--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:53:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1390/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -602.36 -604.83
2 -602.34 -607.37
--------------------------------------
TOTAL -602.35 -606.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904712 0.092399 0.373498 1.498828 0.870764 1338.26 1419.63 1.002
r(A<->C){all} 0.161972 0.018709 0.000022 0.439099 0.125089 261.16 281.87 1.003
r(A<->G){all} 0.164245 0.020235 0.000229 0.459012 0.123836 270.64 271.56 1.002
r(A<->T){all} 0.168962 0.020481 0.000091 0.460043 0.127567 237.53 251.55 1.006
r(C<->G){all} 0.164661 0.017870 0.000018 0.426145 0.130630 220.89 264.00 1.001
r(C<->T){all} 0.176134 0.021191 0.000025 0.482313 0.139652 184.20 246.36 1.000
r(G<->T){all} 0.164026 0.019815 0.000051 0.448639 0.126614 184.65 184.91 1.002
pi(A){all} 0.209059 0.000369 0.174908 0.248435 0.208783 1316.49 1321.90 1.000
pi(C){all} 0.273116 0.000449 0.232463 0.315812 0.272908 1301.96 1313.83 1.000
pi(G){all} 0.328526 0.000482 0.283033 0.368090 0.328464 1380.88 1440.94 1.000
pi(T){all} 0.189299 0.000343 0.155684 0.225835 0.189101 1308.82 1356.65 1.000
alpha{1,2} 0.422504 0.241666 0.000328 1.377334 0.247719 1152.80 1216.23 1.000
alpha{3} 0.454529 0.221748 0.000330 1.379971 0.306091 1270.88 1385.94 1.000
pinvar{all} 0.996263 0.000023 0.987522 0.999997 0.997747 1154.24 1283.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -570.158874
Model 2: PositiveSelection -570.158855
Model 0: one-ratio -570.158864
Model 7: beta -570.158943
Model 8: beta&w>1 -570.158843
Model 0 vs 1 1.9999999949504854E-5
Model 2 vs 1 3.799999990405922E-5
Model 8 vs 7 1.999999999497959E-4
>C1
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C2
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C3
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C4
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C5
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C6
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
C1 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C2 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C3 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C4 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C5 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C6 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
**************************************************
C1 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C2 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C3 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C4 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C5 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C6 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
**************************************************
C1 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C2 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C3 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C4 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C5 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C6 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
***********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 147 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 147 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4410]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4410]--->[4410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.680 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C2 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C3 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C4 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C5 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
C6 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
**************************************************
C1 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C2 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C3 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C4 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C5 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
C6 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
**************************************************
C1 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C2 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C3 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C4 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C5 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
C6 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C2 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C3 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C4 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C5 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
C6 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
**************************************************
C1 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C2 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C3 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C4 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C5 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
C6 GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
**************************************************
C1 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C2 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C3 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C4 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C5 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
C6 TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
**************************************************
C1 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C2 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C3 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C4 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C5 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
C6 GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
**************************************************
C1 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C2 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C3 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C4 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C5 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
C6 CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
**************************************************
C1 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C2 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C3 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C4 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C5 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
C6 ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
**************************************************
C1 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C2 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C3 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C4 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C5 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
C6 CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
**************************************************
C1 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C2 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C3 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C4 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C5 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
C6 GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
**************************************************
C1 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C2 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C3 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C4 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C5 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
C6 GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
*****************************************
>C1
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C2
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C3
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C4
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C5
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C6
ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC
GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC
TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC
GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA
CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA
ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC
CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT
GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC
GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>C1
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C2
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C3
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C4
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C5
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
>C6
MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 441 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859517
Setting output file names to "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 343318872
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5438336661
Seed = 2032503976
Swapseed = 1579859517
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -986.979141 -- -24.965149
Chain 2 -- -986.979085 -- -24.965149
Chain 3 -- -986.979141 -- -24.965149
Chain 4 -- -986.979141 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -986.979141 -- -24.965149
Chain 2 -- -986.979141 -- -24.965149
Chain 3 -- -986.979085 -- -24.965149
Chain 4 -- -986.979141 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-986.979] (-986.979) (-986.979) (-986.979) * [-986.979] (-986.979) (-986.979) (-986.979)
500 -- [-616.984] (-611.274) (-616.968) (-616.981) * [-616.635] (-614.736) (-607.289) (-613.138) -- 0:00:00
1000 -- [-615.059] (-615.890) (-614.403) (-622.655) * [-619.236] (-617.575) (-610.739) (-628.826) -- 0:00:00
1500 -- (-611.696) [-618.461] (-608.214) (-609.061) * [-611.457] (-614.085) (-615.201) (-611.857) -- 0:00:00
2000 -- (-614.475) (-607.742) [-606.848] (-616.059) * (-611.998) (-617.600) (-610.874) [-609.137] -- 0:00:00
2500 -- (-616.143) (-608.698) (-611.073) [-608.316] * (-615.885) (-616.533) (-609.125) [-614.478] -- 0:00:00
3000 -- [-607.498] (-612.744) (-615.084) (-618.955) * (-613.006) (-614.128) [-610.438] (-615.047) -- 0:00:00
3500 -- (-606.114) [-609.130] (-612.779) (-618.100) * (-612.113) [-610.344] (-615.536) (-613.045) -- 0:00:00
4000 -- (-608.236) [-608.392] (-615.409) (-624.354) * (-613.062) (-617.739) [-611.324] (-615.652) -- 0:04:09
4500 -- (-609.800) (-617.658) (-616.268) [-613.214] * [-610.972] (-608.533) (-615.321) (-612.447) -- 0:03:41
5000 -- (-614.146) (-612.301) [-612.180] (-612.806) * (-618.293) [-612.846] (-611.563) (-614.711) -- 0:03:19
Average standard deviation of split frequencies: 0.081983
5500 -- (-611.280) (-609.232) (-606.412) [-614.376] * [-606.347] (-608.697) (-613.673) (-612.654) -- 0:03:00
6000 -- [-610.473] (-616.209) (-613.220) (-610.774) * [-611.640] (-617.229) (-609.748) (-614.047) -- 0:02:45
6500 -- (-613.053) (-609.669) (-625.060) [-610.947] * [-609.855] (-613.438) (-613.266) (-612.614) -- 0:02:32
7000 -- (-614.959) [-611.273] (-616.246) (-612.495) * [-609.396] (-609.507) (-614.302) (-617.623) -- 0:02:21
7500 -- (-612.369) [-615.831] (-603.107) (-614.240) * (-611.195) (-618.805) (-613.728) [-612.359] -- 0:02:12
8000 -- (-608.366) [-609.488] (-604.165) (-616.132) * (-616.634) (-612.070) (-609.888) [-607.113] -- 0:02:04
8500 -- (-611.311) [-611.659] (-602.973) (-608.513) * (-613.542) (-612.121) (-614.366) [-613.149] -- 0:01:56
9000 -- (-612.643) (-617.020) [-604.841] (-606.289) * (-612.100) (-611.251) (-610.123) [-613.572] -- 0:01:50
9500 -- (-606.431) [-612.071] (-602.304) (-617.510) * [-611.559] (-621.236) (-609.107) (-615.321) -- 0:01:44
10000 -- (-612.674) (-618.816) [-601.408] (-611.529) * (-612.801) [-613.171] (-608.079) (-610.637) -- 0:01:39
Average standard deviation of split frequencies: 0.066291
10500 -- [-613.855] (-613.145) (-605.760) (-620.461) * (-618.251) [-616.253] (-619.631) (-615.768) -- 0:01:34
11000 -- [-610.132] (-622.355) (-604.838) (-618.609) * [-614.671] (-616.365) (-610.458) (-620.379) -- 0:01:29
11500 -- (-606.842) [-609.301] (-603.353) (-616.671) * [-610.152] (-604.646) (-615.089) (-609.756) -- 0:01:25
12000 -- (-618.646) (-603.637) (-603.846) [-612.883] * (-613.153) [-604.557] (-610.740) (-612.770) -- 0:01:22
12500 -- (-618.052) [-603.405] (-604.287) (-620.666) * (-612.612) [-603.111] (-608.755) (-612.627) -- 0:01:19
13000 -- (-614.155) [-604.462] (-603.673) (-613.781) * (-612.431) [-603.123] (-612.811) (-619.753) -- 0:01:15
13500 -- (-628.664) (-603.291) [-603.777] (-617.174) * (-614.090) (-601.249) (-623.210) [-614.662] -- 0:01:13
14000 -- (-608.182) [-603.392] (-602.203) (-617.806) * (-610.852) (-605.754) (-606.159) [-613.113] -- 0:01:10
14500 -- (-605.440) (-603.795) [-602.012] (-602.991) * [-609.698] (-603.708) (-611.886) (-614.389) -- 0:01:07
15000 -- [-610.119] (-610.097) (-603.032) (-606.535) * (-619.691) (-601.817) [-612.193] (-624.588) -- 0:01:05
Average standard deviation of split frequencies: 0.047702
15500 -- [-604.637] (-603.178) (-605.311) (-606.859) * (-620.650) [-601.477] (-633.484) (-611.247) -- 0:01:03
16000 -- (-612.768) [-604.754] (-603.303) (-602.593) * [-611.838] (-603.799) (-613.656) (-618.256) -- 0:01:01
16500 -- (-606.095) [-603.752] (-604.917) (-603.166) * [-608.367] (-603.993) (-603.605) (-607.972) -- 0:00:59
