-602.460) (-601.282) [-606.316] (-603.879) * (-603.521) (-604.688) [-602.132] (-602.310) -- 0:00:36
      404500 -- (-601.758) [-603.095] (-601.355) (-603.837) * (-604.036) [-603.787] (-603.119) (-601.850) -- 0:00:36
      405000 -- (-601.579) [-602.639] (-604.590) (-602.825) * (-601.274) (-601.418) [-602.922] (-602.029) -- 0:00:36

      Average standard deviation of split frequencies: 0.015777

      405500 -- (-601.860) [-602.750] (-604.965) (-603.640) * [-603.853] (-604.568) (-604.855) (-604.111) -- 0:00:36
      406000 -- (-601.177) (-603.688) [-602.302] (-603.215) * [-603.463] (-603.338) (-611.549) (-601.477) -- 0:00:36
      406500 -- (-602.103) [-603.039] (-603.004) (-603.740) * (-601.542) (-605.990) (-609.120) [-604.306] -- 0:00:36
      407000 -- (-602.540) (-603.288) [-603.715] (-605.451) * (-604.433) [-603.229] (-604.084) (-601.551) -- 0:00:36
      407500 -- (-602.353) [-602.797] (-601.832) (-604.433) * (-603.024) (-606.256) [-603.293] (-604.147) -- 0:00:36
      408000 -- (-602.663) [-603.183] (-603.607) (-606.001) * (-600.979) (-603.238) [-606.597] (-602.200) -- 0:00:36
      408500 -- (-602.601) [-603.134] (-601.358) (-603.904) * [-602.075] (-604.582) (-603.120) (-606.216) -- 0:00:36
      409000 -- [-607.734] (-604.701) (-602.502) (-606.675) * (-601.895) (-605.104) [-602.497] (-604.792) -- 0:00:36
      409500 -- (-602.494) [-601.893] (-603.508) (-605.598) * (-601.911) [-602.003] (-601.356) (-606.097) -- 0:00:36
      410000 -- (-604.343) [-601.479] (-604.845) (-603.558) * (-601.520) (-602.978) (-605.174) [-604.187] -- 0:00:35

      Average standard deviation of split frequencies: 0.015733

      410500 -- (-609.309) (-601.940) [-603.553] (-603.667) * (-602.163) (-603.240) [-601.911] (-606.179) -- 0:00:35
      411000 -- (-601.777) (-603.018) (-603.542) [-604.453] * [-602.065] (-604.686) (-601.348) (-605.705) -- 0:00:35
      411500 -- [-602.223] (-605.612) (-604.122) (-603.945) * (-602.856) (-603.226) (-602.639) [-603.129] -- 0:00:35
      412000 -- (-601.210) [-602.839] (-603.590) (-602.009) * (-601.204) (-604.535) (-604.392) [-601.476] -- 0:00:35
      412500 -- [-601.307] (-601.894) (-603.039) (-604.820) * (-602.954) (-606.515) (-601.031) [-602.241] -- 0:00:35
      413000 -- (-601.869) [-601.929] (-605.854) (-608.856) * (-602.329) (-604.532) [-603.759] (-603.115) -- 0:00:35
      413500 -- (-604.526) [-601.947] (-602.966) (-606.390) * (-603.292) [-604.872] (-601.909) (-605.111) -- 0:00:35
      414000 -- (-603.600) [-602.283] (-604.595) (-604.623) * [-601.600] (-601.887) (-602.548) (-603.114) -- 0:00:35
      414500 -- (-604.207) [-603.956] (-607.885) (-604.995) * (-601.822) (-601.313) [-603.583] (-608.851) -- 0:00:35
      415000 -- [-604.474] (-601.753) (-601.270) (-603.642) * (-601.759) [-601.451] (-603.942) (-604.479) -- 0:00:35

      Average standard deviation of split frequencies: 0.014665

      415500 -- [-601.641] (-603.360) (-602.731) (-605.968) * [-602.313] (-601.465) (-607.660) (-602.921) -- 0:00:35
      416000 -- (-602.907) (-605.362) [-603.249] (-601.823) * [-603.401] (-603.824) (-602.270) (-605.992) -- 0:00:35
      416500 -- (-601.785) (-603.781) [-601.902] (-601.386) * (-601.322) [-603.389] (-603.123) (-602.150) -- 0:00:35
      417000 -- (-602.514) (-605.211) [-602.342] (-603.064) * (-601.477) [-602.289] (-602.120) (-605.676) -- 0:00:34
      417500 -- (-601.668) (-602.989) (-602.649) [-603.243] * (-603.380) (-602.734) (-602.668) [-601.499] -- 0:00:34
      418000 -- (-602.855) (-603.777) [-604.109] (-603.353) * (-603.817) [-601.742] (-604.919) (-601.438) -- 0:00:34
      418500 -- (-602.272) [-603.927] (-603.425) (-601.446) * [-603.342] (-603.576) (-604.270) (-602.013) -- 0:00:34
      419000 -- [-602.986] (-604.801) (-601.555) (-604.179) * (-605.785) (-603.597) [-602.819] (-601.858) -- 0:00:34
      419500 -- (-602.361) (-604.503) (-602.328) [-608.056] * (-603.507) (-602.238) (-602.629) [-601.701] -- 0:00:34
      420000 -- (-602.360) [-602.731] (-606.263) (-602.847) * (-605.804) (-604.260) [-603.694] (-605.037) -- 0:00:34

      Average standard deviation of split frequencies: 0.015359

      420500 -- [-602.734] (-604.765) (-605.186) (-607.418) * (-603.276) [-602.674] (-602.883) (-601.103) -- 0:00:34
      421000 -- (-601.564) [-601.389] (-603.221) (-602.292) * (-602.392) (-603.676) (-601.722) [-601.515] -- 0:00:35
      421500 -- (-602.316) [-601.810] (-604.511) (-603.587) * (-602.307) [-602.058] (-601.563) (-602.159) -- 0:00:35
      422000 -- (-602.827) [-603.733] (-605.671) (-601.767) * [-601.738] (-602.542) (-602.572) (-603.870) -- 0:00:35
      422500 -- (-602.333) [-601.859] (-604.971) (-601.091) * (-604.352) (-605.117) [-602.131] (-604.167) -- 0:00:35
      423000 -- (-605.234) [-601.928] (-604.146) (-601.161) * (-601.687) [-601.137] (-602.439) (-601.139) -- 0:00:35
      423500 -- [-604.230] (-602.268) (-604.558) (-605.513) * (-604.311) (-605.851) [-604.770] (-601.033) -- 0:00:35
      424000 -- (-602.386) (-605.394) (-604.492) [-601.678] * [-602.622] (-606.362) (-602.997) (-603.144) -- 0:00:35
      424500 -- (-603.048) (-610.275) [-604.092] (-603.378) * (-603.761) [-607.616] (-603.024) (-604.740) -- 0:00:35
      425000 -- (-605.468) (-602.784) [-603.399] (-607.120) * (-605.187) [-605.863] (-601.914) (-605.485) -- 0:00:35

      Average standard deviation of split frequencies: 0.015297

      425500 -- (-602.511) (-603.151) [-601.554] (-601.716) * [-603.980] (-605.682) (-602.839) (-601.528) -- 0:00:35
      426000 -- (-603.810) (-605.172) [-602.242] (-605.859) * (-606.194) (-603.174) [-603.137] (-601.781) -- 0:00:35
      426500 -- (-606.043) (-606.302) (-601.289) [-602.685] * [-603.228] (-604.236) (-602.353) (-603.491) -- 0:00:34
      427000 -- [-603.542] (-602.060) (-605.626) (-603.652) * (-602.366) (-606.319) [-602.207] (-605.459) -- 0:00:34
      427500 -- [-606.394] (-601.257) (-606.966) (-602.812) * (-603.418) (-605.271) (-603.492) [-601.917] -- 0:00:34
      428000 -- (-603.532) (-602.565) [-605.967] (-602.453) * (-601.769) (-601.735) (-603.945) [-605.460] -- 0:00:34
      428500 -- [-601.761] (-603.116) (-601.181) (-602.692) * (-603.530) [-604.347] (-603.582) (-602.122) -- 0:00:34
      429000 -- (-603.905) (-605.768) [-602.955] (-605.891) * [-603.859] (-606.828) (-604.428) (-605.216) -- 0:00:34
      429500 -- (-602.584) (-601.856) [-601.655] (-605.547) * (-605.784) [-601.488] (-604.146) (-602.277) -- 0:00:34
      430000 -- (-605.262) [-601.243] (-605.571) (-605.486) * [-603.329] (-605.468) (-603.879) (-602.690) -- 0:00:34

      Average standard deviation of split frequencies: 0.015461

      430500 -- (-609.364) [-601.687] (-609.586) (-602.238) * (-601.156) (-604.840) (-602.948) [-602.633] -- 0:00:34
      431000 -- (-604.073) (-601.546) (-611.051) [-601.343] * (-601.174) (-601.146) (-603.550) [-603.820] -- 0:00:34
      431500 -- (-601.207) [-601.794] (-606.756) (-602.269) * [-602.666] (-601.642) (-602.923) (-603.573) -- 0:00:34
      432000 -- [-600.961] (-604.117) (-602.683) (-602.217) * [-605.450] (-603.269) (-605.386) (-602.820) -- 0:00:34
      432500 -- (-603.098) [-603.663] (-605.793) (-603.632) * (-602.495) (-602.243) (-603.666) [-604.194] -- 0:00:34
      433000 -- (-604.330) (-603.092) (-601.486) [-602.326] * (-602.423) (-602.303) [-603.930] (-603.730) -- 0:00:34
      433500 -- (-604.606) (-605.890) [-603.419] (-607.212) * [-602.524] (-602.420) (-603.538) (-604.900) -- 0:00:33
      434000 -- (-608.056) (-602.103) [-601.930] (-604.325) * (-607.710) [-602.296] (-604.003) (-603.099) -- 0:00:33
      434500 -- (-603.303) (-608.312) [-606.716] (-603.334) * [-601.816] (-603.829) (-603.427) (-601.283) -- 0:00:33
      435000 -- (-602.832) (-606.802) (-603.129) [-602.760] * (-605.924) (-602.701) (-606.395) [-602.012] -- 0:00:33

      Average standard deviation of split frequencies: 0.014934

      435500 -- [-601.967] (-612.375) (-603.981) (-603.619) * (-604.192) (-607.142) [-602.279] (-601.879) -- 0:00:33
      436000 -- (-602.792) [-604.850] (-601.802) (-603.431) * [-601.905] (-602.127) (-605.600) (-603.124) -- 0:00:33
      436500 -- (-603.804) (-604.778) [-603.901] (-601.759) * (-601.883) (-601.471) [-603.963] (-602.754) -- 0:00:33
      437000 -- (-602.464) [-604.648] (-602.490) (-603.093) * (-602.284) (-603.921) [-605.596] (-604.661) -- 0:00:33
      437500 -- [-601.636] (-600.876) (-602.691) (-607.411) * (-601.555) (-605.728) [-602.712] (-604.250) -- 0:00:33
      438000 -- (-607.501) (-604.599) [-601.867] (-605.851) * (-603.624) [-602.190] (-602.836) (-603.510) -- 0:00:34
      438500 -- (-605.206) (-601.160) [-601.176] (-603.786) * [-602.371] (-601.848) (-604.122) (-605.847) -- 0:00:34
      439000 -- [-602.377] (-603.539) (-601.966) (-602.857) * [-602.127] (-602.769) (-602.761) (-604.308) -- 0:00:34
      439500 -- (-603.746) (-604.788) [-604.108] (-606.998) * (-605.069) [-602.257] (-602.424) (-602.756) -- 0:00:34
      440000 -- (-602.903) [-603.152] (-601.384) (-606.807) * (-604.505) (-602.953) (-601.584) [-603.563] -- 0:00:34

      Average standard deviation of split frequencies: 0.015378

      440500 -- [-602.111] (-603.377) (-601.543) (-611.134) * (-602.812) (-602.333) (-603.248) [-601.478] -- 0:00:34
      441000 -- [-602.116] (-610.922) (-603.040) (-602.442) * [-600.895] (-604.542) (-600.971) (-603.233) -- 0:00:34
      441500 -- (-601.031) (-606.540) (-602.286) [-603.544] * (-601.790) [-605.581] (-606.775) (-601.592) -- 0:00:34
      442000 -- (-604.681) [-605.021] (-601.767) (-604.467) * (-601.507) (-602.878) [-602.909] (-606.012) -- 0:00:34
      442500 -- (-607.545) (-602.095) [-604.054] (-603.460) * [-602.088] (-602.443) (-603.423) (-603.654) -- 0:00:34
      443000 -- (-604.041) (-602.220) (-602.917) [-603.479] * (-604.022) (-603.568) (-601.565) [-602.938] -- 0:00:33
      443500 -- (-602.590) (-603.076) [-603.094] (-607.129) * (-602.915) (-604.577) [-601.762] (-603.369) -- 0:00:33
      444000 -- (-601.225) (-602.002) (-605.441) [-603.252] * (-602.896) [-602.611] (-604.127) (-602.378) -- 0:00:33
      444500 -- (-603.127) (-602.301) [-602.597] (-601.947) * (-602.488) (-603.731) [-603.089] (-603.396) -- 0:00:33
      445000 -- (-602.790) (-601.869) (-602.831) [-606.652] * (-605.365) [-602.638] (-601.623) (-602.687) -- 0:00:33

      Average standard deviation of split frequencies: 0.014137

      445500 -- (-604.547) [-601.568] (-604.104) (-607.207) * (-603.847) (-604.198) (-601.298) [-601.305] -- 0:00:33
      446000 -- (-603.059) (-605.777) [-605.941] (-605.487) * (-603.041) (-603.904) [-601.661] (-604.380) -- 0:00:33
      446500 -- [-603.018] (-603.325) (-601.877) (-602.774) * [-601.289] (-604.015) (-604.382) (-601.801) -- 0:00:33
      447000 -- (-609.996) [-602.959] (-603.685) (-603.100) * [-602.052] (-608.717) (-604.623) (-604.540) -- 0:00:33
      447500 -- (-602.227) [-601.755] (-601.167) (-604.680) * (-603.055) (-604.923) [-602.457] (-604.209) -- 0:00:33
      448000 -- [-600.957] (-602.157) (-602.830) (-601.841) * (-603.953) (-603.146) [-604.907] (-605.189) -- 0:00:33
      448500 -- (-602.810) [-602.013] (-604.104) (-603.979) * (-605.885) (-601.492) [-604.658] (-605.443) -- 0:00:33
      449000 -- (-602.150) (-602.838) [-601.478] (-606.260) * (-601.715) (-606.107) (-602.137) [-603.081] -- 0:00:33
      449500 -- [-607.728] (-601.649) (-603.776) (-602.348) * (-602.210) (-604.563) [-602.161] (-605.406) -- 0:00:33
      450000 -- (-603.489) (-603.905) [-600.766] (-605.040) * [-602.106] (-602.809) (-602.035) (-604.433) -- 0:00:33