17000 -- (-606.501) [-601.367] (-601.273) (-604.972) * [-607.905] (-600.941) (-601.464) (-607.106) -- 0:00:57
17500 -- (-610.471) (-603.810) [-601.466] (-604.693) * (-605.018) (-602.613) (-601.916) [-603.762] -- 0:00:56
18000 -- (-615.673) (-603.278) (-601.559) [-608.757] * (-604.526) (-605.331) [-603.493] (-606.433) -- 0:00:54
18500 -- (-613.375) (-602.976) (-602.140) [-601.678] * (-603.272) (-602.445) [-601.875] (-602.888) -- 0:00:53
19000 -- [-607.525] (-606.404) (-603.194) (-604.114) * (-604.916) (-602.130) (-601.691) [-601.878] -- 0:00:51
19500 -- (-617.924) (-601.285) (-603.829) [-602.722] * (-604.644) [-601.297] (-600.901) (-601.854) -- 0:00:50
20000 -- (-626.481) [-602.858] (-604.702) (-605.089) * (-603.847) [-602.079] (-601.904) (-601.783) -- 0:00:49
Average standard deviation of split frequencies: 0.038016
20500 -- (-624.488) [-602.738] (-605.227) (-603.279) * [-603.320] (-602.339) (-603.546) (-601.294) -- 0:01:35
21000 -- (-607.455) (-605.015) [-602.639] (-601.750) * [-603.815] (-602.279) (-602.322) (-602.705) -- 0:01:33
21500 -- (-602.133) [-604.408] (-603.063) (-601.102) * (-603.253) (-607.818) [-605.013] (-604.884) -- 0:01:31
22000 -- (-601.810) (-604.525) (-603.168) [-602.661] * [-603.973] (-610.141) (-603.367) (-602.766) -- 0:01:28
22500 -- (-604.226) [-602.528] (-604.637) (-604.603) * (-604.444) (-601.330) [-606.881] (-604.524) -- 0:01:26
23000 -- (-602.834) [-602.845] (-602.060) (-603.376) * (-603.080) (-601.161) [-602.918] (-603.881) -- 0:01:24
23500 -- [-601.913] (-606.821) (-604.375) (-605.859) * (-601.422) (-600.876) [-602.274] (-602.630) -- 0:01:23
24000 -- (-601.284) (-601.503) (-603.893) [-603.108] * (-601.761) (-601.207) [-602.087] (-603.748) -- 0:01:21
24500 -- (-604.007) (-604.432) (-604.210) [-601.936] * (-602.448) [-602.076] (-604.390) (-605.101) -- 0:01:19
25000 -- (-602.899) (-604.144) (-603.890) [-603.371] * (-604.532) [-601.296] (-603.203) (-604.003) -- 0:01:18
Average standard deviation of split frequencies: 0.037989
25500 -- (-604.788) (-603.985) (-603.530) [-607.776] * (-602.021) [-602.582] (-604.414) (-604.828) -- 0:01:16
26000 -- [-601.783] (-602.658) (-603.329) (-601.641) * [-604.469] (-603.117) (-606.450) (-603.086) -- 0:01:14
26500 -- (-603.113) (-601.919) [-603.307] (-602.917) * (-604.924) (-606.790) [-601.936] (-603.203) -- 0:01:13
27000 -- (-603.186) [-606.185] (-604.594) (-604.679) * (-602.453) (-603.595) (-601.558) [-602.107] -- 0:01:12
27500 -- (-602.340) (-610.626) (-602.187) [-604.781] * [-601.218] (-603.081) (-602.628) (-604.809) -- 0:01:10
28000 -- (-603.792) (-604.137) (-602.803) [-603.263] * (-602.943) (-602.572) [-601.865] (-603.761) -- 0:01:09
28500 -- (-602.498) (-604.728) (-605.005) [-602.417] * [-602.709] (-601.327) (-606.451) (-602.833) -- 0:01:08
29000 -- (-604.872) (-603.426) (-603.056) [-602.646] * (-601.516) [-601.192] (-602.938) (-605.042) -- 0:01:06
29500 -- (-601.857) [-601.709] (-601.913) (-601.736) * (-606.286) (-602.444) [-603.605] (-602.595) -- 0:01:05
30000 -- [-602.754] (-602.632) (-602.381) (-602.159) * (-603.004) (-602.710) [-601.292] (-605.485) -- 0:01:04
Average standard deviation of split frequencies: 0.032208
30500 -- (-604.798) (-602.776) [-603.036] (-602.539) * [-604.628] (-602.752) (-604.240) (-605.711) -- 0:01:03
31000 -- (-604.515) [-604.955] (-602.079) (-602.665) * (-604.292) (-603.041) (-602.276) [-604.780] -- 0:01:02
31500 -- (-604.498) [-601.853] (-602.559) (-601.298) * (-602.396) (-606.483) (-603.604) [-607.281] -- 0:01:01
32000 -- (-603.838) (-601.900) (-602.080) [-601.081] * (-601.605) (-608.027) [-603.317] (-612.727) -- 0:01:00
32500 -- (-602.020) (-604.547) (-603.767) [-602.234] * (-603.885) (-604.839) (-602.876) [-604.252] -- 0:00:59
33000 -- (-603.414) [-603.299] (-605.178) (-602.338) * [-601.580] (-604.309) (-601.055) (-602.164) -- 0:00:58
33500 -- (-601.318) (-603.561) (-602.674) [-603.568] * (-607.609) (-603.100) (-600.940) [-601.325] -- 0:00:57
34000 -- (-602.195) (-604.638) [-601.931] (-604.544) * (-603.254) [-602.514] (-601.601) (-606.759) -- 0:00:56
34500 -- (-602.640) (-606.632) [-603.303] (-604.921) * [-605.699] (-602.281) (-601.408) (-603.615) -- 0:00:55
35000 -- (-605.513) [-604.116] (-604.175) (-603.605) * (-606.609) (-602.520) (-601.758) [-603.135] -- 0:00:55
Average standard deviation of split frequencies: 0.022448
35500 -- (-603.595) (-607.664) (-602.660) [-602.623] * (-601.507) (-603.164) [-600.767] (-604.686) -- 0:00:54
36000 -- (-602.672) (-601.230) [-602.247] (-604.235) * (-606.275) (-601.929) (-606.203) [-604.436] -- 0:00:53
36500 -- (-609.284) [-601.839] (-602.844) (-601.241) * (-602.935) (-603.630) (-608.676) [-607.848] -- 0:00:52
37000 -- (-604.554) [-603.463] (-602.282) (-603.571) * (-603.964) (-603.230) [-605.054] (-605.240) -- 0:00:52
37500 -- [-603.991] (-604.591) (-606.031) (-605.866) * (-606.625) [-602.582] (-604.800) (-606.537) -- 0:01:17
38000 -- (-602.003) [-602.178] (-603.813) (-603.412) * [-607.375] (-603.712) (-604.187) (-605.853) -- 0:01:15
38500 -- (-601.528) (-603.810) [-602.736] (-603.172) * (-604.264) (-605.738) [-605.188] (-601.519) -- 0:01:14
39000 -- (-603.661) [-605.737] (-601.704) (-601.465) * (-604.029) (-602.565) (-602.940) [-603.024] -- 0:01:13
39500 -- (-601.673) (-601.587) [-601.720] (-602.026) * (-607.057) (-602.991) [-604.701] (-602.889) -- 0:01:12
40000 -- (-604.460) [-601.671] (-602.646) (-604.523) * [-602.836] (-601.622) (-604.361) (-603.430) -- 0:01:12
Average standard deviation of split frequencies: 0.028152
40500 -- [-604.374] (-604.452) (-604.472) (-602.201) * [-604.030] (-601.121) (-601.385) (-606.536) -- 0:01:11
41000 -- (-601.378) [-601.854] (-603.007) (-601.279) * (-603.562) [-600.870] (-605.325) (-606.902) -- 0:01:10
41500 -- (-604.094) [-603.573] (-603.123) (-600.755) * (-603.141) [-603.582] (-607.420) (-607.067) -- 0:01:09
42000 -- [-601.371] (-603.669) (-604.914) (-601.733) * (-603.182) [-603.162] (-603.008) (-605.673) -- 0:01:08
42500 -- [-601.280] (-604.974) (-603.649) (-603.449) * (-601.467) (-608.682) (-602.241) [-602.784] -- 0:01:07
43000 -- (-602.343) (-601.631) [-602.354] (-601.731) * (-602.243) (-603.936) (-602.393) [-602.399] -- 0:01:06
43500 -- (-606.457) [-607.726] (-603.837) (-601.628) * (-601.608) (-604.776) [-602.533] (-609.528) -- 0:01:05
44000 -- (-603.181) [-601.703] (-602.800) (-601.357) * (-606.179) (-604.232) [-602.056] (-605.264) -- 0:01:05
44500 -- (-603.256) (-603.678) [-606.146] (-603.189) * [-601.661] (-603.294) (-603.068) (-606.682) -- 0:01:04
45000 -- [-602.618] (-601.979) (-604.771) (-601.898) * [-602.412] (-603.235) (-602.386) (-603.851) -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-602.189) [-604.434] (-605.062) (-601.893) * [-604.058] (-601.433) (-609.258) (-601.198) -- 0:01:02
46000 -- (-602.268) (-603.468) [-602.680] (-603.448) * (-601.471) (-602.955) [-601.427] (-601.189) -- 0:01:02
46500 -- [-601.864] (-607.970) (-604.593) (-605.197) * (-601.509) [-604.129] (-603.535) (-603.621) -- 0:01:01
47000 -- (-606.057) [-605.195] (-602.577) (-601.027) * (-602.638) [-603.046] (-607.592) (-604.755) -- 0:01:00
47500 -- (-603.219) (-601.745) (-602.287) [-602.456] * [-601.763] (-603.307) (-604.742) (-603.221) -- 0:01:00
48000 -- (-602.256) (-603.238) (-601.538) [-606.079] * (-602.058) (-603.429) [-604.543] (-606.387) -- 0:00:59
48500 -- [-601.879] (-601.884) (-606.248) (-602.842) * (-605.692) [-604.898] (-608.687) (-604.210) -- 0:00:58
49000 -- (-602.969) [-600.907] (-602.995) (-607.489) * [-605.048] (-603.475) (-601.549) (-603.236) -- 0:00:58
49500 -- [-601.254] (-602.935) (-602.520) (-606.128) * (-601.865) (-603.853) [-602.055] (-602.229) -- 0:00:57
50000 -- [-602.226] (-601.930) (-604.517) (-606.509) * (-601.823) (-603.052) [-604.815] (-603.342) -- 0:00:57
Average standard deviation of split frequencies: 0.027447
50500 -- (-603.003) (-601.941) [-602.243] (-607.362) * (-601.765) (-601.481) (-606.467) [-601.096] -- 0:00:56
51000 -- (-602.659) [-601.353] (-601.724) (-601.953) * (-603.095) (-602.809) [-604.425] (-601.549) -- 0:00:55
51500 -- (-602.101) (-601.528) [-601.470] (-602.548) * [-604.083] (-603.725) (-604.215) (-601.774) -- 0:00:55
52000 -- [-603.058] (-604.096) (-602.387) (-605.403) * (-604.741) (-606.003) [-602.575] (-602.256) -- 0:00:54
52500 -- (-602.428) (-603.949) [-602.284] (-604.978) * (-608.271) (-603.591) (-604.716) [-600.904] -- 0:00:54
53000 -- (-604.011) [-602.029] (-605.155) (-600.935) * (-605.138) (-603.289) (-604.508) [-601.214] -- 0:00:53
53500 -- (-602.783) [-602.710] (-601.982) (-601.359) * (-603.181) (-601.904) [-604.398] (-604.250) -- 0:00:53
54000 -- (-602.212) (-607.071) [-602.383] (-601.489) * (-602.656) (-601.940) (-605.867) [-602.018] -- 0:01:10
54500 -- (-602.112) (-603.059) (-604.086) [-601.066] * (-602.649) [-602.896] (-602.327) (-603.066) -- 0:01:09
55000 -- (-602.017) [-602.527] (-601.776) (-605.070) * (-604.921) (-602.744) (-604.138) [-604.377] -- 0:01:08
Average standard deviation of split frequencies: 0.024853
55500 -- (-603.169) (-601.721) (-602.672) [-603.701] * [-605.499] (-601.702) (-603.891) (-604.870) -- 0:01:08
56000 -- [-602.901] (-602.726) (-602.014) (-602.588) * (-602.894) (-603.877) (-604.377) [-603.661] -- 0:01:07
56500 -- [-601.500] (-603.307) (-608.066) (-603.408) * [-603.197] (-601.279) (-603.952) (-602.002) -- 0:01:06
57000 -- (-601.189) (-601.181) (-602.633) [-601.717] * (-603.248) (-600.924) (-604.096) [-601.587] -- 0:01:06
57500 -- (-602.728) [-601.849] (-604.678) (-601.671) * (-603.652) (-605.106) [-603.583] (-601.906) -- 0:01:05
58000 -- (-601.956) [-602.851] (-603.924) (-602.047) * (-603.293) (-602.375) (-602.486) [-601.555] -- 0:01:04
58500 -- [-604.956] (-602.263) (-602.952) (-604.857) * (-603.718) (-604.069) (-603.006) [-602.451] -- 0:01:04
59000 -- [-601.481] (-602.433) (-602.133) (-608.742) * (-603.235) (-602.824) (-601.913) [-607.278] -- 0:01:03
59500 -- (-603.572) [-604.399] (-602.813) (-603.933) * (-605.063) [-602.208] (-602.712) (-603.283) -- 0:01:03
60000 -- (-604.728) (-602.094) [-602.826] (-601.629) * [-603.447] (-605.367) (-602.434) (-604.003) -- 0:01:02
Average standard deviation of split frequencies: 0.023700
60500 -- (-602.786) (-604.604) (-604.843) [-602.900] * [-602.855] (-604.225) (-601.290) (-603.910) -- 0:01:02
61000 -- (-603.051) [-606.599] (-608.068) (-603.907) * (-605.034) (-604.158) [-604.360] (-602.467) -- 0:01:01
61500 -- (-601.782) (-602.324) [-603.814] (-603.188) * (-605.092) (-602.733) [-604.151] (-601.764) -- 0:01:01
62000 -- (-601.804) (-600.675) (-605.428) [-604.752] * (-601.544) (-601.179) [-603.070] (-603.065) -- 0:01:00
62500 -- (-601.259) (-606.622) [-602.578] (-603.379) * (-602.249) (-601.778) [-603.604] (-602.116) -- 0:01:00
63000 -- (-601.804) [-601.237] (-604.584) (-602.031) * (-602.457) (-607.572) [-601.369] (-601.676) -- 0:00:59
63500 -- (-604.384) (-601.590) [-602.495] (-603.186) * (-601.757) [-604.758] (-605.089) (-601.729) -- 0:00:58
64000 -- (-604.660) [-601.342] (-601.838) (-601.414) * (-601.068) (-609.094) [-605.727] (-604.244) -- 0:00:58
64500 -- [-604.621] (-603.040) (-602.820) (-601.680) * (-602.371) (-602.665) [-604.023] (-604.182) -- 0:00:58
65000 -- [-602.206] (-602.669) (-608.516) (-603.227) * (-603.502) (-602.967) (-606.171) [-601.994] -- 0:00:57
Average standard deviation of split frequencies: 0.024284
65500 -- (-606.009) (-601.565) [-602.874] (-603.809) * (-602.345) (-603.975) [-601.634] (-603.969) -- 0:00:57
66000 -- (-603.811) (-602.094) [-603.788] (-602.737) * (-601.612) (-603.173) [-603.341] (-603.745) -- 0:00:56
66500 -- (-602.680) (-602.310) [-602.196] (-604.951) * (-601.122) (-602.951) (-601.660) [-603.461] -- 0:00:56
67000 -- (-601.915) [-601.773] (-602.212) (-601.909) * (-603.631) (-603.655) [-602.390] (-605.623) -- 0:00:55
67500 -- (-601.547) (-601.420) [-602.020] (-607.733) * (-603.236) (-604.143) [-603.352] (-603.711) -- 0:00:55
68000 -- [-607.355] (-601.337) (-601.555) (-606.475) * (-608.551) [-604.033] (-602.940) (-607.672) -- 0:00:54
68500 -- [-603.365] (-602.041) (-602.481) (-604.154) * (-602.949) (-601.958) [-601.310] (-605.183) -- 0:00:54
69000 -- [-601.323] (-604.183) (-604.724) (-603.606) * (-604.986) (-601.412) (-601.543) [-601.091] -- 0:00:53
69500 -- (-601.548) (-602.289) [-603.085] (-608.572) * (-605.272) (-603.282) (-601.738) [-602.714] -- 0:00:53
70000 -- [-602.318] (-604.053) (-603.060) (-601.870) * (-605.388) (-602.364) (-602.803) [-601.044] -- 0:01:06
Average standard deviation of split frequencies: 0.026016
70500 -- (-601.828) (-602.205) (-603.170) [-601.372] * (-604.738) [-602.324] (-604.298) (-603.673) -- 0:01:05
71000 -- (-602.765) (-601.938) (-602.417) [-601.519] * [-604.481] (-602.842) (-603.357) (-604.644) -- 0:01:05
71500 -- [-601.546] (-603.249) (-605.152) (-604.980) * [-604.561] (-602.433) (-604.733) (-601.422) -- 0:01:04
72000 -- [-602.081] (-602.596) (-602.355) (-605.864) * (-606.274) (-604.373) [-602.915] (-602.463) -- 0:01:04
72500 -- (-605.823) (-604.185) (-602.830) [-605.558] * (-605.707) (-603.077) [-602.626] (-601.733) -- 0:01:03
73000 -- (-605.100) [-602.519] (-605.673) (-602.347) * (-607.429) (-602.702) [-604.958] (-602.360) -- 0:01:03
73500 -- (-604.646) (-601.625) (-601.874) [-604.319] * (-603.932) (-605.392) [-604.071] (-601.257) -- 0:01:03
74000 -- (-602.296) (-603.724) (-604.885) [-603.540] * (-602.463) [-604.631] (-605.621) (-604.553) -- 0:01:02
74500 -- (-602.943) [-605.133] (-603.955) (-602.347) * (-602.262) (-602.904) (-605.205) [-603.777] -- 0:01:02
75000 -- (-602.824) (-605.646) (-607.533) [-603.086] * (-604.587) (-605.981) (-605.344) [-603.075] -- 0:01:01
Average standard deviation of split frequencies: 0.026982
75500 -- [-604.515] (-602.093) (-605.658) (-602.613) * [-602.799] (-605.438) (-605.282) (-604.913) -- 0:01:01