      Average standard deviation of split frequencies: 0.014574

      450500 -- (-602.262) (-603.589) [-607.839] (-605.526) * (-602.479) [-601.576] (-603.085) (-605.037) -- 0:00:32
      451000 -- (-603.840) (-603.810) [-607.217] (-603.330) * [-604.837] (-604.207) (-604.849) (-603.439) -- 0:00:32
      451500 -- (-603.908) [-603.383] (-608.704) (-605.445) * (-605.532) [-603.439] (-604.916) (-602.445) -- 0:00:32
      452000 -- (-606.012) (-601.930) (-604.673) [-602.800] * [-601.914] (-604.383) (-602.035) (-602.545) -- 0:00:32
      452500 -- (-605.112) (-606.575) [-601.956] (-601.501) * (-603.228) [-602.430] (-602.428) (-604.376) -- 0:00:32
      453000 -- (-603.411) (-604.705) (-602.123) [-605.329] * (-607.815) (-602.365) (-601.068) [-602.299] -- 0:00:32
      453500 -- (-604.320) (-601.320) (-601.277) [-602.145] * (-608.629) (-602.337) (-602.513) [-602.410] -- 0:00:32
      454000 -- (-604.458) (-601.699) [-601.951] (-603.104) * (-609.337) [-606.494] (-603.943) (-605.935) -- 0:00:33
      454500 -- (-602.935) [-601.140] (-606.793) (-602.938) * (-602.537) [-603.451] (-602.624) (-602.418) -- 0:00:33
      455000 -- (-606.073) [-600.824] (-603.152) (-601.670) * (-601.621) (-604.650) [-602.484] (-602.415) -- 0:00:33

      Average standard deviation of split frequencies: 0.013439

      455500 -- (-603.817) [-601.079] (-601.972) (-603.174) * (-601.235) [-601.922] (-603.322) (-604.642) -- 0:00:33
      456000 -- [-601.845] (-603.716) (-601.781) (-605.597) * (-606.451) [-604.806] (-606.316) (-606.309) -- 0:00:33
      456500 -- [-601.372] (-601.771) (-602.507) (-601.821) * (-606.291) [-600.840] (-604.082) (-608.640) -- 0:00:33
      457000 -- [-602.388] (-604.195) (-601.339) (-604.771) * (-605.006) (-601.490) [-601.841] (-601.726) -- 0:00:33
      457500 -- [-603.116] (-605.709) (-601.365) (-604.349) * (-601.412) [-603.181] (-602.702) (-604.072) -- 0:00:33
      458000 -- (-603.286) (-603.472) [-601.483] (-602.778) * [-602.667] (-604.621) (-603.157) (-604.303) -- 0:00:33
      458500 -- (-604.835) (-606.444) (-601.231) [-603.433] * (-605.783) (-603.832) [-605.343] (-603.512) -- 0:00:33
      459000 -- [-601.250] (-605.147) (-601.187) (-601.650) * (-605.856) (-604.380) [-605.801] (-605.437) -- 0:00:33
      459500 -- (-602.926) [-602.706] (-604.975) (-611.189) * (-608.576) [-601.694] (-603.704) (-604.643) -- 0:00:32
      460000 -- (-601.318) (-602.048) [-601.337] (-604.745) * (-604.901) (-602.772) (-603.110) [-603.677] -- 0:00:32

      Average standard deviation of split frequencies: 0.013781

      460500 -- (-603.645) [-601.195] (-603.229) (-601.103) * (-603.514) (-604.167) [-601.980] (-605.529) -- 0:00:32
      461000 -- [-602.384] (-606.897) (-603.893) (-604.143) * (-602.536) (-606.285) [-602.632] (-602.198) -- 0:00:32
      461500 -- (-602.246) [-602.045] (-602.210) (-603.419) * (-604.565) (-602.308) (-602.050) [-602.135] -- 0:00:32
      462000 -- [-606.295] (-606.599) (-603.560) (-601.845) * (-601.758) (-601.914) [-602.743] (-606.786) -- 0:00:32
      462500 -- (-605.463) [-602.748] (-602.089) (-602.869) * (-602.900) [-601.297] (-602.557) (-601.458) -- 0:00:32
      463000 -- [-604.535] (-601.842) (-603.426) (-602.700) * [-605.005] (-603.757) (-606.383) (-604.041) -- 0:00:32
      463500 -- (-604.567) (-602.258) [-602.145] (-606.842) * (-604.428) (-603.045) (-608.140) [-602.652] -- 0:00:32
      464000 -- (-603.951) (-601.508) [-604.288] (-602.951) * (-601.167) (-601.422) [-602.176] (-602.844) -- 0:00:32
      464500 -- (-604.573) [-602.802] (-603.066) (-604.607) * [-601.935] (-605.235) (-603.774) (-601.287) -- 0:00:32
      465000 -- (-603.552) [-601.445] (-602.097) (-604.241) * [-605.647] (-607.055) (-603.284) (-603.668) -- 0:00:32

      Average standard deviation of split frequencies: 0.013893

      465500 -- [-601.668] (-603.899) (-604.170) (-603.216) * [-601.766] (-609.171) (-602.676) (-601.947) -- 0:00:32
      466000 -- [-602.839] (-601.130) (-602.021) (-609.215) * (-602.484) (-601.902) [-602.822] (-601.787) -- 0:00:32
      466500 -- [-606.248] (-601.658) (-603.792) (-603.606) * [-602.252] (-602.442) (-605.396) (-604.670) -- 0:00:32
      467000 -- (-602.794) (-604.967) [-603.127] (-603.846) * (-601.814) (-604.270) (-602.836) [-600.776] -- 0:00:31
      467500 -- (-602.857) [-602.513] (-604.234) (-603.792) * (-601.602) (-602.850) [-602.619] (-602.817) -- 0:00:31
      468000 -- (-600.703) (-606.386) [-602.692] (-601.084) * (-602.553) (-603.564) (-600.996) [-606.927] -- 0:00:31
      468500 -- [-603.374] (-604.171) (-603.617) (-606.897) * (-608.433) (-602.928) [-601.264] (-604.136) -- 0:00:31
      469000 -- [-601.971] (-601.562) (-601.735) (-604.874) * (-611.994) [-601.531] (-605.111) (-603.991) -- 0:00:31
      469500 -- [-603.847] (-602.291) (-602.376) (-602.577) * [-603.950] (-603.346) (-604.614) (-602.812) -- 0:00:31
      470000 -- (-601.559) (-604.493) [-602.607] (-602.322) * (-606.559) (-603.814) [-602.841] (-603.524) -- 0:00:32

      Average standard deviation of split frequencies: 0.013955

      470500 -- [-602.795] (-601.338) (-600.897) (-603.598) * (-603.170) (-604.982) (-605.200) [-602.417] -- 0:00:32
      471000 -- [-602.801] (-605.906) (-606.118) (-601.695) * [-602.978] (-604.723) (-603.411) (-601.407) -- 0:00:32
      471500 -- (-604.890) (-604.961) [-603.302] (-603.386) * (-601.800) (-602.211) [-603.530] (-601.651) -- 0:00:32
      472000 -- (-604.807) (-602.382) [-601.845] (-601.795) * (-604.318) [-601.907] (-601.682) (-604.243) -- 0:00:32
      472500 -- (-607.216) (-601.679) [-602.631] (-605.517) * (-602.588) (-604.220) [-602.125] (-603.059) -- 0:00:32
      473000 -- (-602.475) [-601.477] (-604.189) (-603.834) * (-603.591) (-602.867) (-604.527) [-600.803] -- 0:00:32
      473500 -- (-602.409) (-601.237) [-601.418] (-606.389) * (-605.745) (-603.123) (-608.132) [-601.503] -- 0:00:32
      474000 -- (-602.771) [-603.349] (-601.539) (-603.434) * (-600.967) (-601.386) (-604.591) [-602.604] -- 0:00:32
      474500 -- (-602.080) (-603.395) (-604.036) [-603.095] * (-604.666) [-608.399] (-602.994) (-604.010) -- 0:00:32
      475000 -- [-603.734] (-602.886) (-609.992) (-601.947) * (-603.741) (-606.674) [-603.069] (-602.250) -- 0:00:32

      Average standard deviation of split frequencies: 0.013469

      475500 -- [-603.860] (-604.092) (-603.250) (-603.533) * [-607.492] (-604.828) (-603.213) (-601.886) -- 0:00:31
      476000 -- (-605.396) (-603.734) (-601.291) [-602.379] * (-603.944) [-604.498] (-605.999) (-602.272) -- 0:00:31
      476500 -- (-603.506) (-606.424) (-602.385) [-602.946] * (-601.979) [-603.737] (-603.022) (-603.942) -- 0:00:31
      477000 -- (-605.096) (-607.732) (-604.197) [-601.289] * (-605.752) (-603.096) [-603.468] (-604.548) -- 0:00:31
      477500 -- (-603.588) [-603.348] (-602.963) (-602.073) * (-605.742) (-608.337) [-608.533] (-603.104) -- 0:00:31
      478000 -- (-601.616) (-605.104) [-602.980] (-605.184) * (-605.158) [-600.966] (-603.337) (-603.141) -- 0:00:31
      478500 -- (-602.399) (-604.193) [-601.285] (-603.411) * (-605.396) (-602.040) [-601.773] (-606.006) -- 0:00:31
      479000 -- (-601.881) (-604.515) [-601.848] (-603.185) * (-605.118) (-601.521) [-605.508] (-604.591) -- 0:00:31
      479500 -- (-602.031) [-602.178] (-605.265) (-606.061) * (-609.216) [-601.975] (-601.102) (-602.195) -- 0:00:31
      480000 -- (-603.731) (-605.660) (-604.739) [-604.152] * (-604.018) [-603.604] (-601.153) (-605.330) -- 0:00:31

      Average standard deviation of split frequencies: 0.012946

      480500 -- (-603.545) [-606.147] (-602.379) (-602.206) * [-604.856] (-604.087) (-601.305) (-601.483) -- 0:00:31
      481000 -- [-602.651] (-606.272) (-602.383) (-602.841) * (-608.284) [-605.973] (-602.109) (-603.892) -- 0:00:31
      481500 -- (-602.444) (-601.696) (-603.380) [-603.731] * (-603.379) (-602.982) (-604.234) [-606.860] -- 0:00:31
      482000 -- (-605.513) (-602.424) [-603.106] (-601.401) * (-605.835) (-601.395) [-602.363] (-602.264) -- 0:00:31
      482500 -- [-601.893] (-605.133) (-604.681) (-601.061) * [-604.392] (-601.597) (-605.715) (-604.338) -- 0:00:31
      483000 -- (-601.194) (-606.953) (-602.435) [-602.221] * (-605.509) [-602.527] (-608.034) (-602.349) -- 0:00:31
      483500 -- (-601.064) (-607.183) (-601.420) [-602.308] * (-604.283) (-607.970) (-602.088) [-604.622] -- 0:00:30
      484000 -- (-603.028) (-606.878) (-602.584) [-603.168] * (-602.716) [-601.914] (-606.618) (-606.165) -- 0:00:30
      484500 -- (-602.769) (-605.028) (-602.047) [-602.046] * [-603.976] (-604.281) (-603.790) (-602.825) -- 0:00:30
      485000 -- (-602.171) [-601.289] (-601.955) (-601.482) * [-602.923] (-601.587) (-603.105) (-603.449) -- 0:00:30

      Average standard deviation of split frequencies: 0.013515

      485500 -- [-601.997] (-602.452) (-604.698) (-602.711) * (-603.099) [-605.808] (-602.313) (-602.474) -- 0:00:30
      486000 -- (-602.785) [-603.288] (-605.343) (-602.835) * (-602.737) (-603.457) [-602.996] (-606.067) -- 0:00:30
      486500 -- (-602.075) (-602.853) [-603.585] (-602.085) * (-604.278) (-607.985) (-602.956) [-601.318] -- 0:00:30
      487000 -- (-604.315) (-601.561) (-604.998) [-605.525] * (-601.967) (-607.633) (-602.652) [-601.301] -- 0:00:31
      487500 -- (-602.352) (-605.179) (-607.586) [-602.497] * (-601.789) [-605.132] (-602.339) (-602.588) -- 0:00:31
      488000 -- (-603.876) (-606.716) (-610.103) [-603.374] * [-602.120] (-603.045) (-605.203) (-602.456) -- 0:00:31
      488500 -- [-602.556] (-602.592) (-603.754) (-603.853) * [-603.222] (-602.122) (-605.019) (-603.806) -- 0:00:31
      489000 -- (-603.297) [-603.519] (-601.600) (-603.972) * [-602.055] (-601.920) (-603.627) (-602.530) -- 0:00:31
      489500 -- (-606.130) (-607.077) [-604.334] (-601.621) * [-601.834] (-602.977) (-605.830) (-602.793) -- 0:00:31
      490000 -- (-604.208) (-602.304) [-602.659] (-605.131) * (-601.788) [-603.413] (-604.548) (-601.510) -- 0:00:31