76000 -- (-603.523) (-602.636) [-605.618] (-605.373) * (-601.763) (-603.949) [-602.537] (-602.620) -- 0:01:00
76500 -- (-603.935) [-604.041] (-602.011) (-611.618) * (-603.970) (-602.269) [-602.997] (-603.059) -- 0:01:00
77000 -- (-603.464) (-602.767) (-603.076) [-601.175] * (-603.512) [-601.868] (-603.916) (-603.563) -- 0:00:59
77500 -- (-602.969) [-601.016] (-601.381) (-605.516) * (-603.409) [-604.276] (-601.676) (-601.974) -- 0:00:59
78000 -- (-602.764) (-602.556) (-606.978) [-601.064] * [-601.706] (-605.883) (-602.842) (-600.866) -- 0:00:59
78500 -- (-601.987) [-601.614] (-606.302) (-601.321) * (-608.020) (-602.805) [-600.979] (-602.082) -- 0:00:58
79000 -- (-601.840) [-603.659] (-605.452) (-602.040) * [-602.931] (-602.037) (-602.229) (-601.889) -- 0:00:58
79500 -- [-602.573] (-606.074) (-601.778) (-602.196) * (-601.481) [-601.451] (-601.546) (-607.238) -- 0:00:57
80000 -- (-602.345) (-606.509) [-602.129] (-601.619) * (-601.708) [-602.659] (-602.913) (-603.844) -- 0:00:57
Average standard deviation of split frequencies: 0.028941
80500 -- [-602.440] (-605.829) (-603.445) (-601.479) * [-601.404] (-601.462) (-602.929) (-606.908) -- 0:00:57
81000 -- [-603.008] (-602.918) (-603.602) (-602.831) * (-602.239) (-604.264) (-604.440) [-606.441] -- 0:00:56
81500 -- (-601.822) (-606.196) (-603.792) [-605.074] * (-603.470) (-606.570) [-601.891] (-603.435) -- 0:00:56
82000 -- (-603.662) (-602.632) [-601.816] (-603.397) * (-605.275) (-603.257) [-602.298] (-603.593) -- 0:00:55
82500 -- [-602.851] (-602.478) (-607.087) (-606.808) * (-602.029) (-602.697) [-602.597] (-604.331) -- 0:00:55
83000 -- (-600.883) [-605.539] (-604.936) (-604.686) * (-602.030) [-603.242] (-606.037) (-602.868) -- 0:00:55
83500 -- (-601.313) (-601.922) [-603.390] (-601.501) * (-604.521) (-602.395) (-601.637) [-604.377] -- 0:00:54
84000 -- (-603.572) [-601.538] (-601.569) (-603.716) * (-602.712) [-606.296] (-608.557) (-604.439) -- 0:00:54
84500 -- (-603.519) (-601.916) (-602.485) [-601.430] * [-602.147] (-608.238) (-608.268) (-603.324) -- 0:00:54
85000 -- (-602.765) (-602.978) [-603.689] (-603.565) * [-602.060] (-604.774) (-604.826) (-604.561) -- 0:00:53
Average standard deviation of split frequencies: 0.024797
85500 -- (-606.660) (-606.816) [-604.170] (-605.370) * (-602.454) (-601.698) [-602.187] (-601.649) -- 0:00:53
86000 -- (-603.826) (-603.495) (-604.330) [-602.316] * (-603.955) [-602.341] (-602.319) (-602.198) -- 0:00:53
86500 -- (-602.763) [-602.196] (-603.369) (-604.592) * (-604.180) (-603.950) [-602.120] (-602.560) -- 0:00:52
87000 -- (-604.966) [-606.048] (-605.598) (-604.800) * [-603.018] (-601.555) (-602.546) (-603.326) -- 0:01:02
87500 -- [-603.108] (-606.565) (-609.741) (-601.445) * (-604.727) (-601.613) [-603.552] (-603.848) -- 0:01:02
88000 -- [-603.590] (-603.836) (-602.870) (-601.503) * [-601.644] (-602.394) (-609.301) (-603.442) -- 0:01:02
88500 -- [-604.855] (-607.191) (-602.495) (-601.996) * (-605.225) (-603.506) (-601.563) [-603.827] -- 0:01:01
89000 -- (-604.134) [-602.472] (-601.820) (-603.859) * (-606.125) (-602.211) (-607.475) [-603.921] -- 0:01:01
89500 -- (-602.520) [-602.492] (-601.427) (-603.473) * [-603.152] (-601.340) (-603.126) (-606.681) -- 0:01:01
90000 -- (-604.151) (-601.236) [-603.882] (-605.165) * (-602.813) (-601.371) (-602.775) [-602.918] -- 0:01:00
Average standard deviation of split frequencies: 0.023026
90500 -- (-605.120) (-602.514) [-601.991] (-602.569) * [-602.667] (-601.186) (-602.930) (-602.362) -- 0:01:00
91000 -- (-607.428) [-601.956] (-605.289) (-603.264) * [-605.238] (-603.507) (-602.014) (-604.551) -- 0:00:59
91500 -- (-602.494) [-602.326] (-603.354) (-602.632) * [-602.767] (-603.094) (-600.794) (-605.431) -- 0:00:59
92000 -- (-602.401) (-604.900) (-604.031) [-602.064] * (-602.244) (-601.570) [-601.399] (-606.637) -- 0:00:59
92500 -- (-604.761) (-602.565) (-603.206) [-602.700] * (-604.947) [-601.369] (-602.023) (-606.567) -- 0:00:58
93000 -- (-602.555) (-603.122) [-604.969] (-603.469) * (-603.649) (-603.031) [-603.610] (-602.505) -- 0:00:58
93500 -- (-603.473) (-601.629) [-604.949] (-603.749) * (-606.654) (-603.000) (-603.537) [-601.216] -- 0:00:58
94000 -- [-602.333] (-602.898) (-603.552) (-601.763) * (-606.176) (-603.503) (-601.780) [-602.623] -- 0:00:57
94500 -- (-602.935) [-601.268] (-601.193) (-605.438) * (-606.440) (-602.155) [-603.705] (-605.593) -- 0:00:57
95000 -- [-601.864] (-601.465) (-600.831) (-608.476) * (-602.801) (-605.761) (-603.504) [-605.294] -- 0:00:57
Average standard deviation of split frequencies: 0.023383
95500 -- (-604.900) (-601.561) (-600.761) [-601.337] * (-601.742) (-602.024) [-601.905] (-602.813) -- 0:00:56
96000 -- (-604.100) (-614.398) (-601.458) [-600.853] * [-601.150] (-605.589) (-603.411) (-602.669) -- 0:00:56
96500 -- [-605.376] (-603.285) (-601.705) (-604.545) * [-606.204] (-603.388) (-601.366) (-600.947) -- 0:00:56
97000 -- (-603.102) (-602.177) (-601.885) [-605.567] * [-604.039] (-603.067) (-601.782) (-605.630) -- 0:00:55
97500 -- (-602.706) (-603.719) [-601.845] (-605.467) * [-602.744] (-602.215) (-602.046) (-603.573) -- 0:00:55
98000 -- [-600.915] (-602.937) (-602.867) (-603.434) * [-604.008] (-602.551) (-602.128) (-600.879) -- 0:00:55
98500 -- [-603.477] (-606.357) (-603.624) (-603.483) * (-603.763) (-602.058) (-607.721) [-603.881] -- 0:00:54
99000 -- [-602.095] (-604.511) (-604.259) (-601.739) * (-603.241) (-602.311) (-602.020) [-601.387] -- 0:00:54
99500 -- [-602.744] (-604.313) (-601.828) (-602.749) * [-602.526] (-603.484) (-601.501) (-603.651) -- 0:00:54
100000 -- (-602.880) (-602.293) (-601.960) [-606.134] * (-606.260) [-603.169] (-602.179) (-601.677) -- 0:00:54
Average standard deviation of split frequencies: 0.025521
100500 -- (-602.318) (-601.272) [-604.942] (-604.766) * (-608.257) [-604.481] (-603.021) (-600.812) -- 0:00:53
101000 -- (-606.029) [-605.595] (-602.117) (-604.370) * (-601.496) (-606.173) (-601.349) [-602.752] -- 0:00:53
101500 -- (-601.836) [-601.243] (-602.703) (-603.517) * (-602.583) (-601.164) [-601.316] (-603.432) -- 0:00:53
102000 -- (-602.020) [-602.553] (-604.765) (-602.374) * (-601.310) [-602.020] (-604.067) (-607.120) -- 0:00:52
102500 -- (-602.969) [-602.699] (-602.816) (-602.625) * [-604.015] (-602.130) (-601.713) (-606.820) -- 0:00:52
103000 -- [-601.884] (-603.240) (-602.294) (-603.619) * (-601.423) (-601.804) [-602.968] (-606.954) -- 0:00:52
103500 -- (-601.103) (-604.234) (-602.100) [-602.633] * (-601.545) [-605.781] (-606.242) (-602.317) -- 0:00:51
104000 -- (-603.469) (-604.116) [-602.384] (-601.909) * (-601.780) (-604.266) [-601.651] (-602.238) -- 0:01:00
104500 -- (-603.044) (-602.643) [-603.829] (-603.143) * [-603.064] (-603.896) (-606.954) (-602.308) -- 0:00:59
105000 -- (-603.199) [-603.897] (-601.817) (-604.062) * (-606.306) [-603.454] (-601.450) (-604.593) -- 0:00:59
Average standard deviation of split frequencies: 0.022448
105500 -- (-601.427) (-602.231) (-602.114) [-604.590] * (-605.625) (-605.528) [-601.468] (-603.855) -- 0:00:59
106000 -- (-601.733) (-603.206) (-603.595) [-602.306] * [-604.860] (-602.585) (-604.694) (-614.706) -- 0:00:59
106500 -- (-601.411) (-604.486) [-604.429] (-603.107) * [-602.245] (-602.979) (-603.806) (-603.771) -- 0:00:58
107000 -- (-605.901) (-603.276) (-601.250) [-602.420] * [-602.060] (-604.386) (-604.837) (-603.323) -- 0:00:58
107500 -- [-602.131] (-602.950) (-602.332) (-604.940) * [-601.942] (-605.459) (-606.574) (-602.523) -- 0:00:58
108000 -- (-602.228) [-604.029] (-603.695) (-603.728) * (-602.437) (-602.928) (-602.821) [-601.519] -- 0:00:57
108500 -- (-603.165) [-601.571] (-602.627) (-601.621) * (-602.893) [-603.246] (-606.389) (-603.842) -- 0:00:57
109000 -- (-601.347) [-604.781] (-603.142) (-602.183) * (-601.802) [-602.141] (-601.989) (-602.092) -- 0:00:57
109500 -- (-601.919) (-606.909) [-601.717] (-602.494) * (-606.749) [-603.128] (-600.912) (-603.089) -- 0:00:56
110000 -- (-601.198) [-603.856] (-601.325) (-603.569) * (-603.944) (-603.718) (-602.263) [-601.832] -- 0:00:56
Average standard deviation of split frequencies: 0.020446
110500 -- (-602.183) (-601.671) [-601.910] (-602.068) * [-604.026] (-603.220) (-602.598) (-600.863) -- 0:00:56
111000 -- (-601.143) [-604.392] (-603.691) (-601.197) * (-601.314) [-603.675] (-602.184) (-601.204) -- 0:00:56
111500 -- (-601.594) (-608.465) (-604.570) [-600.722] * (-601.122) (-602.919) (-601.708) [-600.925] -- 0:00:55
112000 -- (-607.386) (-600.959) [-603.694] (-601.195) * (-602.191) (-600.875) [-605.863] (-601.370) -- 0:00:55
112500 -- (-602.627) (-605.400) (-603.393) [-602.322] * (-602.431) (-601.534) (-605.466) [-601.595] -- 0:00:55
113000 -- (-602.295) [-605.377] (-602.958) (-601.398) * (-602.436) (-604.773) (-602.530) [-603.070] -- 0:00:54
113500 -- (-602.658) [-603.926] (-604.535) (-601.866) * (-604.374) (-603.536) (-603.319) [-602.506] -- 0:00:54
114000 -- [-601.098] (-604.967) (-603.747) (-601.408) * (-602.413) (-601.499) (-603.482) [-602.123] -- 0:00:54
114500 -- (-602.332) (-604.414) (-601.331) [-600.968] * (-604.881) [-606.235] (-602.169) (-602.378) -- 0:00:54
115000 -- [-605.569] (-605.223) (-603.432) (-601.633) * [-605.178] (-603.320) (-603.263) (-606.251) -- 0:00:53
Average standard deviation of split frequencies: 0.019464
115500 -- (-602.587) (-607.806) (-601.063) [-604.243] * (-602.313) (-603.421) [-602.844] (-605.367) -- 0:00:53
116000 -- [-601.704] (-601.820) (-605.815) (-602.896) * (-605.235) (-603.020) [-605.442] (-601.883) -- 0:00:53
116500 -- (-605.096) (-601.933) [-601.451] (-603.555) * (-601.198) (-603.632) [-601.101] (-606.629) -- 0:00:53
117000 -- [-603.279] (-604.033) (-604.856) (-602.109) * [-601.598] (-602.392) (-601.502) (-605.730) -- 0:00:52
117500 -- (-602.119) (-602.828) [-606.415] (-602.666) * (-602.559) (-602.319) (-602.095) [-602.338] -- 0:00:52
118000 -- (-605.707) (-602.810) [-601.876] (-606.543) * (-603.753) (-602.079) (-601.472) [-603.010] -- 0:00:52
118500 -- (-601.633) (-602.387) [-602.229] (-603.049) * [-605.164] (-602.433) (-601.457) (-601.974) -- 0:00:52
119000 -- (-603.607) [-603.229] (-603.731) (-605.021) * (-604.404) (-608.905) (-602.730) [-602.593] -- 0:00:51
119500 -- (-601.241) (-601.578) [-605.176] (-603.449) * (-601.694) (-605.665) [-604.473] (-603.584) -- 0:00:51
120000 -- [-601.683] (-602.532) (-602.033) (-601.868) * (-603.720) (-604.287) [-603.494] (-601.487) -- 0:00:51
Average standard deviation of split frequencies: 0.020705
120500 -- (-603.262) (-603.588) [-602.040] (-601.304) * [-602.946] (-602.303) (-605.730) (-602.672) -- 0:00:51
121000 -- (-602.567) (-601.020) (-603.010) [-604.408] * (-604.748) (-603.805) (-602.978) [-601.612] -- 0:00:58
121500 -- (-603.549) (-606.053) [-604.862] (-601.727) * [-604.230] (-604.633) (-602.689) (-604.073) -- 0:00:57
122000 -- (-602.477) [-601.944] (-603.903) (-602.725) * [-602.833] (-603.933) (-605.874) (-605.141) -- 0:00:57
122500 -- [-601.680] (-604.374) (-604.361) (-601.833) * (-602.637) (-604.006) [-605.131] (-607.425) -- 0:00:57
123000 -- (-602.036) (-606.096) [-602.264] (-607.428) * (-601.424) [-605.206] (-601.605) (-603.816) -- 0:00:57
123500 -- [-601.725] (-603.630) (-601.733) (-606.025) * (-604.845) (-600.733) (-608.755) [-601.922] -- 0:00:56
124000 -- (-601.548) (-606.608) (-603.185) [-606.958] * (-602.979) (-601.436) (-602.879) [-611.410] -- 0:00:56
124500 -- (-603.027) [-605.232] (-608.209) (-603.500) * [-603.454] (-606.585) (-602.292) (-605.595) -- 0:00:56
125000 -- [-603.458] (-602.546) (-603.527) (-605.101) * (-602.932) (-604.132) [-602.264] (-605.571) -- 0:00:56
Average standard deviation of split frequencies: 0.018172
125500 -- [-602.172] (-604.171) (-603.811) (-603.445) * (-602.306) (-603.728) [-601.925] (-607.838) -- 0:00:55
126000 -- [-605.756] (-604.172) (-604.423) (-602.546) * (-604.454) (-605.331) (-602.210) [-603.781] -- 0:00:55
126500 -- [-602.832] (-603.334) (-608.168) (-601.331) * [-603.183] (-602.883) (-602.025) (-603.816) -- 0:00:55
127000 -- [-604.317] (-606.385) (-604.161) (-603.005) * [-604.200] (-603.078) (-604.885) (-602.028) -- 0:00:54
127500 -- (-605.086) (-604.269) [-603.038] (-603.079) * [-605.361] (-600.952) (-601.434) (-604.975) -- 0:00:54
128000 -- [-603.207] (-601.932) (-605.072) (-603.624) * (-601.810) (-607.872) (-603.015) [-602.061] -- 0:00:54
128500 -- (-602.642) (-603.757) [-604.166] (-604.666) * (-601.678) [-604.402] (-606.871) (-603.766) -- 0:00:54
129000 -- [-602.296] (-603.121) (-605.483) (-602.920) * (-603.192) (-601.913) (-602.198) [-604.507] -- 0:00:54
129500 -- [-604.975] (-603.378) (-605.416) (-606.596) * (-605.806) [-601.656] (-603.083) (-601.851) -- 0:00:53
130000 -- (-603.094) (-602.561) (-605.870) [-604.717] * (-602.003) (-603.363) (-605.613) [-602.281] -- 0:00:53
Average standard deviation of split frequencies: 0.018219
130500 -- [-605.630] (-602.834) (-601.893) (-605.089) * (-602.394) (-605.600) (-601.848) [-602.259] -- 0:00:53
131000 -- (-602.181) (-601.030) (-603.179) [-604.415] * (-602.498) [-606.072] (-600.888) (-603.199) -- 0:00:53
131500 -- (-602.156) (-602.116) [-601.818] (-607.793) * (-603.222) (-602.302) [-601.373] (-602.131) -- 0:00:52
132000 -- [-604.193] (-603.332) (-604.966) (-604.334) * [-603.758] (-603.273) (-602.241) (-606.395) -- 0:00:52
132500 -- (-603.243) [-605.046] (-602.667) (-603.245) * (-602.261) (-602.622) (-605.302) [-603.200] -- 0:00:52
133000 -- (-603.832) (-603.873) (-604.676) [-602.579] * [-605.628] (-602.116) (-601.719) (-604.724) -- 0:00:52
133500 -- (-607.203) [-602.851] (-604.426) (-603.408) * (-608.577) [-601.832] (-604.411) (-601.352) -- 0:00:51
134000 -- (-602.733) [-605.549] (-603.858) (-604.048) * (-607.897) [-603.418] (-601.593) (-603.014) -- 0:00:51