      Average standard deviation of split frequencies: 0.012874

      490500 -- (-601.926) (-602.052) [-602.564] (-602.750) * [-602.234] (-601.743) (-602.464) (-601.952) -- 0:00:31
      491000 -- [-605.436] (-607.977) (-607.707) (-604.868) * (-601.562) (-601.061) [-603.386] (-604.119) -- 0:00:31
      491500 -- (-601.940) [-604.268] (-602.865) (-604.188) * (-602.572) (-601.234) [-605.250] (-603.792) -- 0:00:31
      492000 -- (-603.799) (-604.213) (-603.596) [-601.525] * (-602.794) [-604.812] (-604.810) (-601.935) -- 0:00:30
      492500 -- (-603.390) (-608.848) [-604.887] (-604.205) * (-602.797) (-606.171) [-602.803] (-602.637) -- 0:00:30
      493000 -- (-602.141) (-607.647) (-603.792) [-603.922] * [-601.687] (-601.645) (-603.723) (-603.702) -- 0:00:30
      493500 -- (-605.006) (-602.205) (-600.982) [-601.781] * (-602.920) (-601.723) [-602.616] (-605.389) -- 0:00:30
      494000 -- (-602.183) (-605.482) (-601.200) [-602.088] * (-603.222) (-602.684) [-601.961] (-603.167) -- 0:00:30
      494500 -- (-603.896) [-602.529] (-602.306) (-602.141) * (-605.270) [-601.647] (-601.687) (-610.499) -- 0:00:30
      495000 -- (-608.900) [-603.075] (-601.809) (-604.415) * (-603.622) [-601.103] (-602.445) (-602.161) -- 0:00:30

      Average standard deviation of split frequencies: 0.012926

      495500 -- (-608.528) (-605.546) [-604.852] (-604.185) * [-602.743] (-603.290) (-604.315) (-603.224) -- 0:00:30
      496000 -- (-604.547) (-601.834) [-600.953] (-602.952) * (-603.037) (-603.605) [-601.805] (-603.231) -- 0:00:30
      496500 -- (-601.582) (-605.461) (-603.074) [-601.800] * (-602.676) (-601.820) [-603.493] (-600.869) -- 0:00:30
      497000 -- (-602.819) (-603.119) (-602.948) [-603.826] * [-603.254] (-603.725) (-601.629) (-604.389) -- 0:00:30
      497500 -- (-601.538) (-602.137) (-604.028) [-606.460] * [-607.324] (-601.818) (-601.944) (-602.558) -- 0:00:30
      498000 -- (-605.442) (-601.278) (-602.514) [-604.864] * (-603.145) (-602.710) (-602.634) [-603.488] -- 0:00:30
      498500 -- (-605.879) (-605.031) [-602.260] (-603.741) * (-603.020) [-606.567] (-603.826) (-603.057) -- 0:00:30
      499000 -- (-601.783) (-607.340) (-601.823) [-601.569] * [-603.052] (-604.224) (-601.274) (-603.409) -- 0:00:30
      499500 -- [-602.650] (-607.225) (-601.754) (-602.344) * [-603.346] (-607.563) (-602.871) (-602.114) -- 0:00:30
      500000 -- (-601.504) (-603.034) [-608.702] (-602.478) * [-601.090] (-605.759) (-605.102) (-604.229) -- 0:00:30

      Average standard deviation of split frequencies: 0.012931

      500500 -- (-605.068) (-601.873) [-604.903] (-601.957) * (-601.512) [-603.069] (-608.469) (-604.310) -- 0:00:29
      501000 -- (-604.644) (-602.618) [-604.970] (-602.651) * (-604.610) (-602.486) (-603.156) [-601.487] -- 0:00:29
      501500 -- [-603.023] (-607.643) (-601.675) (-602.905) * (-604.285) [-603.064] (-601.011) (-603.585) -- 0:00:29
      502000 -- (-605.819) [-605.772] (-601.652) (-606.358) * (-603.596) [-602.827] (-605.449) (-605.084) -- 0:00:29
      502500 -- (-605.133) (-604.021) [-604.416] (-606.650) * (-604.375) (-602.512) (-602.662) [-602.450] -- 0:00:29
      503000 -- [-603.124] (-605.265) (-604.474) (-601.682) * (-604.322) (-606.189) [-602.384] (-601.165) -- 0:00:29
      503500 -- (-604.866) [-602.975] (-603.133) (-603.000) * [-605.808] (-604.460) (-602.328) (-601.915) -- 0:00:29
      504000 -- (-606.732) [-601.962] (-601.784) (-603.022) * (-604.226) [-601.593] (-603.549) (-601.929) -- 0:00:29
      504500 -- (-603.220) [-602.829] (-601.288) (-603.862) * (-605.071) [-603.909] (-606.242) (-603.697) -- 0:00:30
      505000 -- [-603.870] (-602.480) (-604.582) (-601.296) * (-603.887) [-601.396] (-605.777) (-604.915) -- 0:00:30

      Average standard deviation of split frequencies: 0.012461

      505500 -- (-601.625) [-603.485] (-602.894) (-602.104) * (-604.113) (-603.510) (-601.656) [-604.369] -- 0:00:30
      506000 -- (-602.358) (-603.339) (-602.306) [-604.386] * (-601.461) [-606.239] (-603.682) (-604.555) -- 0:00:30
      506500 -- (-603.865) [-601.223] (-605.123) (-602.422) * (-603.977) [-605.100] (-601.164) (-601.788) -- 0:00:30
      507000 -- (-602.747) [-607.941] (-606.585) (-603.526) * (-602.145) (-601.103) [-603.015] (-602.415) -- 0:00:30
      507500 -- (-602.127) (-602.417) (-600.950) [-603.547] * (-605.918) (-601.377) (-602.982) [-602.409] -- 0:00:30
      508000 -- (-601.928) [-603.104] (-603.197) (-604.469) * (-602.222) (-603.501) [-601.600] (-602.952) -- 0:00:30
      508500 -- (-604.403) (-600.879) [-603.582] (-602.653) * [-601.827] (-603.052) (-605.021) (-602.040) -- 0:00:29
      509000 -- (-601.958) (-601.238) [-606.009] (-601.520) * (-601.535) [-603.036] (-608.072) (-604.102) -- 0:00:29
      509500 -- (-602.089) (-604.371) (-606.033) [-601.534] * [-601.421] (-602.622) (-605.697) (-605.280) -- 0:00:29
      510000 -- (-602.515) [-603.835] (-602.543) (-601.326) * (-601.392) (-604.112) [-602.151] (-607.782) -- 0:00:29

      Average standard deviation of split frequencies: 0.012247

      510500 -- (-605.626) (-601.077) [-604.423] (-604.994) * (-601.658) (-605.160) (-604.116) [-605.502] -- 0:00:29
      511000 -- [-604.062] (-602.448) (-604.324) (-602.934) * (-603.306) (-604.407) (-601.895) [-603.255] -- 0:00:29
      511500 -- (-604.691) [-602.007] (-601.252) (-601.174) * (-602.894) [-603.867] (-603.052) (-602.413) -- 0:00:29
      512000 -- (-609.914) (-601.537) [-603.312] (-603.236) * (-602.823) (-605.353) (-603.768) [-605.101] -- 0:00:29
      512500 -- (-607.607) (-602.267) [-601.565] (-602.774) * (-603.040) (-602.660) (-605.044) [-602.373] -- 0:00:29
      513000 -- [-601.692] (-602.815) (-601.233) (-602.867) * (-602.583) [-601.785] (-601.659) (-604.577) -- 0:00:29
      513500 -- [-604.897] (-601.272) (-601.826) (-606.130) * (-601.280) [-602.798] (-605.561) (-601.913) -- 0:00:29
      514000 -- [-606.330] (-601.781) (-603.764) (-601.923) * [-602.031] (-603.956) (-603.886) (-603.620) -- 0:00:29
      514500 -- (-603.833) [-602.094] (-605.244) (-600.728) * [-601.704] (-603.607) (-603.118) (-601.549) -- 0:00:29
      515000 -- [-604.342] (-602.768) (-604.808) (-603.478) * (-603.164) [-601.540] (-603.019) (-604.185) -- 0:00:29

      Average standard deviation of split frequencies: 0.012059

      515500 -- (-601.070) (-603.265) (-602.152) [-601.227] * [-604.576] (-602.226) (-602.848) (-604.104) -- 0:00:29
      516000 -- [-601.717] (-602.990) (-601.550) (-602.672) * (-603.999) (-603.742) [-602.721] (-604.402) -- 0:00:29
      516500 -- (-603.369) [-602.686] (-602.064) (-601.425) * [-603.133] (-602.853) (-602.556) (-607.684) -- 0:00:29
      517000 -- (-607.229) (-601.243) [-602.425] (-604.012) * (-603.598) [-606.040] (-606.412) (-603.414) -- 0:00:28
      517500 -- (-606.096) [-601.814] (-605.159) (-603.675) * [-601.764] (-605.144) (-603.937) (-604.369) -- 0:00:28
      518000 -- (-602.886) (-603.305) (-605.881) [-601.779] * (-602.682) (-602.776) [-601.900] (-605.326) -- 0:00:28
      518500 -- (-605.139) [-604.770] (-601.942) (-603.959) * (-604.511) (-603.684) [-601.615] (-604.915) -- 0:00:28
      519000 -- (-606.069) (-604.023) (-604.784) [-604.933] * (-602.449) (-603.774) [-601.799] (-601.824) -- 0:00:28
      519500 -- (-603.533) [-603.892] (-602.027) (-603.359) * [-603.027] (-603.023) (-604.409) (-602.589) -- 0:00:28
      520000 -- [-601.470] (-606.714) (-601.958) (-603.022) * (-603.362) [-602.048] (-603.532) (-600.861) -- 0:00:28

      Average standard deviation of split frequencies: 0.012072

      520500 -- (-605.823) [-603.851] (-606.436) (-603.434) * (-602.327) [-603.807] (-606.729) (-607.379) -- 0:00:28
      521000 -- [-601.887] (-601.271) (-604.249) (-604.686) * (-602.325) [-604.813] (-602.513) (-609.182) -- 0:00:28
      521500 -- (-602.107) [-607.251] (-604.958) (-602.604) * [-604.557] (-603.000) (-600.944) (-604.784) -- 0:00:29
      522000 -- (-603.583) (-605.435) [-604.710] (-602.210) * (-604.408) [-601.918] (-601.174) (-604.736) -- 0:00:29
      522500 -- (-602.056) (-602.313) (-604.213) [-607.356] * (-601.051) (-601.192) [-601.963] (-604.600) -- 0:00:29
      523000 -- (-603.935) [-605.253] (-606.702) (-602.476) * [-602.310] (-602.940) (-601.904) (-601.256) -- 0:00:29
      523500 -- (-602.080) [-602.601] (-603.225) (-602.695) * (-601.157) (-601.921) (-602.379) [-602.698] -- 0:00:29
      524000 -- (-601.773) [-602.018] (-602.938) (-601.221) * (-603.708) (-602.452) [-607.857] (-607.420) -- 0:00:29
      524500 -- [-604.670] (-603.064) (-602.372) (-603.455) * (-602.964) (-602.455) [-601.893] (-603.417) -- 0:00:29
      525000 -- (-603.533) (-602.991) [-603.666] (-607.919) * (-608.013) (-602.637) (-601.967) [-602.662] -- 0:00:28

      Average standard deviation of split frequencies: 0.012155

      525500 -- (-605.756) (-601.709) [-602.770] (-602.757) * (-612.874) (-602.505) [-602.656] (-604.110) -- 0:00:28
      526000 -- (-603.357) [-600.864] (-605.192) (-603.920) * (-602.059) [-601.649] (-602.167) (-604.238) -- 0:00:28
      526500 -- (-601.055) (-601.470) [-602.415] (-601.893) * [-601.429] (-604.535) (-604.985) (-601.921) -- 0:00:28
      527000 -- [-605.330] (-606.356) (-604.584) (-601.919) * (-601.838) (-603.078) (-602.900) [-603.217] -- 0:00:28
      527500 -- [-602.732] (-602.808) (-603.685) (-605.074) * (-603.038) (-602.636) (-606.225) [-605.131] -- 0:00:28
      528000 -- (-603.487) [-604.656] (-601.784) (-600.879) * (-605.583) (-604.056) (-609.648) [-607.981] -- 0:00:28
      528500 -- (-601.689) (-601.289) [-602.461] (-601.608) * [-605.200] (-604.905) (-604.606) (-604.377) -- 0:00:28
      529000 -- (-605.764) (-604.113) (-603.146) [-601.643] * [-604.313] (-604.586) (-604.138) (-605.531) -- 0:00:28
      529500 -- (-602.372) (-603.284) [-604.665] (-601.959) * (-606.225) (-602.375) [-602.163] (-602.896) -- 0:00:28
      530000 -- [-601.071] (-603.468) (-601.256) (-605.062) * (-605.040) (-602.490) [-601.311] (-604.970) -- 0:00:28

      Average standard deviation of split frequencies: 0.011770

      530500 -- (-604.896) (-603.726) [-602.901] (-607.917) * (-602.488) (-603.101) [-602.476] (-601.440) -- 0:00:28
      531000 -- (-602.876) [-602.474] (-601.957) (-604.641) * [-606.767] (-603.461) (-601.704) (-604.968) -- 0:00:28
      531500 -- (-601.226) [-604.290] (-602.784) (-603.438) * (-605.421) (-605.682) (-604.431) [-603.961] -- 0:00:28
      532000 -- [-601.335] (-601.281) (-605.809) (-600.865) * (-605.508) [-604.914] (-601.103) (-603.168) -- 0:00:28
      532500 -- (-603.360) [-602.897] (-604.417) (-603.725) * [-605.283] (-606.762) (-604.119) (-601.483) -- 0:00:28
      533000 -- (-602.477) (-604.849) (-602.921) [-602.829] * (-604.871) (-604.293) (-601.516) [-603.803] -- 0:00:28
      533500 -- (-602.514) (-603.511) [-603.183] (-603.482) * (-605.622) (-603.347) (-601.711) [-602.422] -- 0:00:27
      534000 -- [-605.375] (-602.665) (-605.123) (-605.159) * (-602.634) [-605.617] (-604.684) (-601.768) -- 0:00:27
      534500 -- [-602.179] (-602.609) (-603.784) (-604.809) * (-603.585) (-602.032) [-603.315] (-603.399) -- 0:00:27
      535000 -- (-602.166) (-602.203) (-605.462) [-602.635] * (-603.770) (-602.358) (-603.704) [-601.970] -- 0:00:27

      Average standard deviation of split frequencies: 0.012698

      535500 -- (-604.585) (-603.527) [-601.129] (-603.108) * (-602.438) [-608.626] (-602.416) (-601.759) -- 0:00:27
      536000 -- (-605.756) (-603.195) [-601.550] (-603.697) * (-601.374) [-602.345] (-603.535) (-601.197) -- 0:00:27
      536500 -- (-603.117) [-604.300] (-602.005) (-604.282) * (-607.503) [-603.754] (-603.852) (-601.528) -- 0:00:27
      537000 -- (-602.642) [-604.201] (-602.992) (-603.160) * [-602.146] (-602.397) (-602.072) (-602.575) -- 0:00:27
      537500 -- (-603.547) (-602.501) (-601.719) [-603.758] * [-602.548] (-603.834) (-605.419) (-603.117) -- 0:00:27
      538000 -- (-602.758) (-606.190) (-602.825) [-601.235] * [-604.456] (-603.936) (-605.188) (-604.216) -- 0:00:28
      538500 -- (-607.589) [-603.309] (-603.016) (-601.939) * (-606.064) [-603.525] (-603.908) (-606.333) -- 0:00:28
      539000 -- (-604.299) (-603.230) (-603.904) [-605.214] * (-600.953) (-603.165) (-601.838) [-603.093] -- 0:00:28
      539500 -- (-601.184) (-601.842) [-603.313] (-605.942) * (-602.617) [-604.676] (-609.836) (-602.711) -- 0:00:28
      540000 -- (-602.468) (-605.611) [-604.118] (-604.491) * (-602.421) (-602.482) (-602.492) [-604.654] -- 0:00:28

      Average standard deviation of split frequencies: 0.012860

      540500 -- (-604.943) (-603.740) (-603.591) [-603.022] * (-601.713) (-602.897) (-602.890) [-601.822] -- 0:00:28
      541000 -- (-603.871) [-603.572] (-601.959) (-603.526) * (-602.188) [-603.964] (-604.710) (-601.495) -- 0:00:27
      541500 -- (-604.588) (-603.505) [-604.036] (-605.147) * (-606.029) [-605.534] (-603.843) (-602.942) -- 0:00:27
      542000 -- (-603.719) [-601.522] (-603.147) (-601.108) * [-605.239] (-601.697) (-603.197) (-602.291) -- 0:00:27
      542500 -- (-606.579) [-603.068] (-610.964) (-604.133) * [-603.896] (-602.416) (-607.411) (-603.078) -- 0:00:27
      543000 -- [-605.393] (-604.355) (-602.878) (-602.068) * (-603.060) (-601.937) (-604.405) [-601.421] -- 0:00:27
      543500 -- (-601.715) (-603.916) (-602.282) [-603.065] * (-606.224) (-602.364) (-602.203) [-601.185] -- 0:00:27
      544000 -- (-601.442) (-606.764) (-604.020) [-601.486] * (-601.604) (-603.272) (-605.757) [-602.793] -- 0:00:27
      544500 -- (-604.614) (-602.541) [-602.068] (-601.317) * (-601.463) [-601.014] (-604.290) (-605.286) -- 0:00:27
      545000 -- (-602.418) (-605.816) [-602.056] (-605.954) * (-601.146) (-601.410) [-603.581] (-604.499) -- 0:00:27

      Average standard deviation of split frequencies: 0.012544

      545500 -- (-602.692) [-603.059] (-601.816) (-604.970) * (-605.242) (-602.008) (-602.640) [-601.003] -- 0:00:27
      546000 -- [-602.162] (-604.185) (-602.357) (-604.232) * (-604.616) (-604.054) [-603.307] (-601.312) -- 0:00:27
      546500 -- [-601.885] (-602.874) (-602.395) (-602.766) * (-601.105) [-604.122] (-602.435) (-601.550) -- 0:00:27
      547000 -- (-602.261) [-602.548] (-607.671) (-605.918) * (-601.603) [-602.054] (-608.154) (-603.544) -- 0:00:27
      547500 -- (-601.589) (-603.824) [-606.925] (-602.709) * (-601.913) [-601.460] (-603.974) (-607.845) -- 0:00:27
      548000 -- [-603.035] (-603.992) (-602.054) (-604.803) * [-603.512] (-604.255) (-604.078) (-603.235) -- 0:00:27
      548500 -- (-602.525) [-601.280] (-602.271) (-603.204) * (-603.502) (-602.115) [-601.648] (-601.941) -- 0:00:27
      549000 -- [-603.408] (-601.819) (-602.872) (-604.786) * (-605.958) (-604.703) [-601.300] (-602.195) -- 0:00:27
      549500 -- (-604.534) (-601.987) (-603.868) [-604.491] * (-601.450) (-603.115) [-601.069] (-601.706) -- 0:00:27
      550000 -- (-604.455) (-602.777) [-601.642] (-608.073) * (-602.647) [-605.490] (-603.118) (-609.754) -- 0:00:27

      Average standard deviation of split frequencies: 0.012589

      550500 -- (-602.060) (-601.764) (-603.531) [-604.948] * (-604.844) (-608.081) [-601.005] (-604.125) -- 0:00:26
      551000 -- (-605.496) [-601.624] (-603.018) (-603.250) * (-602.222) (-606.726) (-601.450) [-601.787] -- 0:00:26
      551500 -- (-601.473) (-602.672) (-607.587) [-601.835] * (-602.292) (-603.966) (-602.518) [-602.862] -- 0:00:26
      552000 -- [-604.775] (-603.736) (-606.019) (-602.202) * [-604.849] (-601.066) (-601.685) (-606.930) -- 0:00:26
      552500 -- (-601.186) (-603.063) (-605.767) [-601.477] * (-602.382) (-601.951) [-601.953] (-605.938) -- 0:00:26
      553000 -- [-602.444] (-605.429) (-605.210) (-603.325) * (-601.237) (-604.330) [-601.811] (-601.400) -- 0:00:26
      553500 -- (-603.256) (-602.338) (-602.757) [-606.803] * [-601.609] (-601.328) (-602.925) (-603.371) -- 0:00:26
      554000 -- (-602.911) (-603.776) (-603.338) [-607.399] * (-603.086) (-603.639) [-602.690] (-601.813) -- 0:00:26
      554500 -- (-602.934) (-604.234) (-601.971) [-603.068] * (-603.426) (-601.773) (-602.514) [-604.674] -- 0:00:26
      555000 -- [-605.500] (-604.184) (-601.892) (-603.881) * [-603.708] (-602.095) (-604.454) (-604.105) -- 0:00:27

      Average standard deviation of split frequencies: 0.012867

      555500 -- [-601.857] (-602.631) (-601.872) (-603.942) * (-601.408) (-601.782) [-603.696] (-606.285) -- 0:00:27
      556000 -- (-608.585) (-605.978) (-602.936) [-602.484] * (-601.704) [-601.544] (-603.443) (-602.676) -- 0:00:27
      556500 -- (-604.281) [-604.875] (-602.154) (-604.907) * [-605.329] (-604.307) (-604.301) (-601.464) -- 0:00:27
      557000 -- [-601.388] (-605.623) (-602.375) (-603.217) * (-605.438) (-606.377) (-604.836) [-601.739] -- 0:00:27
      557500 -- (-601.061) [-606.507] (-602.887) (-605.542) * [-604.898] (-602.132) (-604.576) (-605.454) -- 0:00:26
      558000 -- (-603.524) (-602.823) [-601.869] (-601.453) * (-600.787) (-602.089) [-602.305] (-603.844) -- 0:00:26
      558500 -- (-602.706) [-602.529] (-603.716) (-604.241) * (-601.125) (-602.747) [-602.913] (-602.297) -- 0:00:26
      559000 -- (-601.588) [-604.418] (-603.551) (-605.232) * (-601.257) (-605.721) [-602.907] (-608.602) -- 0:00:26
      559500 -- [-603.251] (-601.520) (-605.975) (-602.813) * (-601.373) (-605.253) (-601.787) [-604.563] -- 0:00:26
      560000 -- (-602.140) (-605.104) (-605.844) [-605.007] * [-604.074] (-604.806) (-604.509) (-602.734) -- 0:00:26

      Average standard deviation of split frequencies: 0.012760

      560500 -- (-607.219) (-602.169) (-603.063) [-604.779] * (-601.709) [-601.708] (-602.400) (-607.844) -- 0:00:26
      561000 -- (-607.159) [-603.636] (-605.340) (-604.994) * (-601.594) [-601.761] (-607.194) (-603.733) -- 0:00:26
      561500 -- (-601.842) (-603.694) (-602.770) [-601.892] * (-602.816) [-601.815] (-603.344) (-603.844) -- 0:00:26
      562000 -- [-601.043] (-601.812) (-608.186) (-602.411) * (-603.733) (-602.657) (-603.886) [-602.608] -- 0:00:26
      562500 -- (-601.651) (-604.342) [-601.845] (-601.195) * [-601.295] (-604.464) (-604.670) (-605.197) -- 0:00:26
      563000 -- (-601.466) [-601.956] (-604.090) (-602.486) * (-601.203) (-605.195) (-603.101) [-602.873] -- 0:00:26
      563500 -- (-601.979) [-605.865] (-602.347) (-603.416) * [-603.684] (-602.909) (-604.285) (-601.385) -- 0:00:26
      564000 -- (-602.442) [-605.852] (-606.193) (-602.499) * [-602.075] (-608.099) (-605.371) (-601.665) -- 0:00:26
      564500 -- [-602.023] (-605.209) (-604.152) (-601.371) * [-604.039] (-601.943) (-604.831) (-602.790) -- 0:00:26
      565000 -- (-602.739) [-603.571] (-602.176) (-601.949) * (-606.644) [-602.157] (-601.644) (-602.889) -- 0:00:26

      Average standard deviation of split frequencies: 0.012447

      565500 -- (-603.431) (-607.306) [-602.390] (-603.942) * (-603.444) [-604.802] (-602.338) (-605.212) -- 0:00:26
      566000 -- (-604.879) (-603.417) [-602.961] (-603.035) * (-602.391) [-602.322] (-602.814) (-603.331) -- 0:00:26
      566500 -- (-603.789) (-602.868) [-603.844] (-603.355) * (-601.881) [-602.241] (-603.627) (-602.842) -- 0:00:26
      567000 -- (-605.535) [-603.239] (-601.108) (-602.961) * (-601.881) (-603.006) [-604.255] (-602.112) -- 0:00:25
      567500 -- [-601.897] (-602.206) (-602.394) (-603.471) * (-602.910) [-602.392] (-602.813) (-601.742) -- 0:00:25
      568000 -- (-603.339) (-601.897) [-603.283] (-603.415) * (-601.973) [-602.306] (-603.228) (-602.783) -- 0:00:25
      568500 -- (-602.281) (-603.994) (-603.706) [-603.016] * (-602.816) [-602.535] (-603.536) (-606.446) -- 0:00:25
      569000 -- (-608.616) (-603.569) [-604.760] (-603.340) * [-604.612] (-602.349) (-601.447) (-605.442) -- 0:00:25
      569500 -- (-604.979) (-601.911) [-602.121] (-600.857) * (-603.981) (-603.681) [-601.932] (-606.814) -- 0:00:25
      570000 -- (-601.935) (-604.781) (-601.179) [-602.529] * [-601.682] (-602.978) (-604.803) (-601.957) -- 0:00:25

      Average standard deviation of split frequencies: 0.012666

      570500 -- [-601.211] (-603.274) (-603.394) (-601.558) * [-603.787] (-603.305) (-601.937) (-603.028) -- 0:00:25
      571000 -- [-601.214] (-602.017) (-603.388) (-602.318) * (-603.516) (-605.334) [-601.529] (-604.970) -- 0:00:25
      571500 -- (-603.050) (-609.437) [-604.452] (-602.383) * [-602.000] (-606.087) (-605.204) (-605.324) -- 0:00:26
      572000 -- (-603.670) [-602.687] (-604.058) (-605.684) * (-602.791) (-606.270) (-604.902) [-602.280] -- 0:00:26
      572500 -- (-605.729) (-605.793) [-604.022] (-602.257) * [-602.288] (-601.534) (-605.188) (-605.955) -- 0:00:26
      573000 -- [-602.916] (-601.992) (-604.105) (-602.471) * (-602.778) (-605.625) (-601.720) [-605.016] -- 0:00:26
      573500 -- [-606.102] (-602.339) (-603.147) (-600.738) * (-607.289) (-602.137) [-603.740] (-602.096) -- 0:00:26
      574000 -- (-604.361) (-602.243) (-604.536) [-602.619] * (-605.689) [-601.347] (-603.015) (-604.520) -- 0:00:25
      574500 -- (-601.428) (-601.308) (-602.020) [-601.718] * [-602.510] (-603.955) (-603.964) (-604.630) -- 0:00:25
      575000 -- (-601.289) (-602.481) (-601.763) [-602.400] * (-605.377) (-601.888) [-601.139] (-604.108) -- 0:00:25

      Average standard deviation of split frequencies: 0.013004

      575500 -- (-602.567) (-603.867) [-603.579] (-603.204) * [-603.350] (-603.024) (-602.665) (-604.400) -- 0:00:25
      576000 -- (-603.104) [-604.156] (-602.768) (-610.432) * (-601.398) (-604.475) [-602.466] (-600.808) -- 0:00:25
      576500 -- (-604.399) (-603.722) [-602.487] (-604.137) * (-603.074) (-601.934) (-602.861) [-602.383] -- 0:00:25
      577000 -- [-602.467] (-605.972) (-602.668) (-604.548) * [-601.943] (-606.888) (-602.440) (-603.525) -- 0:00:25
      577500 -- [-603.053] (-607.444) (-602.247) (-605.068) * (-603.913) (-604.835) (-601.967) [-608.077] -- 0:00:25
      578000 -- (-601.516) [-601.480] (-605.467) (-604.921) * (-607.515) (-601.107) [-601.547] (-604.307) -- 0:00:25
      578500 -- [-602.424] (-608.062) (-602.736) (-601.085) * (-602.858) [-605.275] (-602.124) (-604.268) -- 0:00:25
      579000 -- (-604.640) (-603.692) (-603.626) [-601.207] * [-602.820] (-606.515) (-606.637) (-603.770) -- 0:00:25
      579500 -- (-604.009) (-601.512) [-602.758] (-602.146) * (-607.491) (-602.367) [-603.189] (-603.722) -- 0:00:25
      580000 -- (-604.901) (-602.046) (-603.600) [-604.986] * (-610.699) (-608.385) [-601.123] (-602.719) -- 0:00:25