134500 -- (-601.259) (-602.124) (-605.678) [-601.146] * (-603.109) (-601.383) [-601.886] (-601.691) -- 0:00:51
135000 -- [-601.227] (-609.224) (-607.660) (-602.241) * [-601.198] (-603.393) (-604.541) (-602.491) -- 0:00:51
Average standard deviation of split frequencies: 0.018198
135500 -- (-601.646) (-605.961) (-604.076) [-609.023] * (-601.371) [-611.657] (-601.911) (-603.966) -- 0:00:51
136000 -- (-601.445) (-603.327) (-604.150) [-605.235] * (-601.588) (-607.744) [-600.904] (-601.582) -- 0:00:50
136500 -- (-601.089) (-602.753) (-601.079) [-601.865] * (-603.569) (-601.897) [-600.779] (-601.438) -- 0:00:50
137000 -- (-604.526) (-603.576) (-601.399) [-602.907] * [-601.420] (-603.740) (-604.751) (-601.883) -- 0:00:50
137500 -- [-604.100] (-603.832) (-603.251) (-603.613) * (-602.357) [-604.592] (-604.656) (-602.914) -- 0:00:50
138000 -- (-602.318) [-601.519] (-602.800) (-603.673) * (-604.996) (-603.707) (-602.952) [-601.434] -- 0:00:56
138500 -- (-607.801) (-603.172) [-605.289] (-602.613) * (-606.442) [-608.303] (-602.165) (-603.276) -- 0:00:55
139000 -- (-605.120) (-601.716) [-602.562] (-603.116) * (-603.646) (-606.370) [-601.868] (-601.235) -- 0:00:55
139500 -- (-606.225) (-607.333) (-603.417) [-604.537] * [-603.144] (-607.552) (-602.026) (-602.973) -- 0:00:55
140000 -- (-604.924) (-604.356) [-601.184] (-600.988) * (-603.677) (-603.639) [-601.765] (-602.311) -- 0:00:55
Average standard deviation of split frequencies: 0.016589
140500 -- (-605.797) (-602.925) [-602.342] (-603.226) * (-602.762) (-601.422) [-601.325] (-602.785) -- 0:00:55
141000 -- [-601.467] (-609.130) (-601.430) (-603.545) * (-604.169) (-602.141) (-603.255) [-603.510] -- 0:00:54
141500 -- (-602.100) (-604.182) [-601.322] (-602.734) * (-603.334) (-602.837) (-601.413) [-602.754] -- 0:00:54
142000 -- (-601.020) (-605.777) [-600.731] (-602.502) * (-603.860) (-601.900) (-608.344) [-603.189] -- 0:00:54
142500 -- (-603.011) (-603.302) [-604.325] (-604.975) * (-603.149) (-606.793) [-606.478] (-602.399) -- 0:00:54
143000 -- (-601.988) (-602.491) (-603.334) [-601.475] * [-602.613] (-602.375) (-605.663) (-602.437) -- 0:00:53
143500 -- (-602.837) (-602.523) (-601.461) [-605.238] * (-601.597) (-603.011) [-603.241] (-602.288) -- 0:00:53
144000 -- (-604.953) [-602.678] (-603.362) (-603.162) * [-602.471] (-602.346) (-603.021) (-601.821) -- 0:00:53
144500 -- [-602.566] (-605.902) (-603.780) (-603.682) * (-602.649) (-605.387) (-601.641) [-603.725] -- 0:00:53
145000 -- [-602.187] (-603.484) (-603.023) (-602.480) * (-604.193) (-603.432) (-603.562) [-608.297] -- 0:00:53
Average standard deviation of split frequencies: 0.016628
145500 -- (-604.596) (-602.135) [-603.056] (-601.498) * (-606.198) (-603.309) [-603.649] (-603.945) -- 0:00:52
146000 -- (-603.940) (-601.720) [-602.513] (-604.583) * (-604.888) (-602.220) (-602.934) [-603.617] -- 0:00:52
146500 -- (-603.956) (-605.445) [-601.875] (-602.726) * (-603.232) [-603.273] (-604.453) (-604.790) -- 0:00:52
147000 -- (-603.920) [-601.774] (-606.861) (-604.101) * (-602.618) [-602.867] (-603.808) (-603.021) -- 0:00:52
147500 -- (-607.414) [-603.002] (-602.054) (-603.464) * (-606.362) (-603.240) [-601.635] (-604.707) -- 0:00:52
148000 -- (-603.232) (-602.107) (-602.085) [-602.345] * (-608.048) [-602.427] (-604.290) (-603.909) -- 0:00:51
148500 -- (-603.942) [-600.719] (-601.958) (-601.323) * (-605.310) (-601.444) (-603.048) [-605.923] -- 0:00:51
149000 -- (-602.537) (-601.691) [-603.047] (-604.305) * (-605.327) [-601.655] (-604.271) (-604.358) -- 0:00:51
149500 -- [-602.196] (-601.955) (-602.457) (-602.075) * (-601.542) (-602.059) [-602.801] (-601.509) -- 0:00:51
150000 -- [-602.237] (-602.203) (-603.408) (-602.841) * (-602.865) (-601.699) (-603.404) [-604.702] -- 0:00:51
Average standard deviation of split frequencies: 0.015018
150500 -- [-601.514] (-601.836) (-602.819) (-601.890) * (-605.895) (-602.660) (-604.880) [-601.668] -- 0:00:50
151000 -- [-601.853] (-601.968) (-601.093) (-601.694) * (-604.796) [-601.034] (-602.248) (-601.579) -- 0:00:50
151500 -- [-601.342] (-602.079) (-601.436) (-602.934) * (-604.447) (-602.322) (-603.992) [-602.024] -- 0:00:50
152000 -- [-603.019] (-607.391) (-602.402) (-601.772) * (-604.760) (-605.506) [-605.943] (-610.172) -- 0:00:50
152500 -- [-602.209] (-605.533) (-603.655) (-601.709) * [-604.194] (-602.273) (-601.991) (-605.881) -- 0:00:50
153000 -- (-601.904) [-604.351] (-606.249) (-601.536) * (-604.476) (-601.580) [-604.915] (-602.699) -- 0:00:49
153500 -- (-606.013) (-604.996) [-603.788] (-604.185) * (-604.359) (-606.661) [-603.743] (-602.838) -- 0:00:49
154000 -- (-602.762) (-602.249) [-604.097] (-604.099) * (-604.117) [-604.169] (-606.720) (-603.964) -- 0:00:49
154500 -- (-605.438) (-602.147) [-602.076] (-601.247) * (-604.124) (-602.409) [-601.354] (-602.588) -- 0:00:54
155000 -- (-605.384) [-603.862] (-602.749) (-603.883) * (-601.970) (-603.141) (-605.028) [-601.614] -- 0:00:54
Average standard deviation of split frequencies: 0.013749
155500 -- [-600.966] (-601.952) (-602.189) (-603.981) * (-610.386) [-601.782] (-601.164) (-601.685) -- 0:00:54
156000 -- (-602.488) (-603.648) [-601.917] (-604.694) * (-601.582) (-602.750) (-601.377) [-601.452] -- 0:00:54
156500 -- (-604.283) (-601.468) [-603.401] (-609.710) * (-603.407) (-602.167) (-603.085) [-601.936] -- 0:00:53
157000 -- (-605.370) (-602.455) [-603.991] (-606.659) * (-602.128) (-604.705) (-604.751) [-603.065] -- 0:00:53
157500 -- (-607.076) (-603.370) (-602.170) [-606.131] * (-601.927) (-601.158) (-602.176) [-605.152] -- 0:00:53
158000 -- (-605.059) (-603.365) [-602.896] (-602.278) * [-603.477] (-601.610) (-601.983) (-602.388) -- 0:00:53
158500 -- (-606.808) (-602.564) [-604.831] (-602.205) * (-603.576) [-606.061] (-603.352) (-604.323) -- 0:00:53
159000 -- (-606.903) [-601.767] (-601.255) (-602.242) * (-603.165) (-602.093) [-605.837] (-602.940) -- 0:00:52
159500 -- (-608.345) [-603.375] (-602.274) (-602.898) * (-602.039) [-602.391] (-603.184) (-601.230) -- 0:00:52
160000 -- (-608.305) (-604.699) [-603.433] (-607.545) * (-605.104) (-602.645) (-603.528) [-601.176] -- 0:00:52
Average standard deviation of split frequencies: 0.011736
160500 -- (-602.635) (-602.015) (-603.114) [-603.039] * (-604.262) (-605.848) [-601.789] (-601.635) -- 0:00:52
161000 -- [-603.429] (-600.808) (-605.452) (-603.624) * (-603.031) (-603.155) [-601.722] (-601.578) -- 0:00:52
161500 -- (-602.722) (-603.141) (-601.683) [-603.174] * (-608.488) (-601.607) (-605.019) [-600.798] -- 0:00:51
162000 -- (-608.580) (-602.628) (-601.990) [-601.783] * (-602.870) [-601.536] (-604.682) (-601.184) -- 0:00:51
162500 -- (-604.565) (-604.872) (-601.685) [-602.799] * (-606.063) [-601.328] (-602.780) (-601.483) -- 0:00:51
163000 -- (-604.915) [-601.686] (-601.886) (-603.268) * (-604.895) [-601.749] (-605.536) (-604.838) -- 0:00:51
163500 -- (-602.410) (-602.966) (-601.284) [-602.023] * (-603.341) (-601.704) [-600.783] (-605.007) -- 0:00:51
164000 -- [-602.998] (-602.643) (-602.326) (-601.444) * (-601.731) (-603.476) (-601.317) [-603.002] -- 0:00:50
164500 -- (-602.361) [-601.472] (-601.903) (-601.046) * [-603.500] (-601.944) (-605.844) (-603.803) -- 0:00:50
165000 -- (-605.286) [-605.274] (-602.336) (-606.178) * [-606.054] (-602.654) (-604.841) (-603.801) -- 0:00:50
Average standard deviation of split frequencies: 0.013063
165500 -- (-602.262) (-604.935) (-601.302) [-607.660] * (-602.400) (-603.423) [-601.798] (-601.411) -- 0:00:50
166000 -- (-605.690) (-602.419) (-602.917) [-602.744] * [-601.741] (-606.829) (-602.534) (-602.652) -- 0:00:50
166500 -- (-603.693) [-601.437] (-601.668) (-601.013) * [-602.419] (-602.729) (-607.465) (-603.438) -- 0:00:50
167000 -- (-604.523) [-601.578] (-604.801) (-603.375) * [-602.196] (-602.244) (-602.860) (-601.421) -- 0:00:49
167500 -- (-602.477) [-603.975] (-604.014) (-605.466) * [-603.282] (-601.328) (-603.360) (-601.339) -- 0:00:49
168000 -- (-603.224) (-601.535) (-603.767) [-604.005] * (-604.588) (-601.367) [-601.680] (-600.855) -- 0:00:49
168500 -- [-602.146] (-602.404) (-602.721) (-605.427) * (-604.728) [-601.250] (-602.102) (-604.370) -- 0:00:49
169000 -- (-605.324) [-602.088] (-603.139) (-602.557) * [-601.942] (-601.917) (-602.030) (-604.880) -- 0:00:49
169500 -- (-604.854) (-602.988) [-606.265] (-601.810) * (-602.393) (-601.483) [-603.426] (-605.618) -- 0:00:48
170000 -- (-603.002) (-602.898) [-608.209] (-602.171) * (-603.221) [-604.957] (-602.875) (-605.021) -- 0:00:48
Average standard deviation of split frequencies: 0.015054
170500 -- (-604.354) (-602.972) (-603.790) [-601.958] * (-602.628) (-602.273) [-605.406] (-604.461) -- 0:00:48
171000 -- (-602.573) (-603.296) [-603.215] (-606.137) * (-604.844) (-601.200) (-601.376) [-601.854] -- 0:00:48
171500 -- (-602.907) (-606.138) [-602.349] (-601.594) * (-602.733) (-602.689) [-604.029] (-602.024) -- 0:00:48
172000 -- [-603.966] (-603.103) (-604.087) (-602.692) * (-602.803) (-601.754) (-602.221) [-601.835] -- 0:00:52
172500 -- [-604.511] (-601.392) (-602.192) (-604.389) * (-607.389) (-601.437) [-600.726] (-602.531) -- 0:00:52
173000 -- (-604.232) (-602.487) (-603.914) [-601.527] * (-605.402) (-601.390) [-600.909] (-601.897) -- 0:00:52
173500 -- (-602.672) (-606.649) (-601.142) [-604.535] * (-601.702) (-603.240) [-600.706] (-605.180) -- 0:00:52
174000 -- (-601.637) [-604.018] (-601.590) (-602.073) * [-608.746] (-601.088) (-601.832) (-603.254) -- 0:00:52
174500 -- (-601.914) [-603.106] (-605.111) (-603.218) * [-604.851] (-601.523) (-601.858) (-604.034) -- 0:00:52
175000 -- (-602.101) (-606.076) [-601.719] (-603.350) * (-606.485) (-603.920) (-603.723) [-604.913] -- 0:00:51
Average standard deviation of split frequencies: 0.014330
175500 -- (-602.400) (-603.423) [-601.956] (-601.714) * (-602.249) (-601.010) (-601.734) [-606.250] -- 0:00:51
176000 -- [-602.502] (-604.857) (-606.385) (-605.954) * (-603.297) (-602.105) (-601.478) [-602.404] -- 0:00:51
176500 -- (-604.926) (-601.039) (-605.630) [-602.834] * (-603.017) (-610.773) [-601.960] (-607.380) -- 0:00:51
177000 -- [-603.701] (-600.877) (-604.038) (-603.032) * (-602.806) (-605.860) [-606.573] (-602.495) -- 0:00:51
177500 -- (-601.847) (-606.161) (-601.193) [-602.155] * (-607.112) [-603.245] (-603.363) (-602.641) -- 0:00:50
178000 -- (-601.767) [-602.914] (-604.938) (-602.364) * (-603.604) (-602.413) [-606.652] (-602.381) -- 0:00:50
178500 -- (-600.988) (-602.597) [-602.413] (-604.713) * (-603.517) [-610.474] (-603.455) (-604.672) -- 0:00:50
179000 -- (-601.015) (-601.614) (-602.223) [-605.242] * (-601.569) (-603.070) [-602.116] (-604.711) -- 0:00:50
179500 -- (-603.051) [-602.129] (-603.458) (-602.884) * [-601.417] (-608.932) (-605.325) (-603.611) -- 0:00:50
180000 -- (-607.125) [-603.428] (-603.217) (-601.025) * [-601.467] (-608.594) (-604.224) (-603.304) -- 0:00:50
Average standard deviation of split frequencies: 0.014612
180500 -- (-604.039) (-602.286) [-601.181] (-601.083) * (-601.775) (-601.928) (-603.252) [-603.220] -- 0:00:49
181000 -- (-604.581) [-602.174] (-604.433) (-609.307) * (-606.622) [-602.651] (-604.546) (-602.836) -- 0:00:49
181500 -- [-602.638] (-601.590) (-606.704) (-606.975) * (-602.621) [-603.651] (-603.370) (-605.945) -- 0:00:49
182000 -- (-602.920) [-601.461] (-601.896) (-605.165) * [-601.391] (-607.321) (-602.574) (-604.292) -- 0:00:49
182500 -- (-601.917) [-602.484] (-601.160) (-602.362) * [-604.356] (-602.068) (-602.381) (-602.914) -- 0:00:49
183000 -- (-606.520) [-603.415] (-601.392) (-601.907) * (-605.498) [-603.243] (-603.179) (-602.262) -- 0:00:49
183500 -- (-602.774) (-602.594) (-602.810) [-603.938] * (-607.173) [-601.200] (-604.352) (-602.141) -- 0:00:48
184000 -- (-606.308) [-601.840] (-603.432) (-602.840) * (-603.336) [-601.508] (-604.569) (-602.837) -- 0:00:48
184500 -- [-602.359] (-601.968) (-602.586) (-603.148) * [-604.411] (-603.859) (-602.610) (-602.495) -- 0:00:48
185000 -- (-601.867) (-603.782) [-602.226] (-607.423) * (-603.031) (-608.164) [-604.555] (-602.335) -- 0:00:48
Average standard deviation of split frequencies: 0.014700
185500 -- (-602.260) (-603.771) [-604.794] (-603.950) * [-602.487] (-604.958) (-604.015) (-601.227) -- 0:00:48
186000 -- (-602.337) [-605.401] (-603.386) (-604.032) * (-601.201) (-603.170) (-603.115) [-601.136] -- 0:00:48
186500 -- [-601.626] (-603.734) (-603.515) (-606.416) * (-602.110) (-603.891) (-601.868) [-603.838] -- 0:00:47
187000 -- (-601.487) (-604.731) [-602.765] (-605.440) * (-602.969) (-601.825) [-604.362] (-602.251) -- 0:00:47
187500 -- (-602.334) (-604.478) [-603.261] (-603.492) * (-603.799) (-602.280) [-601.499] (-602.896) -- 0:00:47
188000 -- [-602.152] (-602.698) (-601.591) (-603.492) * [-602.669] (-608.501) (-603.447) (-601.682) -- 0:00:47
188500 -- (-604.411) (-601.571) (-602.915) [-604.184] * (-604.683) (-603.436) [-603.747] (-601.310) -- 0:00:47
189000 -- (-600.880) (-601.363) [-603.989] (-604.460) * (-606.568) (-603.410) [-604.226] (-601.043) -- 0:00:47
189500 -- (-605.136) (-601.435) (-602.162) [-602.598] * (-604.759) [-602.751] (-602.722) (-603.403) -- 0:00:51
190000 -- [-602.780] (-604.581) (-602.189) (-602.900) * (-603.348) (-602.205) [-603.282] (-603.593) -- 0:00:51
Average standard deviation of split frequencies: 0.015947
190500 -- (-603.201) [-601.753] (-600.935) (-603.944) * [-606.152] (-604.889) (-602.784) (-605.458) -- 0:00:50
191000 -- [-602.519] (-603.103) (-604.897) (-601.624) * (-602.234) (-607.329) [-601.786] (-603.933) -- 0:00:50
191500 -- (-604.610) (-603.089) [-601.720] (-601.868) * (-604.759) (-600.805) (-602.449) [-606.396] -- 0:00:50
192000 -- (-606.567) (-605.236) [-603.610] (-605.001) * (-602.280) (-603.187) (-605.772) [-603.652] -- 0:00:50
192500 -- (-604.487) [-605.206] (-603.608) (-605.798) * (-602.484) (-603.883) [-602.660] (-603.009) -- 0:00:50
193000 -- (-601.538) (-605.304) [-604.457] (-605.073) * [-600.849] (-602.983) (-612.245) (-601.940) -- 0:00:50
193500 -- (-602.370) [-602.754] (-603.021) (-601.888) * [-601.017] (-603.621) (-605.065) (-605.517) -- 0:00:50
194000 -- (-601.723) (-601.124) [-602.530] (-607.288) * (-604.758) (-602.897) [-602.394] (-603.352) -- 0:00:49
194500 -- [-602.220] (-601.754) (-603.054) (-601.945) * (-603.338) (-601.305) (-605.598) [-605.301] -- 0:00:49
195000 -- (-604.115) (-602.553) [-603.354] (-603.881) * [-602.390] (-602.070) (-607.065) (-604.019) -- 0:00:49
Average standard deviation of split frequencies: 0.016456
195500 -- (-603.880) (-604.113) (-605.724) [-602.798] * [-602.063] (-602.275) (-602.490) (-603.376) -- 0:00:49
196000 -- (-607.248) (-602.607) (-604.946) [-603.480] * (-602.347) (-605.101) [-605.150] (-601.640) -- 0:00:49
196500 -- [-602.136] (-601.132) (-603.931) (-604.851) * (-603.630) [-603.081] (-604.406) (-602.237) -- 0:00:49
197000 -- (-601.633) [-602.684] (-604.504) (-602.615) * [-606.931] (-602.567) (-605.750) (-602.589) -- 0:00:48
197500 -- (-602.328) (-602.476) [-606.267] (-601.353) * (-607.958) (-601.073) (-602.332) [-601.395] -- 0:00:48
198000 -- (-602.465) [-601.356] (-606.115) (-604.017) * (-607.739) (-601.814) [-602.191] (-601.728) -- 0:00:48
198500 -- (-603.435) (-603.533) (-606.694) [-603.574] * [-603.417] (-604.972) (-602.851) (-602.319) -- 0:00:48
199000 -- (-604.983) (-602.866) (-602.905) [-604.913] * (-604.030) (-602.714) [-602.799] (-602.041) -- 0:00:48
199500 -- (-602.085) (-605.841) [-603.960] (-604.852) * (-602.378) (-605.363) [-602.136] (-601.228) -- 0:00:48
200000 -- [-602.931] (-602.520) (-603.073) (-602.597) * (-604.385) (-602.389) [-604.540] (-603.043) -- 0:00:48
Average standard deviation of split frequencies: 0.014342
200500 -- (-601.520) [-603.689] (-604.834) (-601.662) * [-602.234] (-605.469) (-608.606) (-604.403) -- 0:00:47
201000 -- (-601.748) (-602.018) (-600.830) [-602.264] * (-603.172) (-602.896) (-603.128) [-603.213] -- 0:00:47
201500 -- (-606.645) (-604.017) [-603.383] (-606.197) * (-603.934) (-603.471) [-602.815] (-604.542) -- 0:00:47
202000 -- (-606.833) (-602.394) (-607.644) [-601.778] * (-603.386) (-602.962) (-602.642) [-602.038] -- 0:00:47
202500 -- (-607.274) (-603.418) [-602.449] (-603.599) * (-602.389) [-605.403] (-603.892) (-602.414) -- 0:00:51
203000 -- (-602.297) [-602.333] (-605.828) (-602.212) * (-604.899) (-609.878) (-604.423) [-601.033] -- 0:00:51
203500 -- (-602.637) (-603.344) (-603.040) [-602.966] * (-609.748) (-602.451) [-604.659] (-604.899) -- 0:00:50
204000 -- (-603.244) [-604.108] (-601.027) (-601.377) * (-604.124) (-603.436) [-601.380] (-602.911) -- 0:00:50
204500 -- (-601.908) (-601.944) [-601.144] (-601.920) * (-608.754) [-601.936] (-603.040) (-602.988) -- 0:00:50
205000 -- (-602.541) [-602.313] (-601.752) (-603.148) * (-607.459) (-601.640) [-602.013] (-601.172) -- 0:00:50
Average standard deviation of split frequencies: 0.013008
205500 -- [-605.950] (-601.105) (-601.215) (-601.503) * [-604.305] (-602.075) (-601.234) (-602.711) -- 0:00:50
206000 -- (-602.861) (-614.882) [-601.931] (-601.942) * (-605.427) (-605.178) [-601.939] (-604.440) -- 0:00:50
206500 -- (-606.483) [-603.005] (-604.455) (-603.567) * [-603.191] (-604.682) (-602.041) (-601.407) -- 0:00:49
207000 -- [-604.954] (-604.731) (-603.369) (-607.688) * [-601.708] (-604.415) (-604.152) (-602.422) -- 0:00:49
207500 -- (-606.136) (-603.133) (-601.221) [-606.438] * (-604.398) (-602.922) [-602.353] (-605.533) -- 0:00:49
208000 -- (-603.732) [-602.447] (-602.003) (-605.118) * (-601.491) [-603.786] (-605.173) (-602.191) -- 0:00:49
208500 -- (-604.188) [-602.215] (-601.021) (-602.840) * [-602.259] (-604.559) (-607.695) (-607.788) -- 0:00:49
209000 -- [-603.415] (-606.881) (-601.925) (-601.334) * [-604.182] (-604.244) (-603.344) (-602.234) -- 0:00:49
209500 -- (-606.777) (-602.490) [-604.589] (-602.326) * (-604.474) (-604.175) (-603.145) [-602.067] -- 0:00:49
210000 -- [-602.349] (-602.099) (-602.493) (-601.298) * (-602.223) (-601.504) (-602.351) [-601.774] -- 0:00:48
Average standard deviation of split frequencies: 0.012719
210500 -- (-601.700) (-605.850) (-602.519) [-601.657] * (-601.975) (-602.262) (-608.186) [-602.009] -- 0:00:48
211000 -- (-601.381) [-602.920] (-603.452) (-603.535) * [-604.102] (-603.389) (-603.359) (-601.702) -- 0:00:48
211500 -- (-602.487) [-604.347] (-602.868) (-601.902) * (-603.658) [-604.195] (-602.875) (-603.973) -- 0:00:48
212000 -- (-603.618) (-603.497) (-602.006) [-603.308] * (-601.253) (-608.979) (-607.635) [-606.113] -- 0:00:48
212500 -- (-605.710) (-606.716) (-601.957) [-601.829] * [-603.086] (-604.719) (-603.532) (-608.858) -- 0:00:48
213000 -- [-606.479] (-605.957) (-608.147) (-602.459) * (-608.030) (-602.941) [-604.854] (-605.275) -- 0:00:48
213500 -- (-605.438) [-604.344] (-602.237) (-603.665) * (-601.554) [-601.571] (-602.669) (-602.788) -- 0:00:47
214000 -- (-603.859) (-604.716) (-604.692) [-602.225] * (-602.405) (-603.540) [-602.257] (-605.436) -- 0:00:47
214500 -- [-601.697] (-603.514) (-603.419) (-602.047) * (-604.898) (-603.887) (-601.933) [-603.177] -- 0:00:47
215000 -- (-602.886) (-603.020) [-601.956] (-602.220) * (-601.791) (-604.019) (-602.434) [-601.877] -- 0:00:47
Average standard deviation of split frequencies: 0.013899
215500 -- (-602.062) (-606.207) (-601.225) [-603.116] * (-602.557) (-604.136) (-601.857) [-600.840] -- 0:00:47
216000 -- [-601.968] (-603.107) (-604.171) (-605.557) * (-604.828) (-605.081) (-602.605) [-605.049] -- 0:00:47
216500 -- (-603.450) (-602.752) (-613.484) [-600.793] * (-601.961) [-604.391] (-601.194) (-601.247) -- 0:00:47
217000 -- (-608.139) [-601.094] (-602.879) (-603.634) * (-601.774) (-603.622) [-604.738] (-603.500) -- 0:00:46
217500 -- (-607.354) [-601.153] (-603.789) (-602.125) * (-606.206) (-607.155) [-605.348] (-601.091) -- 0:00:46
218000 -- (-603.236) (-601.498) (-600.984) [-606.493] * (-607.020) (-603.530) (-601.112) [-602.570] -- 0:00:46
218500 -- [-604.633] (-601.703) (-602.838) (-602.453) * [-607.825] (-602.713) (-602.248) (-601.657) -- 0:00:50
219000 -- (-606.971) (-604.837) (-602.732) [-602.318] * (-602.543) [-601.751] (-604.562) (-603.029) -- 0:00:49
219500 -- (-601.860) [-604.306] (-601.624) (-604.017) * (-603.493) [-603.650] (-605.767) (-602.722) -- 0:00:49
220000 -- [-601.722] (-604.027) (-603.188) (-606.342) * (-605.203) (-602.292) (-606.730) [-601.972] -- 0:00:49
Average standard deviation of split frequencies: 0.014717
220500 -- (-601.622) (-605.159) [-603.073] (-604.430) * (-603.369) (-605.001) [-605.018] (-603.060) -- 0:00:49
221000 -- (-602.187) (-604.864) (-605.237) [-601.898] * (-604.643) [-608.757] (-603.285) (-602.350) -- 0:00:49
221500 -- (-601.879) (-601.651) (-602.490) [-603.914] * (-604.260) (-606.983) [-604.206] (-603.598) -- 0:00:49
222000 -- (-605.735) [-604.497] (-600.942) (-605.331) * [-602.723] (-606.446) (-605.631) (-604.946) -- 0:00:49
222500 -- (-604.014) [-602.848] (-601.450) (-601.896) * (-602.893) (-603.596) (-603.099) [-602.164] -- 0:00:48
223000 -- (-602.943) [-601.358] (-602.604) (-602.482) * (-602.910) (-604.267) (-603.970) [-602.899] -- 0:00:48
223500 -- (-601.896) (-603.644) (-601.702) [-604.051] * (-607.281) [-602.898] (-602.339) (-603.983) -- 0:00:48
224000 -- (-601.093) (-604.901) [-601.841] (-603.403) * (-605.005) (-602.903) (-602.254) [-605.067] -- 0:00:48
224500 -- (-600.695) (-609.682) [-600.988] (-603.398) * (-606.104) (-602.732) (-600.813) [-604.167] -- 0:00:48
225000 -- (-601.219) (-605.280) [-602.148] (-602.157) * (-602.825) [-601.807] (-600.885) (-603.462) -- 0:00:48
Average standard deviation of split frequencies: 0.013767
225500 -- (-600.809) (-603.085) [-604.058] (-602.308) * [-607.252] (-601.467) (-602.617) (-605.433) -- 0:00:48
226000 -- [-602.086] (-602.904) (-602.720) (-601.669) * (-606.281) [-601.722] (-601.933) (-601.778) -- 0:00:47
226500 -- [-600.884] (-602.083) (-600.718) (-602.159) * [-603.739] (-601.196) (-604.200) (-601.906) -- 0:00:47
227000 -- (-603.533) (-602.921) (-606.294) [-604.358] * (-605.205) (-604.349) (-603.633) [-602.870] -- 0:00:47
227500 -- (-604.402) [-603.813] (-605.117) (-600.929) * [-601.946] (-602.809) (-604.659) (-602.990) -- 0:00:47
228000 -- (-605.759) (-601.245) [-604.202] (-604.456) * (-602.600) (-605.289) [-603.248] (-602.281) -- 0:00:47
228500 -- (-604.178) [-601.224] (-606.483) (-601.223) * [-601.853] (-602.686) (-602.021) (-602.937) -- 0:00:47
229000 -- (-604.165) (-604.638) [-602.538] (-601.269) * [-606.500] (-602.524) (-601.874) (-603.977) -- 0:00:47
229500 -- (-601.529) (-604.375) (-602.658) [-605.151] * (-603.232) (-604.249) [-601.962] (-603.896) -- 0:00:47
230000 -- (-603.000) (-606.247) (-603.689) [-601.787] * (-605.245) (-604.397) [-601.407] (-601.558) -- 0:00:46
Average standard deviation of split frequencies: 0.014646
230500 -- (-603.827) (-604.544) (-603.299) [-601.620] * (-601.528) (-604.442) (-602.025) [-601.491] -- 0:00:46
231000 -- (-604.627) (-601.324) [-602.111] (-604.373) * [-603.216] (-601.167) (-604.046) (-601.499) -- 0:00:46
231500 -- (-603.350) (-602.631) (-602.337) [-604.222] * [-602.402] (-603.227) (-603.455) (-601.534) -- 0:00:46
232000 -- (-604.400) (-603.006) [-604.894] (-605.173) * (-603.003) [-601.416] (-607.109) (-602.264) -- 0:00:46
232500 -- (-602.108) (-603.815) [-603.308] (-602.395) * [-603.294] (-601.177) (-601.184) (-602.770) -- 0:00:46
233000 -- (-602.584) (-609.025) [-603.268] (-602.603) * (-602.872) (-601.395) (-605.065) [-604.644] -- 0:00:46
233500 -- (-603.081) [-603.155] (-604.598) (-601.598) * (-603.822) (-602.335) [-601.777] (-605.638) -- 0:00:45
234000 -- (-602.388) [-601.817] (-604.645) (-604.125) * (-607.349) (-603.669) (-604.331) [-602.981] -- 0:00:45
234500 -- (-602.774) (-603.445) [-603.876] (-601.960) * (-601.759) (-604.395) (-603.281) [-601.880] -- 0:00:45
235000 -- [-601.669] (-601.707) (-604.081) (-602.371) * (-601.247) (-601.749) (-602.497) [-602.045] -- 0:00:45
Average standard deviation of split frequencies: 0.013141
235500 -- (-604.661) (-603.016) [-604.176] (-603.710) * (-602.586) (-604.337) (-602.728) [-602.843] -- 0:00:48
236000 -- [-608.243] (-600.986) (-605.291) (-602.745) * (-601.381) (-603.517) (-607.314) [-608.279] -- 0:00:48
236500 -- (-601.444) (-601.148) (-602.581) [-602.357] * (-601.132) [-601.243] (-607.586) (-605.539) -- 0:00:48
237000 -- (-603.955) [-602.357] (-604.506) (-602.142) * (-604.163) [-603.063] (-606.286) (-601.557) -- 0:00:48
237500 -- (-601.858) (-603.522) [-603.417] (-601.688) * [-600.905] (-605.918) (-603.884) (-609.317) -- 0:00:48
238000 -- (-603.670) [-604.285] (-606.464) (-602.141) * (-602.254) [-601.489] (-602.958) (-602.340) -- 0:00:48
238500 -- (-604.018) [-602.371] (-604.975) (-604.627) * (-603.739) (-601.882) (-608.067) [-602.531] -- 0:00:47
239000 -- (-602.140) (-604.041) (-604.576) [-601.672] * (-602.966) (-602.464) [-610.394] (-601.602) -- 0:00:47
239500 -- [-602.147] (-603.385) (-603.255) (-602.046) * (-602.616) (-604.865) [-602.694] (-602.106) -- 0:00:47
240000 -- [-603.241] (-602.949) (-602.618) (-605.342) * (-604.320) (-603.450) (-602.764) [-605.105] -- 0:00:47
Average standard deviation of split frequencies: 0.012487
240500 -- (-601.685) [-604.692] (-605.824) (-604.839) * (-602.474) (-602.398) (-604.271) [-602.380] -- 0:00:47
241000 -- [-601.450] (-604.393) (-604.759) (-601.594) * [-605.254] (-602.480) (-602.443) (-602.731) -- 0:00:47
241500 -- [-602.393] (-601.827) (-602.007) (-601.344) * [-602.178] (-605.313) (-601.868) (-601.623) -- 0:00:47
242000 -- (-605.956) [-602.543] (-605.974) (-602.716) * (-601.019) (-602.294) (-602.200) [-605.772] -- 0:00:46
242500 -- (-603.085) (-602.954) (-603.019) [-608.799] * (-603.925) (-605.504) (-602.536) [-604.218] -- 0:00:46
243000 -- (-601.959) (-604.046) (-602.095) [-601.537] * (-602.407) [-604.520] (-601.761) (-606.113) -- 0:00:46
243500 -- [-601.246] (-607.628) (-604.153) (-603.513) * (-603.285) (-605.283) [-606.366] (-601.960) -- 0:00:46
244000 -- (-601.870) (-606.745) (-602.274) [-602.160] * (-604.034) (-602.069) (-601.959) [-603.327] -- 0:00:46
244500 -- (-601.870) (-602.780) (-603.713) [-602.639] * (-607.049) [-603.591] (-601.870) (-601.595) -- 0:00:46
245000 -- (-605.158) (-604.563) (-601.384) [-604.247] * [-601.858] (-602.551) (-603.635) (-602.300) -- 0:00:46
Average standard deviation of split frequencies: 0.013989
245500 -- (-604.417) [-605.079] (-603.642) (-601.965) * [-601.458] (-602.155) (-602.605) (-604.246) -- 0:00:46
246000 -- (-603.983) [-604.221] (-604.664) (-605.824) * (-603.475) [-603.397] (-607.990) (-601.615) -- 0:00:45
246500 -- (-605.525) (-601.955) [-602.254] (-606.300) * (-604.274) (-601.398) [-605.856] (-607.866) -- 0:00:45
247000 -- (-603.333) (-604.665) [-605.052] (-603.248) * (-605.277) (-603.610) [-602.571] (-602.559) -- 0:00:45
247500 -- (-605.409) (-601.581) [-601.767] (-604.779) * (-604.685) (-602.060) [-602.724] (-601.861) -- 0:00:45
248000 -- (-604.788) [-601.948] (-604.710) (-602.802) * [-604.662] (-601.521) (-603.361) (-605.369) -- 0:00:45
248500 -- [-604.977] (-605.511) (-602.742) (-601.871) * (-602.763) (-603.546) [-605.664] (-606.130) -- 0:00:45
249000 -- (-601.388) (-603.740) [-602.820] (-605.443) * (-606.394) (-602.566) (-602.801) [-603.925] -- 0:00:45
249500 -- (-601.740) [-604.574] (-602.428) (-605.893) * (-603.145) [-601.100] (-605.046) (-602.451) -- 0:00:45
250000 -- (-602.681) (-607.161) (-606.218) [-602.420] * (-602.387) (-601.566) (-601.906) [-601.404] -- 0:00:45
Average standard deviation of split frequencies: 0.013446
250500 -- (-601.067) (-602.078) (-604.108) [-601.631] * (-604.756) (-601.598) [-601.779] (-604.054) -- 0:00:44
251000 -- [-603.015] (-603.995) (-603.350) (-603.505) * (-604.184) [-604.069] (-601.407) (-602.067) -- 0:00:44