      Average standard deviation of split frequencies: 0.012764

      580500 -- (-604.144) (-603.066) (-602.642) [-601.134] * (-607.785) (-601.157) [-601.828] (-601.065) -- 0:00:25
      581000 -- (-602.837) (-606.172) (-603.379) [-602.641] * [-605.758] (-601.272) (-601.036) (-602.771) -- 0:00:25
      581500 -- [-604.320] (-602.364) (-603.840) (-602.169) * (-602.601) [-601.344] (-602.298) (-603.734) -- 0:00:25
      582000 -- (-601.964) (-604.956) (-601.709) [-604.954] * (-602.233) [-602.790] (-605.369) (-603.634) -- 0:00:25
      582500 -- (-602.740) (-604.615) (-603.857) [-603.842] * (-603.745) [-602.493] (-606.040) (-602.703) -- 0:00:25
      583000 -- [-603.714] (-603.551) (-607.558) (-600.832) * (-604.527) [-603.295] (-602.411) (-602.932) -- 0:00:25
      583500 -- [-601.834] (-606.110) (-602.375) (-602.395) * (-606.952) [-602.428] (-605.883) (-602.907) -- 0:00:24
      584000 -- (-603.616) [-604.444] (-602.778) (-601.638) * (-606.250) [-601.972] (-603.164) (-601.548) -- 0:00:24
      584500 -- [-603.286] (-601.536) (-603.999) (-601.543) * (-608.673) (-601.795) (-600.983) [-602.819] -- 0:00:24
      585000 -- (-602.965) [-603.880] (-603.489) (-604.722) * (-607.010) (-602.491) (-602.123) [-603.477] -- 0:00:24

      Average standard deviation of split frequencies: 0.013095

      585500 -- [-602.054] (-602.494) (-604.464) (-600.708) * (-603.148) (-601.450) [-603.482] (-605.307) -- 0:00:24
      586000 -- (-603.725) (-605.892) (-605.907) [-600.726] * [-602.224] (-601.300) (-604.504) (-603.132) -- 0:00:24
      586500 -- [-603.217] (-603.227) (-602.199) (-604.081) * (-604.246) [-601.220] (-607.804) (-602.912) -- 0:00:24
      587000 -- (-602.585) (-603.281) [-602.386] (-602.748) * (-601.454) (-603.414) (-606.509) [-605.152] -- 0:00:24
      587500 -- (-602.244) (-605.207) [-603.559] (-601.669) * (-603.073) (-604.850) (-601.557) [-604.056] -- 0:00:24
      588000 -- [-607.326] (-601.544) (-601.687) (-601.428) * (-602.166) (-604.997) [-601.773] (-604.147) -- 0:00:24
      588500 -- (-605.084) (-602.513) [-603.928] (-605.038) * (-603.660) (-600.946) (-601.571) [-602.544] -- 0:00:24
      589000 -- [-604.444] (-603.036) (-601.412) (-605.748) * (-601.644) (-601.387) [-602.458] (-601.370) -- 0:00:25
      589500 -- [-603.709] (-603.446) (-603.676) (-607.037) * [-601.292] (-602.401) (-601.534) (-602.825) -- 0:00:25
      590000 -- (-603.597) [-601.001] (-604.082) (-602.782) * (-604.246) (-610.382) (-603.344) [-602.961] -- 0:00:25

      Average standard deviation of split frequencies: 0.013168

      590500 -- (-602.305) (-601.229) (-605.189) [-602.764] * (-601.543) (-608.387) [-602.017] (-602.481) -- 0:00:24
      591000 -- [-605.463] (-602.312) (-606.437) (-604.235) * (-602.118) (-602.164) (-604.432) [-602.558] -- 0:00:24
      591500 -- (-603.545) (-605.591) (-604.585) [-600.846] * (-602.170) (-603.907) (-603.393) [-601.938] -- 0:00:24
      592000 -- [-603.288] (-603.003) (-602.985) (-602.737) * (-602.319) [-603.549] (-603.063) (-603.743) -- 0:00:24
      592500 -- (-600.922) (-603.253) [-604.174] (-602.944) * [-603.872] (-603.777) (-601.963) (-605.022) -- 0:00:24
      593000 -- (-602.122) (-601.840) [-601.910] (-600.925) * (-601.373) (-603.247) [-602.298] (-604.223) -- 0:00:24
      593500 -- [-602.336] (-602.830) (-604.717) (-601.658) * [-606.080] (-602.927) (-601.569) (-601.365) -- 0:00:24
      594000 -- (-603.043) (-607.690) (-601.862) [-603.155] * [-603.573] (-604.030) (-603.967) (-601.206) -- 0:00:24
      594500 -- (-603.841) [-602.757] (-602.914) (-604.751) * (-604.357) (-604.554) (-601.395) [-601.773] -- 0:00:24
      595000 -- [-603.877] (-601.098) (-601.510) (-604.656) * (-604.199) (-601.794) (-603.743) [-603.304] -- 0:00:24

      Average standard deviation of split frequencies: 0.012479

      595500 -- [-604.887] (-601.179) (-604.842) (-601.230) * [-606.329] (-602.237) (-605.471) (-608.218) -- 0:00:24
      596000 -- (-602.770) (-601.144) (-606.784) [-601.745] * (-601.573) (-605.909) [-608.320] (-604.461) -- 0:00:24
      596500 -- (-605.233) [-603.992] (-605.620) (-601.651) * (-602.029) (-601.285) (-603.551) [-601.737] -- 0:00:24
      597000 -- (-603.937) (-601.748) [-603.039] (-602.260) * (-602.586) (-601.850) [-603.207] (-603.511) -- 0:00:24
      597500 -- (-604.519) (-604.579) [-604.486] (-601.661) * (-603.451) (-604.410) (-604.396) [-601.215] -- 0:00:24
      598000 -- (-603.760) (-602.342) [-601.254] (-601.663) * (-602.548) (-603.530) (-604.916) [-602.074] -- 0:00:24
      598500 -- (-602.024) (-604.075) (-601.851) [-603.502] * (-602.389) [-602.215] (-603.887) (-602.176) -- 0:00:24
      599000 -- (-602.442) (-602.458) (-602.047) [-604.915] * (-602.579) [-601.595] (-601.709) (-603.862) -- 0:00:24
      599500 -- [-601.644] (-603.183) (-601.389) (-604.045) * (-603.866) [-601.188] (-603.364) (-602.159) -- 0:00:24
      600000 -- [-604.185] (-606.320) (-603.511) (-607.579) * (-604.015) (-601.752) (-605.167) [-604.034] -- 0:00:24

      Average standard deviation of split frequencies: 0.012862

      600500 -- (-601.323) [-602.625] (-601.933) (-603.539) * (-603.476) (-603.362) (-602.550) [-603.265] -- 0:00:23
      601000 -- [-601.111] (-602.198) (-602.912) (-603.246) * (-601.621) [-603.198] (-600.890) (-602.857) -- 0:00:23
      601500 -- (-601.949) (-603.877) [-601.578] (-602.619) * (-602.035) (-604.884) [-602.996] (-601.860) -- 0:00:23
      602000 -- [-602.796] (-605.429) (-601.967) (-603.779) * [-602.511] (-604.096) (-604.229) (-603.155) -- 0:00:23
      602500 -- (-603.433) (-606.972) [-602.983] (-607.852) * (-601.212) [-603.057] (-602.474) (-604.155) -- 0:00:23
      603000 -- (-605.941) (-602.614) [-601.480] (-601.374) * (-603.985) (-602.257) (-607.523) [-603.977] -- 0:00:23
      603500 -- (-601.677) (-603.303) (-600.942) [-602.494] * [-600.798] (-602.920) (-604.973) (-604.778) -- 0:00:23
      604000 -- [-601.640] (-602.081) (-602.491) (-605.530) * (-606.121) (-606.665) (-603.846) [-605.443] -- 0:00:23
      604500 -- (-601.943) [-602.159] (-604.833) (-604.678) * [-601.977] (-606.437) (-604.985) (-600.966) -- 0:00:23
      605000 -- [-602.036] (-602.727) (-602.920) (-601.613) * (-601.133) [-602.220] (-600.719) (-603.152) -- 0:00:23

      Average standard deviation of split frequencies: 0.013051

      605500 -- [-603.456] (-603.144) (-604.045) (-605.603) * (-603.043) [-605.033] (-602.574) (-601.200) -- 0:00:24
      606000 -- [-602.209] (-606.818) (-604.161) (-603.661) * (-605.454) (-601.852) (-603.723) [-603.187] -- 0:00:24
      606500 -- (-602.381) (-602.395) (-608.386) [-605.736] * (-603.878) (-602.266) (-606.200) [-601.799] -- 0:00:24
      607000 -- (-604.061) (-602.360) (-604.673) [-602.142] * (-605.562) [-603.073] (-604.148) (-601.302) -- 0:00:23
      607500 -- (-604.018) (-602.982) (-601.797) [-602.251] * (-601.768) (-604.878) [-601.560] (-602.117) -- 0:00:23
      608000 -- (-602.969) (-604.007) (-603.131) [-601.839] * (-603.177) (-604.037) (-605.039) [-609.696] -- 0:00:23
      608500 -- (-603.016) (-603.515) [-603.128] (-602.197) * (-604.074) [-607.193] (-601.902) (-601.999) -- 0:00:23
      609000 -- (-603.278) (-601.895) [-603.486] (-605.002) * (-604.436) [-601.942] (-604.897) (-602.732) -- 0:00:23
      609500 -- [-602.889] (-602.995) (-602.864) (-600.934) * [-604.163] (-603.328) (-603.125) (-600.790) -- 0:00:23
      610000 -- (-602.658) (-600.845) (-603.539) [-604.543] * (-604.782) (-603.403) (-602.887) [-601.393] -- 0:00:23

      Average standard deviation of split frequencies: 0.012609

      610500 -- (-605.768) (-604.995) [-602.161] (-604.643) * (-607.623) [-602.069] (-601.429) (-602.380) -- 0:00:23
      611000 -- (-604.825) (-602.490) [-600.937] (-602.323) * (-603.026) [-602.435] (-605.640) (-604.008) -- 0:00:23
      611500 -- (-603.963) (-602.432) [-602.590] (-602.274) * (-603.099) (-606.015) (-603.202) [-602.576] -- 0:00:23
      612000 -- [-601.026] (-603.960) (-602.473) (-602.728) * (-604.791) [-601.791] (-604.257) (-604.254) -- 0:00:23
      612500 -- (-606.472) [-602.717] (-604.644) (-602.142) * [-601.417] (-602.494) (-603.741) (-602.813) -- 0:00:23
      613000 -- [-605.666] (-601.531) (-612.864) (-602.299) * [-601.023] (-605.313) (-602.055) (-602.229) -- 0:00:23
      613500 -- (-604.092) (-604.780) (-606.560) [-602.643] * (-601.481) (-608.225) (-601.874) [-601.375] -- 0:00:23
      614000 -- [-600.936] (-602.667) (-605.256) (-602.618) * (-601.100) (-601.945) (-602.085) [-601.632] -- 0:00:23
      614500 -- (-601.923) (-605.008) [-604.096] (-602.496) * (-602.257) (-605.030) (-603.920) [-601.790] -- 0:00:23
      615000 -- (-606.314) (-601.687) (-602.969) [-601.599] * [-604.243] (-604.019) (-603.550) (-604.594) -- 0:00:23

      Average standard deviation of split frequencies: 0.012797

      615500 -- (-603.089) (-602.830) (-605.165) [-602.262] * (-601.418) [-603.973] (-607.585) (-603.016) -- 0:00:23
      616000 -- (-602.142) (-602.751) (-602.983) [-602.972] * (-602.258) (-601.929) (-603.933) [-601.796] -- 0:00:23
      616500 -- (-604.579) [-602.555] (-603.076) (-602.527) * [-601.860] (-602.130) (-601.532) (-601.356) -- 0:00:23
      617000 -- (-605.285) (-604.120) [-601.974] (-603.924) * (-602.065) [-601.595] (-601.735) (-603.161) -- 0:00:22
      617500 -- (-603.639) (-608.170) (-601.686) [-604.720] * (-601.236) (-601.615) [-602.913] (-601.223) -- 0:00:22
      618000 -- (-605.324) [-602.901] (-601.732) (-602.858) * [-601.201] (-600.878) (-601.869) (-602.651) -- 0:00:22
      618500 -- (-603.155) (-603.515) [-605.246] (-602.341) * [-601.605] (-602.549) (-601.838) (-604.580) -- 0:00:22
      619000 -- (-602.539) [-603.844] (-605.543) (-602.896) * (-605.480) (-601.271) (-601.852) [-604.041] -- 0:00:22
      619500 -- (-603.640) [-604.878] (-602.809) (-601.775) * [-604.193] (-603.875) (-605.225) (-603.662) -- 0:00:22
      620000 -- [-604.148] (-601.572) (-601.874) (-602.885) * (-603.683) [-603.612] (-605.387) (-601.678) -- 0:00:22

      Average standard deviation of split frequencies: 0.012867

      620500 -- (-603.776) (-602.861) (-605.541) [-602.894] * (-603.725) (-601.736) [-602.145] (-602.542) -- 0:00:22
      621000 -- (-603.450) (-602.108) (-611.921) [-602.246] * (-606.149) (-603.360) [-601.536] (-604.714) -- 0:00:22
      621500 -- (-606.505) [-608.835] (-605.376) (-603.302) * (-602.171) (-604.606) [-602.298] (-601.157) -- 0:00:22
      622000 -- [-603.971] (-606.750) (-610.701) (-603.833) * (-603.147) [-603.952] (-602.825) (-602.994) -- 0:00:22
      622500 -- (-603.170) [-602.542] (-608.012) (-601.653) * [-601.881] (-602.545) (-601.353) (-603.115) -- 0:00:23
      623000 -- (-605.370) [-601.133] (-602.458) (-605.253) * (-604.813) [-603.555] (-601.101) (-608.459) -- 0:00:22
      623500 -- (-608.723) (-601.189) [-603.872] (-601.600) * (-605.217) (-605.964) (-603.319) [-602.707] -- 0:00:22
      624000 -- (-602.577) (-602.146) (-606.714) [-604.279] * [-602.537] (-602.052) (-602.859) (-601.992) -- 0:00:22
      624500 -- (-603.421) [-604.943] (-603.783) (-605.933) * (-602.305) [-602.261] (-602.065) (-604.919) -- 0:00:22
      625000 -- (-605.111) (-603.207) [-603.955] (-604.966) * (-604.359) (-607.441) (-604.724) [-604.655] -- 0:00:22