251500 -- (-604.029) (-601.914) [-601.626] (-606.166) * (-604.940) (-601.053) (-603.463) [-604.184] -- 0:00:44
252000 -- (-601.418) (-604.537) (-602.855) [-603.190] * [-602.752] (-600.875) (-601.649) (-602.327) -- 0:00:44
252500 -- [-603.550] (-605.241) (-601.905) (-608.387) * (-601.978) [-600.732] (-601.880) (-604.067) -- 0:00:47
253000 -- (-607.858) [-602.086] (-603.325) (-609.041) * (-605.316) (-600.887) (-607.313) [-603.030] -- 0:00:47
253500 -- (-603.349) [-602.338] (-602.675) (-603.422) * (-602.492) (-601.977) [-608.634] (-604.818) -- 0:00:47
254000 -- (-603.338) (-603.964) (-601.185) [-602.862] * [-602.373] (-601.644) (-601.163) (-602.811) -- 0:00:46
254500 -- (-604.647) (-609.805) (-606.248) [-607.072] * (-601.388) [-604.603] (-601.751) (-601.937) -- 0:00:46
255000 -- [-601.896] (-613.307) (-602.260) (-604.823) * (-604.243) [-602.939] (-601.520) (-602.427) -- 0:00:46
Average standard deviation of split frequencies: 0.013166
255500 -- (-603.505) (-602.236) (-602.768) [-605.663] * [-604.985] (-605.881) (-603.975) (-602.409) -- 0:00:46
256000 -- [-603.284] (-602.331) (-602.219) (-601.600) * [-603.429] (-604.645) (-604.205) (-601.976) -- 0:00:46
256500 -- (-602.534) (-605.052) [-602.524] (-601.390) * (-603.212) [-604.512] (-601.605) (-602.024) -- 0:00:46
257000 -- (-601.093) (-604.080) (-602.905) [-601.124] * [-606.636] (-608.984) (-605.127) (-601.430) -- 0:00:46
257500 -- (-601.323) (-603.953) (-604.780) [-602.418] * (-601.814) (-604.467) (-607.992) [-600.952] -- 0:00:46
258000 -- (-603.682) (-601.338) [-601.977] (-603.903) * [-603.947] (-606.973) (-606.243) (-603.270) -- 0:00:46
258500 -- (-605.257) [-603.424] (-603.050) (-602.933) * (-605.938) [-603.013] (-605.008) (-604.327) -- 0:00:45
259000 -- [-603.937] (-604.258) (-613.629) (-602.048) * (-602.182) [-601.301] (-606.547) (-601.570) -- 0:00:45
259500 -- (-602.872) (-603.806) (-608.040) [-604.349] * (-603.844) (-601.646) [-603.722] (-601.308) -- 0:00:45
260000 -- [-602.705] (-605.937) (-603.636) (-606.288) * (-601.896) (-602.215) (-601.521) [-602.114] -- 0:00:45
Average standard deviation of split frequencies: 0.015419
260500 -- (-600.834) (-603.830) [-602.498] (-605.168) * (-604.379) [-605.511] (-601.187) (-606.275) -- 0:00:45
261000 -- (-604.551) [-601.180] (-604.165) (-603.164) * (-603.160) (-604.053) [-602.543] (-603.274) -- 0:00:45
261500 -- (-602.004) (-601.571) (-602.726) [-601.297] * (-601.680) (-605.771) (-602.452) [-602.063] -- 0:00:45
262000 -- (-602.409) (-604.344) (-607.221) [-602.918] * (-604.619) (-605.903) [-603.950] (-601.876) -- 0:00:45
262500 -- (-603.102) (-605.043) [-603.242] (-602.877) * (-607.025) (-602.460) [-602.462] (-602.179) -- 0:00:44
263000 -- [-602.836] (-602.660) (-604.476) (-605.685) * (-601.048) (-609.540) (-606.124) [-601.287] -- 0:00:44
263500 -- (-601.312) (-604.200) (-603.982) [-603.525] * (-602.652) [-601.157] (-602.471) (-604.911) -- 0:00:44
264000 -- (-601.246) (-601.115) (-605.140) [-601.462] * (-601.675) [-602.853] (-602.430) (-602.610) -- 0:00:44
264500 -- [-602.827] (-603.969) (-605.303) (-602.621) * [-601.027] (-601.963) (-602.571) (-603.791) -- 0:00:44
265000 -- [-602.644] (-604.126) (-600.976) (-603.994) * (-601.203) (-603.561) [-601.763] (-605.718) -- 0:00:44
Average standard deviation of split frequencies: 0.015670
265500 -- (-603.587) (-601.454) (-604.040) [-601.690] * [-601.392] (-601.364) (-601.454) (-601.810) -- 0:00:44
266000 -- (-605.542) [-602.122] (-601.996) (-608.241) * (-601.351) [-602.149] (-602.900) (-601.461) -- 0:00:44
266500 -- (-605.294) [-601.265] (-607.026) (-603.644) * [-602.984] (-601.978) (-601.326) (-602.088) -- 0:00:44
267000 -- (-600.788) (-601.953) [-607.577] (-606.262) * (-604.568) (-601.603) [-601.571] (-603.013) -- 0:00:43
267500 -- [-601.287] (-603.889) (-604.421) (-604.183) * (-605.115) [-602.540] (-607.731) (-604.853) -- 0:00:43
268000 -- (-606.037) (-605.462) (-605.299) [-604.255] * [-603.081] (-602.070) (-602.923) (-603.326) -- 0:00:43
268500 -- (-606.011) (-606.603) [-603.239] (-603.425) * (-601.723) (-601.077) [-602.491] (-604.342) -- 0:00:43
269000 -- (-603.988) [-606.324] (-602.167) (-606.470) * [-602.077] (-601.385) (-603.532) (-604.730) -- 0:00:43
269500 -- (-602.291) [-602.453] (-602.928) (-602.855) * (-603.160) [-602.536] (-602.216) (-603.458) -- 0:00:46
270000 -- (-603.749) [-602.746] (-602.247) (-604.724) * (-607.540) [-603.279] (-600.857) (-602.116) -- 0:00:45
Average standard deviation of split frequencies: 0.015288
270500 -- (-602.629) [-604.083] (-601.412) (-603.283) * [-602.884] (-601.046) (-601.119) (-609.747) -- 0:00:45
271000 -- [-602.744] (-601.803) (-605.073) (-605.999) * (-601.808) (-601.162) (-605.935) [-605.970] -- 0:00:45
271500 -- (-604.048) (-601.791) [-602.482] (-609.668) * (-601.435) (-602.355) (-606.680) [-605.253] -- 0:00:45
272000 -- (-606.037) [-602.900] (-602.107) (-611.040) * (-602.844) (-602.397) [-601.371] (-605.122) -- 0:00:45
272500 -- (-603.368) (-604.053) (-604.903) [-603.982] * (-604.190) [-602.458] (-602.567) (-608.896) -- 0:00:45
273000 -- (-605.179) (-606.808) (-602.481) [-605.058] * (-606.852) (-607.477) (-604.677) [-602.572] -- 0:00:45
273500 -- (-605.253) (-602.420) [-603.312] (-603.016) * (-601.429) (-604.948) [-603.759] (-604.043) -- 0:00:45
274000 -- (-606.503) [-604.082] (-602.290) (-601.117) * (-601.884) [-604.858] (-601.925) (-603.135) -- 0:00:45
274500 -- (-605.386) (-602.385) (-602.140) [-601.284] * [-603.771] (-603.706) (-603.083) (-602.148) -- 0:00:44
275000 -- [-601.688] (-605.094) (-604.060) (-601.877) * (-603.037) (-604.040) [-604.745] (-603.648) -- 0:00:44
Average standard deviation of split frequencies: 0.016036
275500 -- [-601.707] (-602.721) (-602.830) (-601.549) * (-604.321) (-605.976) (-602.423) [-601.940] -- 0:00:44
276000 -- [-604.151] (-602.447) (-605.250) (-601.071) * (-604.488) [-603.558] (-602.130) (-603.131) -- 0:00:44
276500 -- (-601.239) [-601.580] (-602.915) (-602.844) * (-604.357) (-604.289) [-608.442] (-604.212) -- 0:00:44
277000 -- (-604.611) [-603.515] (-603.585) (-604.902) * (-603.416) [-602.591] (-603.198) (-604.281) -- 0:00:44
277500 -- [-601.167] (-603.536) (-602.957) (-603.804) * (-606.058) [-601.405] (-602.215) (-604.968) -- 0:00:44
278000 -- [-603.163] (-602.935) (-606.864) (-607.114) * (-602.758) (-604.305) (-601.367) [-608.015] -- 0:00:44
278500 -- [-603.292] (-604.873) (-603.187) (-603.564) * (-601.967) (-608.318) [-601.211] (-605.501) -- 0:00:44
279000 -- (-603.733) (-601.400) [-605.797] (-601.613) * (-602.989) (-604.346) (-601.055) [-610.222] -- 0:00:43
279500 -- [-604.666] (-605.432) (-604.666) (-601.437) * (-602.021) (-607.471) [-604.866] (-608.346) -- 0:00:43
280000 -- [-605.457] (-603.938) (-604.133) (-601.457) * (-602.531) [-604.360] (-601.470) (-608.792) -- 0:00:43
Average standard deviation of split frequencies: 0.015769
280500 -- [-603.548] (-603.904) (-602.976) (-602.895) * (-603.340) [-601.353] (-603.209) (-609.278) -- 0:00:43
281000 -- [-603.156] (-603.038) (-605.426) (-602.439) * (-603.507) [-601.738] (-604.868) (-609.021) -- 0:00:43
281500 -- (-604.027) (-601.502) (-602.891) [-602.327] * (-602.223) (-602.572) (-602.390) [-603.770] -- 0:00:43
282000 -- [-606.247] (-603.583) (-602.706) (-601.025) * (-603.272) (-606.667) (-602.323) [-602.330] -- 0:00:43
282500 -- [-602.302] (-603.436) (-602.083) (-603.931) * (-602.127) [-603.960] (-601.984) (-602.090) -- 0:00:43
283000 -- (-601.989) [-601.768] (-601.557) (-605.994) * (-602.373) [-605.113] (-604.524) (-602.323) -- 0:00:43
283500 -- [-602.523] (-605.147) (-601.683) (-601.411) * (-608.587) (-606.259) (-609.331) [-603.913] -- 0:00:42
284000 -- (-602.446) (-601.492) [-602.556] (-603.044) * (-606.792) (-602.099) (-607.758) [-601.075] -- 0:00:42
284500 -- [-602.544] (-603.629) (-603.561) (-603.701) * [-604.374] (-603.954) (-603.038) (-601.905) -- 0:00:42
285000 -- [-601.534] (-603.790) (-601.999) (-601.540) * (-606.715) (-602.741) (-603.874) [-603.533] -- 0:00:42
Average standard deviation of split frequencies: 0.016222
285500 -- [-602.253] (-603.248) (-601.225) (-601.627) * (-604.057) [-603.268] (-605.392) (-602.629) -- 0:00:42
286000 -- [-601.207] (-602.233) (-603.410) (-604.007) * (-603.223) [-601.746] (-603.246) (-603.518) -- 0:00:42
286500 -- (-602.715) (-603.137) [-602.692] (-604.196) * (-603.236) (-603.054) [-602.569] (-603.498) -- 0:00:44
287000 -- (-602.248) [-601.544] (-601.837) (-601.905) * (-602.958) (-602.197) [-603.983] (-607.389) -- 0:00:44
287500 -- (-601.437) [-601.751] (-606.825) (-605.296) * [-602.588] (-608.011) (-602.016) (-604.303) -- 0:00:44
288000 -- (-602.538) [-601.313] (-602.698) (-602.876) * (-601.951) (-601.759) [-603.338] (-601.448) -- 0:00:44
288500 -- (-604.376) [-600.926] (-601.838) (-602.975) * (-600.830) [-602.169] (-601.816) (-603.116) -- 0:00:44
289000 -- (-605.303) (-601.018) [-602.514] (-601.614) * (-603.396) (-604.373) (-603.250) [-603.044] -- 0:00:44
289500 -- (-605.545) (-601.340) [-604.880] (-603.428) * [-603.696] (-605.986) (-604.568) (-602.643) -- 0:00:44
290000 -- [-603.568] (-602.057) (-603.566) (-605.547) * [-603.283] (-607.270) (-603.918) (-605.527) -- 0:00:44
Average standard deviation of split frequencies: 0.016559
290500 -- [-603.251] (-602.870) (-605.013) (-604.667) * (-602.214) (-606.550) [-603.044] (-608.085) -- 0:00:43
291000 -- (-606.617) (-602.655) (-606.508) [-604.062] * (-603.119) [-601.719] (-600.774) (-607.045) -- 0:00:43
291500 -- (-604.957) (-601.579) [-604.119] (-602.005) * (-601.439) (-602.256) [-602.769] (-603.214) -- 0:00:43
292000 -- (-603.378) [-603.131] (-604.832) (-601.648) * (-603.936) (-603.871) [-603.275] (-602.689) -- 0:00:43
292500 -- (-602.805) (-605.812) [-606.910] (-601.655) * (-601.684) (-601.480) [-606.993] (-605.051) -- 0:00:43
293000 -- (-604.381) (-605.992) (-603.237) [-601.579] * (-602.930) (-602.117) (-602.922) [-602.749] -- 0:00:43
293500 -- (-601.407) [-602.498] (-601.036) (-602.462) * (-603.446) [-602.093] (-603.775) (-601.926) -- 0:00:43
294000 -- [-604.050] (-602.318) (-602.102) (-605.583) * [-602.650] (-601.637) (-605.440) (-603.935) -- 0:00:43
294500 -- (-604.085) (-603.746) (-604.616) [-603.642] * (-601.951) (-601.933) (-604.039) [-604.509] -- 0:00:43
295000 -- (-608.226) (-603.117) (-604.254) [-602.863] * (-605.267) (-602.968) [-602.541] (-603.381) -- 0:00:43
Average standard deviation of split frequencies: 0.017015
295500 -- [-603.786] (-602.548) (-605.065) (-601.696) * [-603.008] (-602.916) (-602.062) (-603.489) -- 0:00:42
296000 -- (-602.806) (-603.329) [-602.710] (-603.424) * (-604.363) [-601.985] (-603.686) (-606.858) -- 0:00:42
296500 -- (-607.618) (-605.250) (-604.226) [-601.744] * (-603.866) (-601.126) [-602.801] (-605.625) -- 0:00:42
297000 -- (-602.667) (-602.478) (-606.217) [-604.238] * (-603.434) [-602.780] (-601.838) (-605.307) -- 0:00:42
297500 -- (-604.931) [-603.185] (-601.601) (-604.614) * (-601.392) [-605.298] (-602.776) (-603.741) -- 0:00:42
298000 -- (-603.935) (-603.974) [-602.335] (-604.789) * (-604.113) (-602.244) [-601.304] (-602.587) -- 0:00:42
298500 -- (-604.486) (-604.042) (-601.060) [-604.132] * (-605.369) (-602.560) (-601.509) [-603.875] -- 0:00:42
299000 -- (-601.840) [-602.466] (-601.466) (-603.272) * (-603.589) [-605.706] (-607.351) (-601.049) -- 0:00:42
299500 -- (-603.141) (-602.554) [-602.119] (-602.130) * (-602.652) (-607.354) (-605.662) [-601.155] -- 0:00:42
300000 -- (-604.161) (-602.722) [-601.439] (-605.644) * (-604.051) (-601.383) [-602.960] (-603.873) -- 0:00:42
Average standard deviation of split frequencies: 0.018538
300500 -- (-603.276) [-602.547] (-601.415) (-601.660) * (-607.300) (-602.212) [-602.028] (-603.232) -- 0:00:41
301000 -- (-601.807) (-601.566) [-602.144] (-603.693) * (-602.988) [-604.403] (-603.191) (-605.673) -- 0:00:41
301500 -- [-601.332] (-606.568) (-604.760) (-602.162) * (-603.644) (-601.368) (-602.565) [-602.213] -- 0:00:41
302000 -- (-601.541) (-602.816) (-601.539) [-602.006] * (-602.766) (-602.731) [-603.540] (-605.580) -- 0:00:41
302500 -- (-607.026) (-601.459) [-601.352] (-613.636) * (-602.622) (-602.765) (-603.673) [-603.802] -- 0:00:41
303000 -- (-604.225) (-604.601) (-602.512) [-602.784] * (-603.291) [-601.412] (-608.732) (-603.613) -- 0:00:41
303500 -- (-603.445) (-602.810) (-602.692) [-604.638] * (-604.464) (-601.492) (-601.515) [-601.145] -- 0:00:43
304000 -- [-603.908] (-602.066) (-603.001) (-603.956) * [-601.508] (-604.862) (-603.839) (-604.974) -- 0:00:43
304500 -- [-602.718] (-603.451) (-608.153) (-602.728) * (-603.866) (-601.523) (-601.154) [-602.584] -- 0:00:43
305000 -- (-604.314) (-603.253) [-603.387] (-603.786) * (-605.122) (-605.532) [-602.773] (-602.418) -- 0:00:43
Average standard deviation of split frequencies: 0.018396
305500 -- [-605.021] (-602.530) (-602.228) (-601.286) * (-605.690) (-604.974) (-602.946) [-603.154] -- 0:00:43
306000 -- (-605.703) (-601.827) [-602.523] (-605.001) * (-606.950) [-605.446] (-606.393) (-602.796) -- 0:00:43
306500 -- [-604.593] (-605.384) (-602.775) (-605.689) * (-604.161) [-601.561] (-604.007) (-603.062) -- 0:00:42
307000 -- (-602.548) (-602.054) (-603.971) [-603.092] * [-601.538] (-603.151) (-600.686) (-601.782) -- 0:00:42
307500 -- (-608.565) [-601.929] (-604.974) (-602.793) * (-601.151) [-603.284] (-602.305) (-600.953) -- 0:00:42
308000 -- [-604.100] (-603.729) (-606.421) (-606.612) * [-602.849] (-607.383) (-601.894) (-607.535) -- 0:00:42
308500 -- (-602.480) [-603.500] (-605.036) (-605.969) * [-603.401] (-608.238) (-601.457) (-606.054) -- 0:00:42
309000 -- [-604.721] (-602.725) (-602.787) (-600.846) * (-604.799) [-603.362] (-601.447) (-603.500) -- 0:00:42
309500 -- [-602.690] (-605.185) (-601.958) (-603.597) * (-604.251) (-603.312) (-602.756) [-602.468] -- 0:00:42