      Average standard deviation of split frequencies: 0.012713

      625500 -- (-603.406) [-601.861] (-604.559) (-604.148) * (-602.554) (-605.450) [-602.619] (-604.854) -- 0:00:22
      626000 -- (-601.954) [-605.944] (-604.410) (-602.959) * [-602.255] (-603.190) (-605.886) (-603.794) -- 0:00:22
      626500 -- (-602.927) (-603.401) [-601.305] (-603.547) * [-604.043] (-603.134) (-603.641) (-602.418) -- 0:00:22
      627000 -- [-603.061] (-603.128) (-602.701) (-606.548) * [-604.159] (-602.671) (-601.256) (-603.192) -- 0:00:22
      627500 -- (-606.744) (-602.800) [-602.377] (-603.131) * (-603.198) [-603.462] (-602.671) (-602.603) -- 0:00:22
      628000 -- (-606.699) (-602.464) (-601.083) [-601.699] * (-604.936) (-603.813) [-603.401] (-604.427) -- 0:00:22
      628500 -- (-603.291) (-602.686) (-602.023) [-602.746] * (-605.875) (-604.234) (-602.161) [-602.166] -- 0:00:22
      629000 -- [-602.999] (-604.454) (-602.572) (-602.986) * (-603.395) (-605.329) [-604.300] (-601.562) -- 0:00:22
      629500 -- (-603.532) [-602.720] (-604.669) (-600.884) * (-605.298) [-606.083] (-604.435) (-601.638) -- 0:00:22
      630000 -- (-601.297) (-602.342) (-603.361) [-602.324] * (-605.952) [-605.035] (-601.333) (-605.288) -- 0:00:22

      Average standard deviation of split frequencies: 0.012091

      630500 -- [-603.067] (-602.554) (-606.095) (-603.275) * (-602.597) (-605.373) [-602.805] (-605.644) -- 0:00:22
      631000 -- (-601.810) (-602.089) [-601.892] (-604.452) * (-603.872) [-601.948] (-602.993) (-602.682) -- 0:00:22
      631500 -- (-604.266) (-609.890) [-606.448] (-606.155) * (-606.157) (-602.081) (-602.483) [-600.832] -- 0:00:22
      632000 -- (-602.388) (-603.086) (-605.587) [-604.437] * (-603.321) (-601.907) (-602.677) [-601.920] -- 0:00:22
      632500 -- [-601.626] (-601.246) (-606.547) (-612.373) * (-602.904) (-602.363) (-606.136) [-601.286] -- 0:00:22
      633000 -- (-604.388) (-601.692) [-605.468] (-600.916) * (-604.646) (-601.539) (-603.588) [-601.938] -- 0:00:22
      633500 -- [-605.982] (-601.803) (-602.555) (-601.868) * (-603.712) (-602.094) (-603.233) [-603.374] -- 0:00:21
      634000 -- (-604.060) (-609.028) (-602.266) [-602.589] * (-604.415) (-602.718) (-602.679) [-602.983] -- 0:00:21
      634500 -- [-602.654] (-603.436) (-604.066) (-602.731) * [-603.074] (-604.305) (-606.296) (-604.494) -- 0:00:21
      635000 -- [-602.668] (-604.956) (-602.240) (-602.841) * (-604.080) (-605.022) (-605.505) [-602.632] -- 0:00:21

      Average standard deviation of split frequencies: 0.012426

      635500 -- [-603.041] (-607.056) (-603.101) (-604.487) * (-602.436) [-601.487] (-601.811) (-602.565) -- 0:00:21
      636000 -- (-602.420) (-604.960) (-601.561) [-607.396] * (-604.964) (-605.595) (-602.233) [-604.772] -- 0:00:21
      636500 -- (-602.186) [-602.944] (-601.603) (-601.988) * (-606.160) [-601.717] (-601.194) (-603.296) -- 0:00:21
      637000 -- (-602.141) (-602.063) [-601.983] (-602.961) * (-603.880) (-604.299) (-602.343) [-603.098] -- 0:00:21
      637500 -- (-608.846) (-606.035) (-602.033) [-605.978] * [-602.227] (-604.915) (-603.233) (-609.277) -- 0:00:21
      638000 -- [-603.412] (-603.952) (-602.455) (-601.890) * (-601.715) (-603.070) [-602.704] (-602.209) -- 0:00:21
      638500 -- (-601.460) (-600.899) (-603.173) [-601.874] * (-602.428) (-601.512) (-602.886) [-605.442] -- 0:00:21
      639000 -- (-602.119) (-604.504) (-603.303) [-601.963] * (-609.243) (-602.677) [-602.626] (-603.907) -- 0:00:21
      639500 -- (-606.125) (-602.142) [-602.536] (-602.275) * (-602.216) (-602.285) [-602.081] (-604.733) -- 0:00:21
      640000 -- [-603.087] (-603.001) (-604.532) (-602.061) * (-603.853) [-602.625] (-603.668) (-602.924) -- 0:00:21

      Average standard deviation of split frequencies: 0.012336

      640500 -- [-602.375] (-601.046) (-601.557) (-604.278) * (-604.293) (-605.974) (-604.755) [-605.360] -- 0:00:21
      641000 -- (-601.592) (-604.543) (-607.080) [-601.650] * (-603.840) (-607.394) [-604.544] (-602.968) -- 0:00:21
      641500 -- (-605.417) (-604.540) (-604.500) [-601.581] * (-602.634) (-611.374) (-609.790) [-604.291] -- 0:00:21
      642000 -- (-602.757) (-602.348) (-602.981) [-602.436] * [-606.544] (-602.362) (-604.101) (-601.546) -- 0:00:21
      642500 -- (-602.733) (-604.541) (-602.754) [-601.275] * (-608.760) [-601.792] (-603.766) (-602.782) -- 0:00:21
      643000 -- [-601.377] (-602.499) (-604.639) (-603.060) * (-602.239) [-602.423] (-603.803) (-604.054) -- 0:00:21
      643500 -- [-604.420] (-604.275) (-604.318) (-603.802) * (-602.505) (-606.449) (-602.994) [-601.750] -- 0:00:21
      644000 -- [-601.756] (-601.224) (-604.372) (-602.085) * (-602.099) [-602.639] (-602.441) (-602.782) -- 0:00:21
      644500 -- (-602.791) (-602.942) (-603.861) [-601.745] * (-607.750) [-601.697] (-603.725) (-601.556) -- 0:00:21
      645000 -- (-602.824) (-601.192) [-601.647] (-604.711) * (-602.516) [-604.200] (-603.200) (-602.212) -- 0:00:21

      Average standard deviation of split frequencies: 0.012062

      645500 -- [-602.290] (-602.049) (-602.842) (-603.076) * (-602.878) (-602.488) (-603.079) [-603.785] -- 0:00:21
      646000 -- (-602.526) (-601.691) [-602.024] (-604.534) * (-601.622) (-605.423) [-603.994] (-605.424) -- 0:00:21
      646500 -- (-602.174) (-603.423) [-600.950] (-603.541) * (-602.033) (-603.159) [-603.884] (-605.860) -- 0:00:21
      647000 -- (-603.034) (-603.702) (-602.725) [-605.096] * (-608.953) (-608.495) [-603.417] (-601.466) -- 0:00:21
      647500 -- (-601.948) (-603.524) [-604.278] (-603.044) * (-607.009) (-607.169) [-602.126] (-605.742) -- 0:00:21
      648000 -- (-602.179) (-604.493) [-602.590] (-605.737) * (-603.145) [-606.310] (-601.873) (-602.819) -- 0:00:21
      648500 -- (-602.090) (-606.223) [-601.407] (-605.616) * (-602.603) (-605.452) [-602.573] (-610.512) -- 0:00:21
      649000 -- (-601.507) (-608.015) [-607.842] (-602.774) * (-604.461) (-605.710) (-604.327) [-605.829] -- 0:00:21
      649500 -- [-603.527] (-607.216) (-603.481) (-604.812) * (-604.543) [-601.188] (-603.514) (-609.773) -- 0:00:21
      650000 -- [-603.955] (-603.527) (-604.415) (-601.850) * (-602.731) (-604.520) (-604.752) [-602.282] -- 0:00:21

      Average standard deviation of split frequencies: 0.011379

      650500 -- (-603.020) (-603.707) (-602.931) [-602.181] * (-602.055) [-601.870] (-608.644) (-602.107) -- 0:00:20
      651000 -- (-602.510) (-606.111) [-604.462] (-604.823) * (-602.029) (-601.897) (-606.047) [-600.907] -- 0:00:20
      651500 -- (-606.166) (-607.967) [-606.232] (-603.634) * (-606.140) (-603.456) [-606.776] (-602.915) -- 0:00:20
      652000 -- (-602.351) (-603.185) [-606.217] (-601.272) * [-602.044] (-602.827) (-604.424) (-602.381) -- 0:00:20
      652500 -- (-604.507) [-604.231] (-603.113) (-601.734) * (-603.634) (-602.882) (-602.507) [-603.041] -- 0:00:20
      653000 -- (-602.228) (-603.959) (-603.203) [-602.446] * [-602.024] (-603.998) (-602.832) (-604.948) -- 0:00:20
      653500 -- (-602.081) (-606.241) (-603.211) [-602.980] * (-604.483) (-602.254) (-604.570) [-601.427] -- 0:00:20
      654000 -- (-601.087) (-601.686) [-601.706] (-601.818) * (-602.851) [-601.930] (-601.159) (-604.672) -- 0:00:20
      654500 -- [-602.342] (-604.294) (-601.578) (-603.345) * (-604.065) (-602.954) (-601.830) [-602.432] -- 0:00:20
      655000 -- (-603.289) (-604.319) (-601.956) [-603.417] * (-603.639) (-603.464) [-602.226] (-602.612) -- 0:00:20

      Average standard deviation of split frequencies: 0.011033

      655500 -- (-604.004) (-603.100) [-601.767] (-602.770) * (-603.886) (-601.343) [-603.343] (-601.757) -- 0:00:20
      656000 -- (-602.893) [-603.472] (-602.547) (-602.771) * (-603.765) (-602.270) (-603.583) [-600.885] -- 0:00:20
      656500 -- (-606.812) (-606.901) [-603.674] (-602.277) * [-601.770] (-604.246) (-601.762) (-602.650) -- 0:00:20
      657000 -- (-603.155) (-604.901) [-604.529] (-603.170) * (-601.164) (-603.812) [-603.280] (-604.941) -- 0:00:20
      657500 -- (-602.798) (-603.710) (-606.914) [-602.165] * (-601.283) (-606.243) [-602.366] (-606.362) -- 0:00:20
      658000 -- (-602.710) (-604.461) [-601.276] (-601.650) * (-602.183) [-602.119] (-603.551) (-602.571) -- 0:00:20
      658500 -- (-603.171) (-602.256) [-605.527] (-601.495) * (-601.412) (-601.813) (-602.529) [-604.411] -- 0:00:20
      659000 -- (-605.461) (-613.537) [-602.617] (-603.474) * (-601.249) [-603.388] (-601.023) (-602.701) -- 0:00:20
      659500 -- [-602.786] (-603.974) (-602.303) (-606.810) * (-600.951) (-602.707) (-604.888) [-604.228] -- 0:00:20
      660000 -- [-603.849] (-605.860) (-602.499) (-603.202) * (-601.923) [-601.403] (-602.706) (-607.687) -- 0:00:20

      Average standard deviation of split frequencies: 0.011081

      660500 -- (-604.223) [-603.611] (-604.267) (-603.567) * [-607.913] (-601.941) (-602.940) (-607.478) -- 0:00:20
      661000 -- (-602.403) [-608.235] (-603.250) (-600.999) * [-604.141] (-601.820) (-606.239) (-604.578) -- 0:00:20
      661500 -- [-601.853] (-608.886) (-604.996) (-602.910) * (-606.270) [-603.389] (-604.611) (-606.915) -- 0:00:20
      662000 -- [-602.293] (-602.213) (-601.516) (-603.240) * (-605.417) [-602.376] (-601.064) (-603.422) -- 0:00:20
      662500 -- (-603.768) (-601.299) (-601.298) [-606.239] * (-605.320) (-603.995) [-601.548] (-601.317) -- 0:00:20
      663000 -- (-603.360) [-602.806] (-601.813) (-602.833) * [-606.766] (-602.959) (-603.399) (-601.654) -- 0:00:20
      663500 -- (-603.744) (-603.101) (-600.999) [-602.410] * (-603.153) (-605.852) [-605.160] (-601.984) -- 0:00:20
      664000 -- (-603.696) (-602.846) (-602.064) [-603.632] * [-607.323] (-607.458) (-605.984) (-605.654) -- 0:00:20
      664500 -- (-603.101) [-605.518] (-603.484) (-604.243) * (-603.350) (-604.506) [-602.510] (-600.961) -- 0:00:20
      665000 -- [-602.401] (-603.636) (-602.997) (-603.343) * (-602.749) (-602.995) [-601.507] (-605.973) -- 0:00:20

      Average standard deviation of split frequencies: 0.011075

      665500 -- (-601.670) (-603.327) [-600.965] (-604.426) * (-604.237) (-603.569) [-603.107] (-607.491) -- 0:00:20
      666000 -- [-601.966] (-605.249) (-601.765) (-603.137) * (-603.652) (-602.300) [-601.626] (-603.818) -- 0:00:20
      666500 -- (-605.375) (-610.912) [-601.016] (-605.633) * (-607.778) [-603.959] (-604.517) (-604.751) -- 0:00:20
      667000 -- (-602.652) (-603.423) [-604.626] (-604.802) * [-602.592] (-604.565) (-604.979) (-601.723) -- 0:00:19
      667500 -- [-601.620] (-603.272) (-604.911) (-600.841) * (-603.096) (-601.387) (-601.779) [-603.593] -- 0:00:19
      668000 -- [-604.005] (-602.277) (-605.103) (-604.289) * [-604.302] (-604.656) (-601.298) (-602.335) -- 0:00:19
      668500 -- (-605.867) (-601.443) [-602.087] (-601.297) * (-601.728) (-603.564) (-603.940) [-602.062] -- 0:00:19
      669000 -- [-602.207] (-601.730) (-603.375) (-605.501) * (-602.365) (-601.450) [-603.885] (-605.399) -- 0:00:19
      669500 -- (-602.978) (-602.927) (-602.208) [-603.454] * [-604.625] (-601.452) (-606.706) (-602.089) -- 0:00:19
      670000 -- (-604.866) [-600.856] (-602.511) (-602.346) * (-601.292) (-601.102) [-601.435] (-605.483) -- 0:00:19