310000 -- (-603.380) [-602.615] (-602.357) (-601.419) * (-603.581) (-602.510) (-604.046) [-602.411] -- 0:00:42
Average standard deviation of split frequencies: 0.017787
310500 -- [-602.847] (-601.182) (-601.901) (-605.301) * (-602.655) [-602.775] (-602.566) (-604.025) -- 0:00:42
311000 -- (-603.489) (-600.941) (-602.429) [-601.960] * (-603.113) (-603.292) (-605.384) [-606.174] -- 0:00:42
311500 -- (-602.191) [-601.894] (-604.551) (-602.268) * [-604.746] (-603.909) (-603.534) (-603.507) -- 0:00:41
312000 -- [-605.651] (-604.764) (-606.351) (-603.404) * (-604.486) (-601.846) [-601.533] (-604.488) -- 0:00:41
312500 -- (-601.240) (-603.886) (-600.909) [-602.814] * (-603.400) (-601.979) [-602.486] (-603.503) -- 0:00:41
313000 -- [-602.579] (-602.798) (-601.586) (-602.707) * [-603.154] (-604.806) (-601.640) (-602.548) -- 0:00:41
313500 -- [-602.852] (-602.643) (-601.592) (-602.323) * (-601.110) (-601.930) [-602.391] (-604.027) -- 0:00:41
314000 -- (-602.664) [-605.403] (-602.795) (-601.077) * (-602.093) (-602.094) [-602.535] (-603.144) -- 0:00:41
314500 -- [-607.735] (-602.582) (-603.810) (-604.120) * [-605.466] (-603.227) (-604.124) (-601.516) -- 0:00:41
315000 -- (-602.934) (-602.129) [-602.027] (-605.307) * (-603.202) (-602.931) [-601.843] (-604.709) -- 0:00:41
Average standard deviation of split frequencies: 0.019218
315500 -- [-603.920] (-601.257) (-601.958) (-604.375) * (-603.839) (-604.324) (-603.689) [-603.781] -- 0:00:41
316000 -- (-603.283) (-605.240) (-602.910) [-603.906] * (-602.633) [-601.706] (-601.719) (-604.093) -- 0:00:41
316500 -- [-606.900] (-603.342) (-602.321) (-607.027) * (-602.036) [-602.153] (-603.720) (-602.178) -- 0:00:41
317000 -- (-604.384) (-607.385) [-602.673] (-603.518) * (-602.745) (-604.259) (-605.265) [-601.815] -- 0:00:40
317500 -- (-601.376) [-605.533] (-604.506) (-601.529) * (-603.879) (-603.156) (-601.743) [-603.564] -- 0:00:40
318000 -- [-607.257] (-606.273) (-602.393) (-604.914) * (-604.911) [-602.737] (-603.456) (-602.186) -- 0:00:40
318500 -- (-602.103) [-602.617] (-602.714) (-607.330) * (-601.794) (-604.547) (-604.738) [-603.508] -- 0:00:40
319000 -- [-605.732] (-601.661) (-601.964) (-601.266) * (-600.983) (-604.310) (-608.250) [-602.046] -- 0:00:40
319500 -- (-602.526) (-603.262) (-605.837) [-601.103] * [-606.309] (-602.607) (-603.640) (-601.016) -- 0:00:40
320000 -- (-601.434) (-601.891) (-602.111) [-601.631] * [-601.945] (-602.363) (-603.801) (-602.157) -- 0:00:40
Average standard deviation of split frequencies: 0.019025
320500 -- (-602.491) (-610.284) (-602.848) [-604.165] * [-602.214] (-604.397) (-602.828) (-604.493) -- 0:00:42
321000 -- (-602.592) (-601.461) (-601.742) [-602.800] * (-604.961) (-601.961) (-602.129) [-602.412] -- 0:00:42
321500 -- (-605.495) (-603.180) (-603.257) [-608.028] * (-606.262) (-602.658) (-605.208) [-605.948] -- 0:00:42
322000 -- [-606.066] (-601.809) (-605.009) (-601.910) * (-605.824) [-604.429] (-604.608) (-606.174) -- 0:00:42
322500 -- (-601.373) [-601.220] (-605.152) (-602.119) * (-601.913) (-601.915) [-602.655] (-603.653) -- 0:00:42
323000 -- (-601.436) (-602.056) (-608.944) [-603.636] * [-603.049] (-604.769) (-607.857) (-606.849) -- 0:00:41
323500 -- [-602.396] (-605.350) (-605.865) (-602.727) * [-603.166] (-604.586) (-605.031) (-602.277) -- 0:00:41
324000 -- (-602.227) (-601.520) [-603.406] (-603.675) * (-603.877) [-603.090] (-602.002) (-602.583) -- 0:00:41
324500 -- (-602.808) (-602.693) [-602.565] (-602.650) * (-601.677) (-600.948) (-602.161) [-607.346] -- 0:00:41
325000 -- [-602.509] (-602.165) (-601.498) (-603.373) * [-603.988] (-602.746) (-602.514) (-606.769) -- 0:00:41
Average standard deviation of split frequencies: 0.019361
325500 -- (-605.179) [-601.966] (-602.435) (-602.858) * (-602.432) [-602.691] (-603.334) (-606.149) -- 0:00:41
326000 -- (-602.043) (-601.619) (-604.767) [-602.786] * (-605.944) (-602.787) [-601.065] (-602.945) -- 0:00:41
326500 -- [-601.583] (-602.575) (-603.475) (-600.815) * (-603.569) [-602.401] (-602.433) (-603.019) -- 0:00:41
327000 -- (-608.292) [-605.125] (-602.793) (-602.681) * [-604.322] (-605.011) (-603.047) (-602.879) -- 0:00:41
327500 -- (-606.669) [-607.058] (-603.777) (-603.311) * (-602.004) [-604.630] (-601.825) (-602.112) -- 0:00:41
328000 -- [-607.112] (-605.268) (-604.150) (-604.271) * (-605.240) (-602.838) [-605.244] (-604.326) -- 0:00:40
328500 -- (-605.483) (-602.816) (-603.040) [-602.528] * (-602.019) (-601.010) (-605.558) [-601.533] -- 0:00:40
329000 -- (-608.444) (-602.620) [-601.577] (-604.148) * [-606.290] (-600.900) (-602.176) (-605.670) -- 0:00:40
329500 -- [-601.708] (-603.910) (-601.573) (-603.432) * [-601.927] (-601.989) (-601.500) (-604.801) -- 0:00:40
330000 -- (-605.132) [-601.506] (-603.439) (-603.019) * [-603.720] (-602.455) (-602.011) (-603.408) -- 0:00:40
Average standard deviation of split frequencies: 0.018454
330500 -- (-602.989) [-603.043] (-602.225) (-601.800) * (-604.408) [-603.948] (-603.039) (-602.554) -- 0:00:40
331000 -- [-603.361] (-602.793) (-602.789) (-604.278) * [-602.056] (-602.749) (-604.296) (-601.721) -- 0:00:40
331500 -- (-601.370) (-603.865) (-601.322) [-602.767] * [-604.529] (-605.463) (-602.127) (-603.893) -- 0:00:40
332000 -- (-603.090) [-602.851] (-602.583) (-601.960) * (-606.481) (-605.205) (-602.832) [-607.928] -- 0:00:40
332500 -- [-602.092] (-603.141) (-602.478) (-608.826) * (-604.080) [-603.668] (-606.810) (-604.448) -- 0:00:40
333000 -- [-603.909] (-602.576) (-602.817) (-602.241) * (-604.824) (-601.642) (-604.692) [-604.359] -- 0:00:40
333500 -- (-608.035) [-602.155] (-603.234) (-601.619) * (-601.038) (-608.312) (-603.360) [-601.676] -- 0:00:39
334000 -- (-604.846) [-601.366] (-604.340) (-602.857) * (-604.946) (-603.416) (-601.259) [-603.690] -- 0:00:39
334500 -- (-602.706) (-607.278) [-602.963] (-603.040) * (-602.286) (-612.936) (-601.988) [-601.741] -- 0:00:39
335000 -- [-603.049] (-605.920) (-602.912) (-602.536) * (-605.373) (-608.504) (-602.540) [-601.122] -- 0:00:39
Average standard deviation of split frequencies: 0.018005
335500 -- (-603.610) (-603.934) (-601.128) [-603.638] * (-603.019) (-609.232) [-601.674] (-602.320) -- 0:00:39
336000 -- (-602.327) (-604.163) [-601.427] (-601.176) * (-603.349) (-601.270) (-602.951) [-601.773] -- 0:00:39
336500 -- (-603.438) [-604.182] (-602.209) (-601.177) * (-601.341) (-603.391) [-604.174] (-602.965) -- 0:00:39
337000 -- [-602.955] (-602.326) (-602.520) (-605.415) * (-601.341) [-604.053] (-604.545) (-601.890) -- 0:00:39
337500 -- (-603.917) (-603.610) (-604.662) [-605.299] * [-602.155] (-602.401) (-602.626) (-601.579) -- 0:00:41
338000 -- (-603.185) (-602.424) (-601.565) [-603.488] * [-601.155] (-602.547) (-606.629) (-602.986) -- 0:00:41
338500 -- (-602.084) (-602.738) [-603.041] (-602.649) * (-601.432) (-604.319) [-606.453] (-603.982) -- 0:00:41
339000 -- (-601.997) (-601.268) [-603.139] (-601.575) * (-603.565) (-605.509) [-601.005] (-601.338) -- 0:00:40
339500 -- (-605.987) [-606.140] (-602.646) (-602.963) * [-603.327] (-602.579) (-601.503) (-602.941) -- 0:00:40
340000 -- (-612.288) (-601.973) (-603.938) [-602.404] * (-602.892) (-602.286) [-601.418] (-601.588) -- 0:00:40
Average standard deviation of split frequencies: 0.018233
340500 -- (-605.886) (-605.757) (-602.626) [-602.772] * (-606.059) [-601.150] (-601.497) (-604.367) -- 0:00:40
341000 -- (-603.436) (-600.970) (-604.409) [-603.891] * (-602.800) (-602.422) [-603.779] (-602.253) -- 0:00:40
341500 -- [-601.412] (-601.766) (-605.049) (-605.358) * (-600.923) [-603.463] (-606.214) (-602.942) -- 0:00:40
342000 -- (-602.189) [-602.059] (-604.620) (-601.271) * (-612.579) [-605.159] (-601.459) (-603.712) -- 0:00:40
342500 -- (-602.992) (-606.410) [-601.925] (-601.503) * (-605.364) (-607.733) [-605.533] (-601.608) -- 0:00:40
343000 -- (-605.375) [-602.026] (-603.710) (-601.373) * (-601.790) (-606.759) [-602.297] (-603.966) -- 0:00:40
343500 -- (-602.931) [-609.195] (-604.134) (-602.538) * (-601.171) [-604.603] (-602.749) (-601.962) -- 0:00:40
344000 -- (-603.309) (-603.572) (-603.706) [-603.574] * (-603.935) [-602.391] (-602.145) (-605.419) -- 0:00:40
344500 -- (-601.688) (-604.900) (-604.517) [-601.202] * (-603.570) (-602.522) [-602.718] (-603.059) -- 0:00:39
345000 -- (-602.475) (-602.082) (-605.845) [-602.127] * (-601.543) [-604.874] (-602.385) (-602.032) -- 0:00:39
Average standard deviation of split frequencies: 0.017863
345500 -- [-604.133] (-603.333) (-606.725) (-603.412) * (-603.222) (-604.364) (-604.461) [-601.400] -- 0:00:39
346000 -- (-604.008) (-602.901) (-606.407) [-601.269] * (-604.946) (-604.914) [-600.838] (-606.070) -- 0:00:39
346500 -- (-603.923) [-603.333] (-605.644) (-607.217) * [-603.011] (-601.787) (-607.525) (-602.778) -- 0:00:39
347000 -- (-603.597) (-601.905) [-602.512] (-603.433) * [-603.165] (-602.198) (-606.311) (-603.573) -- 0:00:39
347500 -- [-602.816] (-601.519) (-601.533) (-603.168) * [-604.613] (-602.786) (-605.158) (-605.024) -- 0:00:39
348000 -- (-603.313) (-601.277) (-604.111) [-605.981] * (-605.511) [-602.704] (-605.536) (-602.097) -- 0:00:39
348500 -- (-605.723) [-603.006] (-602.223) (-605.066) * (-605.270) (-602.567) (-602.271) [-603.308] -- 0:00:39
349000 -- (-604.095) [-607.806] (-601.601) (-604.700) * (-607.535) (-601.980) [-604.254] (-600.796) -- 0:00:39
349500 -- (-603.694) (-603.470) (-603.064) [-601.752] * (-602.604) (-606.251) (-603.221) [-601.241] -- 0:00:39
350000 -- (-601.885) (-603.859) (-602.743) [-602.951] * (-604.015) (-604.020) [-605.168] (-602.742) -- 0:00:39
Average standard deviation of split frequencies: 0.018267
350500 -- (-602.142) [-602.072] (-603.896) (-601.614) * (-603.195) (-603.409) (-606.115) [-601.619] -- 0:00:38
351000 -- (-603.535) [-603.665] (-608.195) (-604.489) * (-603.994) (-602.213) (-605.192) [-602.265] -- 0:00:38
351500 -- (-605.324) (-602.613) (-602.770) [-603.557] * (-610.817) (-602.392) (-602.650) [-601.546] -- 0:00:38
352000 -- (-604.870) [-604.626] (-601.849) (-607.276) * [-604.168] (-603.338) (-601.943) (-603.372) -- 0:00:38
352500 -- (-602.753) (-601.573) (-601.348) [-602.024] * (-604.692) (-603.583) (-602.127) [-605.203] -- 0:00:38
353000 -- (-603.811) (-603.346) (-601.522) [-603.831] * [-603.971] (-603.307) (-602.750) (-606.319) -- 0:00:38
353500 -- (-602.833) [-603.942] (-601.987) (-604.612) * [-602.224] (-606.267) (-603.698) (-607.233) -- 0:00:38
354000 -- (-604.550) (-603.966) [-603.551] (-601.573) * (-603.449) (-604.235) [-603.738] (-602.755) -- 0:00:38
354500 -- (-602.213) (-605.067) [-606.449] (-601.263) * (-604.478) (-608.020) (-601.828) [-602.736] -- 0:00:40
355000 -- [-603.951] (-602.710) (-608.155) (-603.590) * [-602.585] (-604.176) (-602.742) (-605.808) -- 0:00:39
Average standard deviation of split frequencies: 0.016825
355500 -- (-605.438) [-603.038] (-602.336) (-602.005) * (-601.106) (-607.460) [-601.041] (-614.239) -- 0:00:39
356000 -- (-604.306) [-602.505] (-602.703) (-602.061) * [-600.885] (-602.194) (-607.072) (-615.762) -- 0:00:39
356500 -- (-602.881) (-604.462) (-601.917) [-601.632] * (-600.797) (-602.286) [-607.412] (-609.992) -- 0:00:39
357000 -- (-606.399) [-601.393] (-602.608) (-603.129) * (-606.430) (-602.064) (-602.792) [-602.700] -- 0:00:39
357500 -- (-604.263) (-603.589) [-602.112] (-602.270) * [-605.298] (-603.518) (-605.144) (-603.187) -- 0:00:39
358000 -- [-601.008] (-605.504) (-601.758) (-602.824) * (-606.829) (-606.228) [-601.621] (-603.123) -- 0:00:39
358500 -- [-602.237] (-606.050) (-604.747) (-606.347) * [-605.322] (-602.908) (-601.946) (-602.151) -- 0:00:39
359000 -- (-604.286) (-607.642) [-601.026] (-604.881) * [-604.456] (-601.540) (-602.641) (-604.804) -- 0:00:39
359500 -- (-603.849) (-601.909) (-606.473) [-606.791] * (-602.127) (-604.751) (-601.823) [-605.990] -- 0:00:39
360000 -- (-602.683) (-604.613) [-602.363] (-608.786) * (-606.620) [-601.938] (-601.776) (-605.083) -- 0:00:39
Average standard deviation of split frequencies: 0.017299
360500 -- (-601.937) [-601.261] (-601.878) (-613.338) * (-604.166) (-602.516) [-602.714] (-606.689) -- 0:00:39
361000 -- [-601.948] (-601.614) (-603.143) (-601.362) * [-602.837] (-602.164) (-602.152) (-606.024) -- 0:00:38
361500 -- [-604.003] (-605.086) (-603.375) (-602.738) * (-602.364) (-601.840) (-603.142) [-603.783] -- 0:00:38
362000 -- (-603.768) [-602.410] (-603.877) (-602.752) * (-602.292) (-606.231) (-603.569) [-605.369] -- 0:00:38
362500 -- [-601.199] (-604.175) (-603.182) (-604.347) * [-605.769] (-602.913) (-607.276) (-604.527) -- 0:00:38
363000 -- (-603.239) (-607.135) [-603.006] (-603.007) * (-602.860) (-604.943) [-604.550] (-601.497) -- 0:00:38
363500 -- [-604.446] (-603.867) (-604.021) (-604.462) * [-603.282] (-608.712) (-603.647) (-602.815) -- 0:00:38
364000 -- (-603.303) [-603.269] (-601.249) (-603.193) * [-601.712] (-604.615) (-606.333) (-603.501) -- 0:00:38
364500 -- [-601.616] (-602.272) (-602.585) (-600.804) * (-601.453) [-601.440] (-601.951) (-605.908) -- 0:00:38
365000 -- [-600.840] (-603.438) (-603.853) (-602.792) * (-604.293) [-606.288] (-603.510) (-602.701) -- 0:00:38
Average standard deviation of split frequencies: 0.017388
365500 -- (-601.460) [-603.580] (-603.311) (-603.807) * (-603.505) (-609.762) (-602.942) [-601.678] -- 0:00:38
366000 -- (-601.566) [-603.967] (-604.154) (-602.796) * (-601.844) (-607.120) (-601.833) [-602.930] -- 0:00:38
366500 -- (-604.142) (-603.521) [-602.541] (-604.111) * (-606.294) [-606.623] (-605.391) (-605.876) -- 0:00:38
367000 -- (-608.443) [-602.335] (-603.879) (-600.889) * (-602.672) (-607.217) [-604.090] (-603.639) -- 0:00:37
367500 -- (-606.194) (-603.189) (-602.966) [-601.804] * (-605.077) [-604.403] (-602.585) (-602.442) -- 0:00:37