      Average standard deviation of split frequencies: 0.010915

      670500 -- (-603.756) (-602.705) [-609.088] (-601.688) * [-603.691] (-607.303) (-601.905) (-606.977) -- 0:00:19
      671000 -- (-601.730) (-602.694) [-605.711] (-602.583) * (-606.588) [-604.681] (-601.600) (-601.248) -- 0:00:19
      671500 -- [-602.820] (-602.711) (-606.388) (-603.841) * (-608.147) (-606.761) [-601.697] (-603.001) -- 0:00:19
      672000 -- (-604.747) [-600.790] (-603.818) (-603.365) * (-603.223) (-612.584) (-600.809) [-602.273] -- 0:00:19
      672500 -- (-601.926) (-602.080) (-603.198) [-601.630] * [-603.218] (-604.422) (-602.727) (-602.495) -- 0:00:19
      673000 -- (-605.467) (-602.512) (-602.921) [-602.960] * [-605.480] (-605.516) (-601.060) (-604.432) -- 0:00:19
      673500 -- (-602.168) [-602.339] (-603.720) (-600.981) * (-603.520) (-603.753) (-601.080) [-603.677] -- 0:00:19
      674000 -- (-602.108) (-601.433) [-602.128] (-604.123) * (-606.349) [-604.447] (-601.772) (-605.139) -- 0:00:19
      674500 -- (-602.561) (-601.790) (-602.579) [-602.206] * [-601.640] (-601.719) (-604.099) (-604.329) -- 0:00:19
      675000 -- (-605.452) [-602.780] (-602.904) (-602.000) * (-602.606) (-604.644) (-602.954) [-603.077] -- 0:00:19

      Average standard deviation of split frequencies: 0.010419

      675500 -- [-603.538] (-603.738) (-602.902) (-608.383) * (-602.647) (-609.957) (-601.877) [-602.514] -- 0:00:19
      676000 -- (-604.805) (-602.117) (-607.214) [-603.428] * (-603.514) [-601.620] (-601.488) (-602.708) -- 0:00:19
      676500 -- (-601.679) (-604.876) [-601.648] (-606.200) * (-601.785) (-601.778) [-602.845] (-601.014) -- 0:00:19
      677000 -- (-602.206) [-602.413] (-602.845) (-601.817) * (-601.916) (-602.013) (-601.482) [-606.604] -- 0:00:19
      677500 -- (-601.644) [-603.650] (-605.860) (-604.217) * (-603.309) (-602.512) (-601.515) [-609.387] -- 0:00:19
      678000 -- [-603.199] (-603.227) (-602.951) (-604.223) * (-602.805) (-602.092) (-602.735) [-602.252] -- 0:00:19
      678500 -- [-603.077] (-603.873) (-603.195) (-604.415) * (-601.637) (-603.093) [-601.851] (-605.218) -- 0:00:19
      679000 -- (-603.786) (-603.838) (-602.305) [-605.101] * (-602.370) (-605.201) [-602.027] (-604.011) -- 0:00:19
      679500 -- [-602.610] (-601.650) (-601.724) (-606.657) * [-603.856] (-604.121) (-606.533) (-604.386) -- 0:00:19
      680000 -- (-604.632) (-606.288) (-602.101) [-602.307] * (-603.631) (-602.160) [-601.654] (-603.477) -- 0:00:19

      Average standard deviation of split frequencies: 0.010691

      680500 -- (-602.411) (-605.566) (-603.719) [-601.162] * (-604.104) (-602.584) [-602.223] (-605.890) -- 0:00:19
      681000 -- (-605.841) [-604.327] (-602.182) (-601.788) * (-603.346) (-604.517) (-602.458) [-601.160] -- 0:00:19
      681500 -- [-603.193] (-601.636) (-601.431) (-605.388) * (-602.984) [-604.509] (-603.191) (-607.120) -- 0:00:19
      682000 -- [-605.145] (-605.336) (-601.754) (-602.890) * (-600.903) (-602.055) [-602.284] (-602.632) -- 0:00:19
      682500 -- (-608.042) (-605.308) [-600.968] (-607.532) * (-605.328) [-602.643] (-604.671) (-606.042) -- 0:00:19
      683000 -- [-602.201] (-604.785) (-602.943) (-605.157) * (-608.229) (-601.723) (-603.175) [-607.556] -- 0:00:19
      683500 -- (-608.330) (-602.300) [-606.866] (-603.793) * [-603.697] (-604.733) (-603.603) (-605.636) -- 0:00:18
      684000 -- [-605.321] (-604.358) (-605.006) (-602.375) * (-602.996) (-602.672) (-602.759) [-601.173] -- 0:00:18
      684500 -- (-602.361) (-600.859) (-605.059) [-602.769] * (-601.649) [-600.884] (-604.086) (-604.612) -- 0:00:18
      685000 -- (-604.045) [-603.046] (-605.473) (-606.678) * (-603.988) (-605.417) [-601.017] (-603.998) -- 0:00:18

      Average standard deviation of split frequencies: 0.011318

      685500 -- (-604.835) (-603.976) [-601.868] (-605.876) * (-602.833) [-602.497] (-605.985) (-606.380) -- 0:00:18
      686000 -- (-604.700) [-602.617] (-601.563) (-603.701) * (-602.848) (-600.796) [-603.402] (-601.779) -- 0:00:18
      686500 -- (-605.034) (-601.568) (-602.816) [-606.945] * (-603.237) (-603.038) (-604.127) [-605.519] -- 0:00:18
      687000 -- [-602.206] (-601.675) (-605.171) (-605.886) * (-603.079) (-601.500) [-602.183] (-601.900) -- 0:00:18
      687500 -- (-601.485) (-604.127) (-605.061) [-605.010] * (-605.734) (-605.056) [-600.844] (-602.882) -- 0:00:18
      688000 -- (-606.527) (-603.981) (-605.272) [-601.870] * [-603.758] (-602.985) (-605.303) (-600.890) -- 0:00:18
      688500 -- (-606.642) (-601.994) (-606.060) [-601.327] * [-604.753] (-602.820) (-603.478) (-604.079) -- 0:00:18
      689000 -- (-601.990) (-603.442) (-605.546) [-601.121] * (-602.343) (-605.324) (-605.189) [-602.324] -- 0:00:18
      689500 -- (-602.398) (-605.481) [-604.831] (-602.473) * [-602.526] (-602.012) (-610.746) (-603.056) -- 0:00:18
      690000 -- (-604.130) (-606.041) (-602.944) [-600.873] * (-606.058) (-602.431) (-605.508) [-604.042] -- 0:00:18

      Average standard deviation of split frequencies: 0.011006

      690500 -- [-601.493] (-603.485) (-602.758) (-603.449) * [-602.374] (-602.108) (-603.602) (-600.900) -- 0:00:18
      691000 -- (-602.311) [-603.060] (-604.958) (-603.724) * (-604.502) (-604.625) [-601.437] (-602.849) -- 0:00:18
      691500 -- (-603.436) (-602.084) (-603.689) [-604.570] * (-604.636) (-608.325) [-601.161] (-601.045) -- 0:00:18
      692000 -- [-602.356] (-605.879) (-603.523) (-602.874) * (-605.030) (-604.012) [-601.804] (-602.089) -- 0:00:18
      692500 -- [-604.927] (-603.488) (-603.804) (-602.869) * (-609.367) [-601.557] (-608.876) (-601.614) -- 0:00:18
      693000 -- (-604.848) (-602.478) (-601.788) [-602.696] * (-604.076) [-601.527] (-604.932) (-602.276) -- 0:00:18
      693500 -- (-603.218) (-601.816) [-601.392] (-603.625) * (-605.686) [-601.508] (-602.337) (-603.813) -- 0:00:18
      694000 -- [-603.529] (-602.856) (-601.515) (-603.519) * [-602.393] (-603.379) (-605.848) (-604.141) -- 0:00:18
      694500 -- (-604.172) (-604.533) [-603.318] (-603.433) * (-602.636) (-602.090) (-605.322) [-604.503] -- 0:00:18
      695000 -- (-603.239) (-603.916) (-602.210) [-603.712] * (-602.500) (-606.320) (-603.283) [-606.183] -- 0:00:18

      Average standard deviation of split frequencies: 0.011006

      695500 -- [-604.969] (-603.683) (-602.837) (-603.442) * [-601.550] (-603.628) (-604.273) (-606.016) -- 0:00:18
      696000 -- (-604.756) (-602.018) [-601.893] (-602.887) * (-605.265) [-606.363] (-608.059) (-605.303) -- 0:00:18
      696500 -- [-603.684] (-602.639) (-601.134) (-601.711) * (-604.567) (-603.500) [-602.533] (-601.644) -- 0:00:18
      697000 -- (-602.994) (-604.937) [-601.072] (-605.598) * [-602.122] (-605.753) (-605.042) (-603.570) -- 0:00:18
      697500 -- (-602.616) (-605.034) (-602.155) [-602.988] * (-605.669) (-603.116) [-605.496] (-603.577) -- 0:00:18
      698000 -- (-601.445) (-605.462) [-602.648] (-602.039) * (-601.118) (-602.854) (-603.326) [-603.573] -- 0:00:18
      698500 -- (-602.019) (-606.957) (-601.655) [-601.487] * (-601.408) (-606.278) (-603.346) [-607.871] -- 0:00:18
      699000 -- (-604.722) [-603.612] (-603.164) (-601.718) * (-601.017) (-603.325) [-603.452] (-601.773) -- 0:00:18
      699500 -- (-601.520) (-601.104) [-603.324] (-603.207) * (-601.551) (-603.813) (-602.658) [-601.019] -- 0:00:18
      700000 -- (-602.615) (-600.959) [-602.851] (-602.040) * (-604.844) [-601.981] (-602.123) (-607.264) -- 0:00:18

      Average standard deviation of split frequencies: 0.011269

      700500 -- (-606.097) [-602.251] (-605.263) (-601.715) * (-603.189) (-602.616) [-601.536] (-602.988) -- 0:00:17
      701000 -- (-602.736) (-602.633) [-604.920] (-604.572) * [-601.026] (-603.774) (-602.415) (-602.267) -- 0:00:17
      701500 -- (-602.270) (-604.529) (-602.369) [-602.478] * [-600.888] (-602.658) (-602.552) (-601.391) -- 0:00:17
      702000 -- (-607.924) (-603.704) [-604.134] (-603.730) * (-603.010) [-605.424] (-602.794) (-602.092) -- 0:00:17
      702500 -- (-604.348) [-601.667] (-603.018) (-601.904) * (-603.765) (-602.086) [-602.170] (-601.290) -- 0:00:17
      703000 -- [-603.187] (-603.431) (-603.369) (-604.653) * [-604.268] (-608.154) (-602.194) (-604.390) -- 0:00:17
      703500 -- (-602.385) (-602.774) [-602.019] (-606.237) * [-603.273] (-602.908) (-602.879) (-602.303) -- 0:00:17
      704000 -- (-606.710) (-601.362) (-601.181) [-602.774] * [-605.401] (-602.445) (-602.858) (-601.816) -- 0:00:17
      704500 -- (-603.453) [-604.562] (-602.656) (-604.612) * (-605.594) [-602.126] (-601.957) (-602.177) -- 0:00:17
      705000 -- (-603.041) (-602.679) (-602.229) [-602.928] * [-603.601] (-601.561) (-601.511) (-602.918) -- 0:00:17

      Average standard deviation of split frequencies: 0.011977

      705500 -- (-601.807) (-603.142) (-601.475) [-601.767] * (-605.003) (-601.425) (-602.325) [-603.294] -- 0:00:17
      706000 -- (-601.884) [-601.843] (-606.214) (-601.703) * [-602.695] (-601.106) (-601.180) (-606.532) -- 0:00:17
      706500 -- (-601.537) (-600.768) (-603.921) [-604.051] * (-606.593) [-601.021] (-603.592) (-603.984) -- 0:00:17
      707000 -- (-603.497) (-602.663) (-604.305) [-601.926] * (-602.246) [-602.726] (-602.359) (-602.238) -- 0:00:17
      707500 -- (-602.831) (-603.058) [-601.714] (-602.333) * (-602.676) (-603.039) [-603.990] (-601.834) -- 0:00:17
      708000 -- [-606.141] (-602.843) (-603.400) (-602.566) * [-603.879] (-603.079) (-602.755) (-602.441) -- 0:00:17
      708500 -- (-601.328) (-602.020) [-603.258] (-601.815) * (-603.030) (-603.630) (-603.798) [-603.273] -- 0:00:17
      709000 -- (-601.157) (-605.312) [-606.280] (-607.341) * (-603.847) [-602.197] (-601.889) (-603.566) -- 0:00:17
      709500 -- [-602.561] (-602.807) (-605.275) (-609.168) * (-602.561) (-603.204) [-602.212] (-603.702) -- 0:00:17
      710000 -- [-602.214] (-604.710) (-605.390) (-603.616) * (-603.388) [-607.571] (-601.827) (-601.875) -- 0:00:17

      Average standard deviation of split frequencies: 0.012272

      710500 -- (-601.128) (-603.384) [-603.220] (-604.207) * (-607.014) [-607.955] (-602.546) (-602.210) -- 0:00:17
      711000 -- (-602.733) [-602.669] (-608.061) (-603.002) * (-602.669) [-604.649] (-603.150) (-603.987) -- 0:00:17
      711500 -- (-603.922) (-601.322) (-604.956) [-604.503] * (-602.539) (-607.985) [-603.420] (-607.388) -- 0:00:17
      712000 -- [-603.196] (-601.449) (-602.404) (-602.870) * (-602.073) [-601.525] (-604.108) (-601.584) -- 0:00:17
      712500 -- (-602.715) (-602.552) (-602.491) [-602.257] * [-603.806] (-602.629) (-603.952) (-601.975) -- 0:00:17
      713000 -- (-604.466) (-601.869) (-602.262) [-606.051] * [-604.667] (-602.817) (-601.616) (-606.024) -- 0:00:17
      713500 -- (-610.588) [-602.507] (-603.672) (-603.269) * (-604.347) [-603.754] (-601.252) (-606.000) -- 0:00:17
      714000 -- (-603.395) (-601.806) [-602.479] (-602.459) * (-605.544) (-601.827) (-601.557) [-606.167] -- 0:00:17
      714500 -- (-604.196) [-602.739] (-604.030) (-604.196) * (-601.806) (-602.779) (-604.285) [-600.867] -- 0:00:17
      715000 -- (-602.459) (-602.539) [-602.351] (-607.857) * [-605.542] (-601.175) (-602.772) (-603.007) -- 0:00:17

      Average standard deviation of split frequencies: 0.011645

      715500 -- (-602.185) (-601.754) [-602.156] (-602.458) * (-602.733) (-601.796) [-606.024] (-603.802) -- 0:00:17
      716000 -- [-603.181] (-602.724) (-604.106) (-603.824) * (-601.434) (-602.145) (-605.416) [-602.007] -- 0:00:17
      716500 -- [-604.797] (-601.711) (-602.449) (-601.759) * (-604.024) [-604.831] (-602.479) (-604.484) -- 0:00:17
      717000 -- (-601.613) (-602.329) (-601.148) [-602.364] * (-601.978) (-601.826) [-605.732] (-602.866) -- 0:00:16
      717500 -- (-602.088) (-603.030) (-602.232) [-601.600] * (-602.090) (-606.132) [-601.203] (-602.130) -- 0:00:16
      718000 -- (-603.363) (-603.543) [-602.914] (-602.184) * [-601.239] (-603.399) (-601.772) (-604.232) -- 0:00:16
      718500 -- [-601.598] (-602.821) (-601.043) (-602.544) * (-601.901) (-603.196) (-602.225) [-602.886] -- 0:00:16
      719000 -- (-601.459) [-602.715] (-603.075) (-603.611) * [-602.035] (-603.094) (-600.833) (-602.246) -- 0:00:16
      719500 -- [-601.961] (-602.218) (-607.705) (-601.991) * (-605.067) (-602.204) (-601.175) [-602.540] -- 0:00:16
      720000 -- [-601.742] (-601.132) (-603.370) (-601.899) * (-610.792) (-604.190) (-602.860) [-604.247] -- 0:00:16

      Average standard deviation of split frequencies: 0.011447

      720500 -- (-603.748) (-602.755) (-602.455) [-602.361] * (-603.463) (-605.231) [-602.968] (-604.572) -- 0:00:16
      721000 -- (-601.475) (-603.895) [-601.160] (-602.605) * (-602.744) (-604.592) (-605.422) [-602.233] -- 0:00:16
      721500 -- (-602.312) (-606.009) (-603.879) [-602.952] * (-602.649) [-602.550] (-601.721) (-603.181) -- 0:00:16
      722000 -- [-602.473] (-603.412) (-603.490) (-601.357) * [-601.521] (-601.865) (-605.371) (-602.026) -- 0:00:16
      722500 -- (-602.441) (-604.418) [-602.791] (-601.568) * [-603.319] (-602.811) (-604.153) (-604.222) -- 0:00:16
      723000 -- (-603.650) [-601.769] (-602.834) (-600.705) * (-602.104) [-601.449] (-602.494) (-602.378) -- 0:00:16
      723500 -- (-607.817) (-603.813) [-602.668] (-603.344) * (-603.041) (-608.265) (-606.544) [-602.476] -- 0:00:16
      724000 -- (-604.585) (-605.460) (-604.092) [-601.918] * (-605.351) (-601.292) (-605.837) [-603.572] -- 0:00:16
      724500 -- (-604.749) (-602.276) (-603.522) [-605.514] * (-606.455) (-602.531) (-602.262) [-602.458] -- 0:00:16
      725000 -- (-603.914) (-601.854) (-607.034) [-601.927] * (-605.168) (-602.621) (-601.732) [-602.469] -- 0:00:16

      Average standard deviation of split frequencies: 0.011566

      725500 -- (-603.251) (-601.109) (-605.508) [-607.027] * (-606.960) [-602.018] (-602.141) (-601.798) -- 0:00:16
      726000 -- (-607.141) [-601.363] (-601.943) (-602.646) * (-604.360) [-601.628] (-602.240) (-601.834) -- 0:00:16
      726500 -- (-603.474) (-604.388) (-601.850) [-602.516] * (-604.480) [-602.509] (-604.920) (-606.566) -- 0:00:16
      727000 -- [-605.381] (-602.036) (-601.457) (-601.512) * (-608.062) [-603.872] (-601.643) (-605.035) -- 0:00:16
      727500 -- (-604.164) [-606.967] (-602.449) (-605.348) * [-601.737] (-603.876) (-601.569) (-603.302) -- 0:00:16
      728000 -- (-603.439) [-603.118] (-602.816) (-603.791) * (-602.740) [-601.044] (-606.726) (-603.787) -- 0:00:16
      728500 -- (-602.924) (-606.043) [-605.061] (-602.380) * (-600.881) (-601.564) [-602.142] (-604.137) -- 0:00:16
      729000 -- (-602.711) (-601.311) (-605.592) [-603.172] * (-600.901) (-601.432) (-605.513) [-610.932] -- 0:00:16
      729500 -- (-605.477) (-601.210) (-604.394) [-602.018] * (-602.826) [-602.226] (-606.674) (-614.903) -- 0:00:16
      730000 -- (-602.670) [-601.607] (-603.580) (-602.202) * (-603.111) (-601.281) (-602.688) [-608.611] -- 0:00:16

      Average standard deviation of split frequencies: 0.011694

      730500 -- (-603.576) (-600.942) (-603.372) [-603.528] * (-604.021) [-602.114] (-601.479) (-605.356) -- 0:00:16
      731000 -- (-602.758) [-600.876] (-604.134) (-604.206) * (-603.070) (-602.579) (-601.140) [-604.436] -- 0:00:16
      731500 -- (-603.004) (-604.022) (-606.059) [-603.691] * (-602.836) (-602.006) (-603.780) [-602.056] -- 0:00:16
      732000 -- [-606.551] (-602.732) (-602.851) (-601.668) * (-601.657) (-606.515) [-602.811] (-603.480) -- 0:00:16
      732500 -- [-607.676] (-606.101) (-603.190) (-601.700) * (-601.998) (-601.798) (-603.013) [-601.091] -- 0:00:16
      733000 -- (-608.384) (-604.080) [-603.784] (-603.152) * (-601.559) (-603.362) [-601.864] (-603.113) -- 0:00:16
      733500 -- (-603.576) [-602.403] (-605.664) (-604.526) * [-604.871] (-602.708) (-604.772) (-603.168) -- 0:00:15
      734000 -- (-605.128) (-604.885) [-602.830] (-602.342) * (-603.793) (-602.853) [-603.344] (-604.173) -- 0:00:15
      734500 -- (-603.377) [-602.351] (-603.661) (-602.567) * (-602.468) [-603.084] (-605.779) (-602.472) -- 0:00:15
      735000 -- (-602.782) (-603.673) [-601.379] (-602.636) * (-603.266) (-603.353) (-602.974) [-605.969] -- 0:00:15

      Average standard deviation of split frequencies: 0.011849

      735500 -- (-605.719) [-603.794] (-601.515) (-607.438) * (-608.780) (-601.761) (-602.757) [-604.505] -- 0:00:15
      736000 -- (-605.062) (-605.138) [-603.795] (-602.142) * [-603.940] (-602.620) (-601.677) (-603.297) -- 0:00:15
      736500 -- (-602.057) (-605.703) (-606.232) [-602.525] * [-601.131] (-603.382) (-602.080) (-602.580) -- 0:00:15
      737000 -- (-602.224) [-606.320] (-605.747) (-606.961) * [-600.927] (-603.316) (-601.996) (-606.262) -- 0:00:15
      737500 -- (-603.401) (-604.572) [-605.319] (-605.500) * (-601.390) (-602.530) [-601.206] (-605.553) -- 0:00:15
      738000 -- (-604.582) [-603.370] (-602.210) (-601.765) * [-602.757] (-601.479) (-602.673) (-605.881) -- 0:00:15
      738500 -- (-603.567) (-603.156) [-603.396] (-604.177) * (-601.700) (-603.140) [-602.388] (-602.874) -- 0:00:15
      739000 -- (-602.982) (-602.338) [-602.425] (-601.554) * (-601.800) [-602.002] (-602.373) (-610.427) -- 0:00:15
      739500 -- (-603.647) [-601.910] (-601.977) (-601.353) * (-604.074) (-605.068) (-603.693) [-607.392] -- 0:00:15
      740000 -- (-606.970) (-603.248) [-603.284] (-603.511) * (-603.520) [-608.006] (-605.257) (-602.031) -- 0:00:15

      Average standard deviation of split frequencies: 0.011655

      740500 -- (-602.303) (-601.635) [-602.537] (-602.223) * (-602.964) [-604.905] (-606.910) (-603.331) -- 0:00:15
      741000 -- (-602.374) [-601.448] (-604.512) (-605.170) * [-603.028] (-602.331) (-603.230) (-601.929) -- 0:00:15
      741500 -- (-606.013) [-602.364] (-604.812) (-604.848) * [-602.526] (-603.653) (-602.367) (-604.790) -- 0:00:15
      742000 -- (-603.085) (-603.719) [-605.075] (-607.401) * (-602.303) (-603.654) (-603.166) [-601.803] -- 0:00:15
      742500 -- (-601.895) (-603.181) (-602.942) [-604.041] * [-605.116] (-602.793) (-606.451) (-604.004) -- 0:00:15
      743000 -- [-603.636] (-603.777) (-603.646) (-602.456) * [-603.469] (-602.902) (-602.041) (-604.557) -- 0:00:15
      743500 -- [-602.942] (-604.016) (-603.394) (-601.915) * [-606.874] (-602.341) (-608.025) (-604.672) -- 0:00:15
      744000 -- (-602.413) [-601.650] (-603.086) (-602.479) * (-605.903) (-601.358) [-601.057] (-602.594) -- 0:00:15
      744500 -- (-605.670) [-603.562] (-602.489) (-608.765) * (-603.079) (-601.637) [-603.985] (-604.279) -- 0:00:15
      745000 -- (-603.175) (-601.768) (-602.220) [-601.248] * (-604.727) [-603.050] (-602.877) (-603.835) -- 0:00:15

      Average standard deviation of split frequencies: 0.011848

      745500 -- [-601.839] (-606.054) (-602.894) (-601.173) * (-604.303) [-604.515] (-606.053) (-601.690) -- 0:00:15
      746000 -- (-602.489) (-605.749) [-601.835] (-604.917) * [-605.162] (-604.034) (-603.226) (-602.728) -- 0:00:15
      746500 -- (-603.621) (-604.363) [-603.383] (-602.705) * (-600.968) (-604.057) [-605.997] (-602.290) -- 0:00:15
      747000 -- (-605.955) (-605.325) [-602.660] (-603.811) * (-600.877) [-602.394] (-602.232) (-605.207) -- 0:00:15
      747500 -- [-603.342] (-603.634) (-603.926) (-602.269) * (-603.254) (-602.445) [-604.117] (-601.423) -- 0:00:15
      748000 -- (-603.062) (-601.994) (-607.368) [-604.923] * (-601.267) (-602.647) (-602.832) [-601.796] -- 0:00:15
      748500 -- [-602.318] (-602.675) (-602.175) (-604.124) * (-604.380) (-601.936) (-602.474) [-603.203] -- 0:00:15
      749000 -- [-603.639] (-602.816) (-601.542) (-601.321) * (-600.986) [-603.879] (-601.693) (-603.104) -- 0:00:15
      749500 -- (-602.499) [-601.324] (-602.099) (-601.154) * (-603.019) (-604.099) [-601.699] (-603.044) -- 0:00:15
      750000 -- [-602.856] (-604.955) (-603.141) (-601.249) * (-605.471) [-608.470] (-604.492) (-602.954) -- 0:00:15

      Average standard deviation of split frequencies: 0.011735

      750500 -- (-605.493) (-602.309) (-601.693) [-602.104] * [-601.487] (-604.667) (-602.209) (-601.782) -- 0:00:14
      751000 -- [-604.543] (-600.976) (-603.225) (-600.976) * (-601.462) [-602.639] (-604.497) (-601.717) -- 0:00:14
      751500 -- (-603.073) [-601.969] (-603.782) (-601.891) * [-604.693] (-603.367) (-601.955) (-601.652) -- 0:00:14
      752000 -- (-603.395) (-602.461) [-605.620] (-601.650) * (-604.283) (-603.819) [-600.992] (-604.019) -- 0:00:14
      752500 -- [-603.588] (-605.866) (-602.397) (-602.349) * [-601.690] (-601.555) (-606.754) (-603.915) -- 0:00:14
      753000 -- (-602.211) (-604.611) [-601.343] (-601.962) * (-601.589) [-601.359] (-602.823) (-602.335) -- 0:00:14
      753500 -- [-602.807] (-603.259) (-601.307) (-602.201) * (-602.418) (-601.345) (-602.456) [-602.423] -- 0:00:14
      754000 -- (-603.351) (-602.212) [-603.061] (-602.420) * (-603.097) (-606.242) (-601.317) [-602.852] -- 0:00:14
      754500 -- (-603.845) [-602.155] (-605.453) (-604.066) * (-605.477) [-603.361] (-602.929) (-603.571) -- 0:00:14
      755000 -- (-605.102) (-601.558) [-603.805] (-601.919) * (-604.377) (-602.922) [-605.599] (-605.893) -- 0:00:14

      Average standard deviation of split frequencies: 0.011640

      755500 -- (-602.878) (-603.268) (-603.043) [-601.902] * (-602.380) [-602.831] (-603.569) (-601.708) -- 0:00:14
      756000 -- [-601.384] (-602.508) (-609.206) (-601.680) * (-604.783) (-605.441) (-601.910) [-601.514] -- 0:00:14
      756500 -- (-601.852) (-602.033) [-603.095] (-601.996) * (-605.539) (-605.208) (-601.935) [-601.447] -- 0:00:14
      757000 -- [-604.601] (-603.397) (-603.297) (-602.456) * (-604.182) [-604.532] (-606.061)