368000 -- (-603.607) (-603.747) [-603.896] (-601.910) * (-602.687) (-602.856) [-604.466] (-602.465) -- 0:00:37
368500 -- [-601.897] (-603.003) (-602.395) (-602.678) * (-602.628) [-604.140] (-603.096) (-608.327) -- 0:00:37
369000 -- (-602.817) (-600.982) (-604.765) [-604.295] * (-603.967) (-603.484) (-602.874) [-601.374] -- 0:00:37
369500 -- (-604.727) (-601.019) (-610.369) [-601.803] * (-601.404) (-603.497) (-603.514) [-605.017] -- 0:00:37
370000 -- (-601.763) [-602.522] (-603.508) (-602.130) * (-601.928) (-603.791) (-603.597) [-603.821] -- 0:00:37
Average standard deviation of split frequencies: 0.016982
370500 -- (-604.013) (-602.578) [-603.695] (-603.602) * (-602.300) [-602.617] (-601.320) (-604.096) -- 0:00:37
371000 -- (-608.603) (-602.328) (-604.394) [-601.696] * [-603.218] (-602.655) (-602.406) (-602.396) -- 0:00:38
371500 -- (-607.861) [-602.442] (-602.799) (-603.751) * (-603.251) [-602.180] (-603.831) (-602.356) -- 0:00:38
372000 -- (-602.336) (-603.321) [-602.380] (-601.680) * (-601.638) (-607.309) [-602.384] (-601.704) -- 0:00:38
372500 -- [-602.573] (-602.484) (-601.657) (-602.116) * [-605.459] (-604.562) (-601.160) (-603.849) -- 0:00:38
373000 -- [-601.919] (-601.363) (-602.066) (-600.803) * (-604.236) [-602.654] (-603.356) (-605.420) -- 0:00:38
373500 -- [-601.839] (-601.786) (-601.744) (-603.893) * (-602.588) (-604.232) (-604.480) [-601.226] -- 0:00:38
374000 -- [-601.649] (-604.110) (-606.616) (-600.846) * [-603.650] (-602.881) (-605.274) (-601.798) -- 0:00:38
374500 -- [-602.326] (-605.707) (-603.096) (-602.992) * (-601.773) (-604.752) (-603.902) [-601.384] -- 0:00:38
375000 -- (-604.822) [-603.653] (-603.672) (-603.073) * (-606.687) (-602.718) (-603.006) [-601.796] -- 0:00:38
Average standard deviation of split frequencies: 0.016004
375500 -- (-603.110) (-602.651) (-604.948) [-602.815] * (-604.508) [-607.615] (-602.739) (-602.700) -- 0:00:38
376000 -- (-606.129) (-602.804) (-603.174) [-601.491] * (-602.285) (-603.188) [-601.327] (-606.411) -- 0:00:38
376500 -- (-603.659) [-602.383] (-602.726) (-602.849) * (-601.675) (-604.253) [-601.312] (-604.813) -- 0:00:38
377000 -- (-604.750) (-603.163) (-601.300) [-602.553] * [-602.733] (-602.783) (-604.471) (-605.236) -- 0:00:38
377500 -- [-605.239] (-601.228) (-602.701) (-604.911) * (-602.393) (-601.440) [-604.531] (-602.843) -- 0:00:37
378000 -- (-602.075) (-602.774) (-603.146) [-604.387] * (-601.731) (-601.771) [-601.470] (-603.292) -- 0:00:37
378500 -- [-602.367] (-602.556) (-603.231) (-601.655) * [-603.738] (-603.101) (-600.995) (-604.559) -- 0:00:37
379000 -- (-605.252) [-603.058] (-602.426) (-601.946) * (-601.789) (-602.313) [-601.145] (-603.184) -- 0:00:37
379500 -- (-602.328) [-601.296] (-603.687) (-602.653) * (-602.327) (-606.297) [-605.534] (-602.488) -- 0:00:37
380000 -- (-604.811) [-601.360] (-602.912) (-602.055) * (-601.330) (-603.264) (-605.103) [-602.179] -- 0:00:37
Average standard deviation of split frequencies: 0.015880
380500 -- (-605.052) (-604.542) (-603.558) [-603.262] * [-601.958] (-603.971) (-609.365) (-602.410) -- 0:00:37
381000 -- (-606.634) (-603.229) (-602.004) [-604.423] * [-604.294] (-603.750) (-605.838) (-603.214) -- 0:00:37
381500 -- (-604.042) [-603.652] (-602.995) (-600.824) * (-602.852) [-602.403] (-603.714) (-603.005) -- 0:00:37
382000 -- (-606.880) (-602.541) (-602.339) [-604.188] * (-601.449) (-601.788) (-602.763) [-604.441] -- 0:00:37
382500 -- (-603.354) [-601.930] (-602.752) (-601.751) * (-603.087) (-603.016) [-603.492] (-602.055) -- 0:00:37
383000 -- (-603.529) (-603.923) [-606.156] (-603.929) * (-602.363) (-601.696) (-603.578) [-601.182] -- 0:00:37
383500 -- (-603.285) (-604.831) (-603.840) [-602.349] * [-603.274] (-603.839) (-603.897) (-601.229) -- 0:00:36
384000 -- (-608.564) (-603.541) [-604.631] (-606.757) * (-604.213) [-601.764] (-601.575) (-603.192) -- 0:00:36
384500 -- [-604.031] (-606.089) (-603.303) (-601.192) * (-602.636) (-603.103) (-605.574) [-601.524] -- 0:00:36
385000 -- [-602.824] (-602.933) (-604.046) (-601.685) * (-600.726) (-602.985) [-601.867] (-605.113) -- 0:00:36
Average standard deviation of split frequencies: 0.015130
385500 -- (-605.185) (-602.758) [-603.271] (-605.159) * [-600.726] (-603.437) (-601.774) (-603.607) -- 0:00:36
386000 -- [-604.386] (-600.720) (-604.513) (-604.225) * (-600.921) (-601.455) [-601.681] (-601.200) -- 0:00:36
386500 -- (-600.784) (-603.972) (-604.825) [-606.205] * (-611.174) (-601.003) (-601.250) [-601.425] -- 0:00:36
387000 -- (-601.524) (-604.645) (-602.729) [-603.856] * [-601.625] (-603.301) (-606.793) (-603.716) -- 0:00:36
387500 -- (-603.122) (-605.918) [-602.354] (-604.517) * (-607.867) (-604.894) (-603.177) [-601.605] -- 0:00:37
388000 -- (-601.675) (-603.720) (-601.454) [-602.842] * (-602.528) (-605.727) [-605.416] (-605.960) -- 0:00:37
388500 -- (-601.182) (-603.671) (-601.583) [-602.778] * (-602.060) (-605.394) (-603.985) [-603.362] -- 0:00:37
389000 -- (-603.441) [-602.565] (-602.072) (-608.797) * (-602.014) (-605.976) (-602.806) [-601.924] -- 0:00:37
389500 -- [-601.959] (-604.574) (-601.205) (-602.181) * (-602.004) (-601.301) [-602.040] (-607.568) -- 0:00:37
390000 -- (-604.831) (-601.783) (-602.758) [-601.118] * [-601.161] (-603.666) (-601.073) (-602.794) -- 0:00:37
Average standard deviation of split frequencies: 0.014906
390500 -- (-602.184) [-603.695] (-604.981) (-601.319) * (-606.403) [-604.378] (-601.554) (-602.648) -- 0:00:37
391000 -- [-602.739] (-604.342) (-601.702) (-604.394) * (-602.980) [-602.396] (-603.697) (-604.311) -- 0:00:37
391500 -- (-601.130) (-604.224) (-604.753) [-604.277] * (-605.581) (-602.684) (-605.606) [-602.657] -- 0:00:37
392000 -- (-603.471) [-603.205] (-605.742) (-604.615) * (-600.917) [-604.174] (-602.151) (-603.567) -- 0:00:37
392500 -- (-603.251) (-604.776) (-604.001) [-602.245] * [-602.319] (-606.946) (-605.937) (-602.309) -- 0:00:37
393000 -- [-604.246] (-603.607) (-605.651) (-602.681) * [-601.825] (-602.025) (-602.566) (-602.992) -- 0:00:37
393500 -- [-601.887] (-602.586) (-603.999) (-601.821) * [-602.831] (-602.739) (-601.765) (-601.898) -- 0:00:36
394000 -- (-609.218) [-602.453] (-605.223) (-601.333) * [-602.513] (-603.940) (-601.493) (-601.585) -- 0:00:36
394500 -- (-604.535) (-603.246) (-601.277) [-602.349] * (-605.518) [-601.303] (-604.093) (-603.929) -- 0:00:36
395000 -- (-602.906) [-603.064] (-603.372) (-604.198) * [-603.754] (-602.489) (-603.196) (-602.078) -- 0:00:36
Average standard deviation of split frequencies: 0.014915
395500 -- (-602.145) [-602.068] (-602.220) (-604.063) * (-602.926) [-604.727] (-606.053) (-604.616) -- 0:00:36
396000 -- (-601.620) [-606.814] (-602.410) (-603.030) * (-603.899) (-601.075) (-605.217) [-607.501] -- 0:00:36
396500 -- [-602.817] (-604.109) (-601.651) (-602.919) * (-602.319) (-602.601) [-604.300] (-605.547) -- 0:00:36
397000 -- [-603.255] (-602.836) (-601.618) (-604.167) * [-604.619] (-603.592) (-605.608) (-602.658) -- 0:00:36
397500 -- [-601.876] (-604.567) (-604.469) (-602.283) * [-605.358] (-603.106) (-602.872) (-602.464) -- 0:00:36
398000 -- (-605.388) [-603.653] (-603.830) (-602.231) * [-605.022] (-604.456) (-603.782) (-601.203) -- 0:00:36
398500 -- (-601.602) [-602.870] (-604.275) (-602.000) * (-602.132) [-601.737] (-604.807) (-604.137) -- 0:00:36
399000 -- (-601.111) [-601.687] (-604.104) (-603.107) * (-607.177) (-602.200) [-602.547] (-601.160) -- 0:00:36
399500 -- (-602.975) [-601.327] (-602.637) (-601.717) * (-607.633) (-601.740) (-606.788) [-602.122] -- 0:00:36
400000 -- (-601.476) [-603.726] (-601.482) (-602.048) * (-605.074) [-601.763] (-605.647) (-602.553) -- 0:00:36
Average standard deviation of split frequencies: 0.014672
400500 -- [-602.554] (-601.376) (-602.561) (-607.261) * (-605.804) (-603.008) [-606.133] (-601.603) -- 0:00:35
401000 -- (-602.818) (-603.346) (-602.388) [-602.872] * (-608.690) (-605.135) [-602.571] (-601.139) -- 0:00:35
401500 -- (-602.757) [-603.969] (-601.810) (-601.519) * (-605.454) (-602.713) [-603.921] (-601.015) -- 0:00:35
402000 -- (-603.317) (-602.410) (-601.353) [-601.868] * (-603.207) (-603.250) (-605.989) [-604.409] -- 0:00:35
402500 -- [-601.839] (-603.348) (-600.860) (-604.502) * [-608.957] (-602.750) (-603.837) (-603.041) -- 0:00:35
403000 -- [-601.460] (-601.488) (-601.535) (-603.538) * [-606.549] (-606.263) (-601.229) (-603.192) -- 0:00:35
403500 -- (-603.616) (-602.651) [-604.490] (-601.780) * (-603.076) [-604.178] (-602.150) (-606.500) -- 0:00:35
404000 -- (-602.460) (-601.282) [-606.316] (-603.879) * (-603.521) (-604.688) [-602.132] (-602.310) -- 0:00:36
404500 -- (-601.758) [-603.095] (-601.355) (-603.837) * (-604.036) [-603.787] (-603.119) (-601.850) -- 0:00:36
405000 -- (-601.579) [-602.639] (-604.590) (-602.825) * (-601.274) (-601.418) [-602.922] (-602.029) -- 0:00:36
Average standard deviation of split frequencies: 0.015777
405500 -- (-601.860) [-602.750] (-604.965) (-603.640) * [-603.853] (-604.568) (-604.855) (-604.111) -- 0:00:36
406000 -- (-601.177) (-603.688) [-602.302] (-603.215) * [-603.463] (-603.338) (-611.549) (-601.477) -- 0:00:36
406500 -- (-602.103) [-603.039] (-603.004) (-603.740) * (-601.542) (-605.990) (-609.120) [-604.306] -- 0:00:36
407000 -- (-602.540) (-603.288) [-603.715] (-605.451) * (-604.433) [-603.229] (-604.084) (-601.551) -- 0:00:36
407500 -- (-602.353) [-602.797] (-601.832) (-604.433) * (-603.024) (-606.256) [-603.293] (-604.147) -- 0:00:36
408000 -- (-602.663) [-603.183] (-603.607) (-606.001) * (-600.979) (-603.238) [-606.597] (-602.200) -- 0:00:36
408500 -- (-602.601) [-603.134] (-601.358) (-603.904) * [-602.075] (-604.582) (-603.120) (-606.216) -- 0:00:36
409000 -- [-607.734] (-604.701) (-602.502) (-606.675) * (-601.895) (-605.104) [-602.497] (-604.792) -- 0:00:36
409500 -- (-602.494) [-601.893] (-603.508) (-605.598) * (-601.911) [-602.003] (-601.356) (-606.097) -- 0:00:36
410000 -- (-604.343) [-601.479] (-604.845) (-603.558) * (-601.520) (-602.978) (-605.174) [-604.187] -- 0:00:35
Average standard deviation of split frequencies: 0.015733
410500 -- (-609.309) (-601.940) [-603.553] (-603.667) * (-602.163) (-603.240) [-601.911] (-606.179) -- 0:00:35
411000 -- (-601.777) (-603.018) (-603.542) [-604.453] * [-602.065] (-604.686) (-601.348) (-605.705) -- 0:00:35
411500 -- [-602.223] (-605.612) (-604.122) (-603.945) * (-602.856) (-603.226) (-602.639) [-603.129] -- 0:00:35
412000 -- (-601.210) [-602.839] (-603.590) (-602.009) * (-601.204) (-604.535) (-604.392) [-601.476] -- 0:00:35
412500 -- [-601.307] (-601.894) (-603.039) (-604.820) * (-602.954) (-606.515) (-601.031) [-602.241] -- 0:00:35
413000 -- (-601.869) [-601.929] (-605.854) (-608.856) * (-602.329) (-604.532) [-603.759] (-603.115) -- 0:00:35
413500 -- (-604.526) [-601.947] (-602.966) (-606.390) * (-603.292) [-604.872] (-601.909) (-605.111) -- 0:00:35
414000 -- (-603.600) [-602.283] (-604.595) (-604.623) * [-601.600] (-601.887) (-602.548) (-603.114) -- 0:00:35
414500 -- (-604.207) [-603.956] (-607.885) (-604.995) * (-601.822) (-601.313) [-603.583] (-608.851) -- 0:00:35
415000 -- [-604.474] (-601.753) (-601.270) (-603.642) * (-601.759) [-601.451] (-603.942) (-604.479) -- 0:00:35
Average standard deviation of split frequencies: 0.014665
415500 -- [-601.641] (-603.360) (-602.731) (-605.968) * [-602.313] (-601.465) (-607.660) (-602.921) -- 0:00:35
416000 -- (-602.907) (-605.362) [-603.249] (-601.823) * [-603.401] (-603.824) (-602.270) (-605.992) -- 0:00:35
416500 -- (-601.785) (-603.781) [-601.902] (-601.386) * (-601.322) [-603.389] (-603.123) (-602.150) -- 0:00:35
417000 -- (-602.514) (-605.211) [-602.342] (-603.064) * (-601.477) [-602.289] (-602.120) (-605.676) -- 0:00:34
417500 -- (-601.668) (-602.989) (-602.649) [-603.243] * (-603.380) (-602.734) (-602.668) [-601.499] -- 0:00:34
418000 -- (-602.855) (-603.777) [-604.109] (-603.353) * (-603.817) [-601.742] (-604.919) (-601.438) -- 0:00:34
418500 -- (-602.272) [-603.927] (-603.425) (-601.446) * [-603.342] (-603.576) (-604.270) (-602.013) -- 0:00:34
419000 -- [-602.986] (-604.801) (-601.555) (-604.179) * (-605.785) (-603.597) [-602.819] (-601.858) -- 0:00:34
419500 -- (-602.361) (-604.503) (-602.328) [-608.056] * (-603.507) (-602.238) (-602.629) [-601.701] -- 0:00:34
420000 -- (-602.360) [-602.731] (-606.263) (-602.847) * (-605.804) (-604.260) [-603.694] (-605.037) -- 0:00:34
Average standard deviation of split frequencies: 0.015359
420500 -- [-602.734] (-604.765) (-605.186) (-607.418) * (-603.276) [-602.674] (-602.883) (-601.103) -- 0:00:34
421000 -- (-601.564) [-601.389] (-603.221) (-602.292) * (-602.392) (-603.676) (-601.722) [-601.515] -- 0:00:35
421500 -- (-602.316) [-601.810] (-604.511) (-603.587) * (-602.307) [-602.058] (-601.563) (-602.159) -- 0:00:35
422000 -- (-602.827) [-603.733] (-605.671) (-601.767) * [-601.738] (-602.542) (-602.572) (-603.870) -- 0:00:35
422500 -- (-602.333) [-601.859] (-604.971) (-601.091) * (-604.352) (-605.117) [-602.131] (-604.167) -- 0:00:35
423000 -- (-605.234) [-601.928] (-604.146) (-601.161) * (-601.687) [-601.137] (-602.439) (-601.139) -- 0:00:35
423500 -- [-604.230] (-602.268) (-604.558) (-605.513) * (-604.311) (-605.851) [-604.770] (-601.033) -- 0:00:35
424000 -- (-602.386) (-605.394) (-604.492) [-601.678] * [-602.622] (-606.362) (-602.997) (-603.144) -- 0:00:35
424500 -- (-603.048) (-610.275) [-604.092] (-603.378) * (-603.761) [-607.616] (-603.024) (-604.740) -- 0:00:35
425000 -- (-605.468) (-602.784) [-603.399] (-607.120) * (-605.187) [-605.863] (-601.914) (-605.485) -- 0:00:35
Average standard deviation of split frequencies: 0.015297
425500 -- (-602.511) (-603.151) [-601.554] (-601.716) * [-603.980] (-605.682) (-602.839) (-601.528) -- 0:00:35
426000 -- (-603.810) (-605.172) [-602.242] (-605.859) * (-606.194) (-603.174) [-603.137] (-601.781) -- 0:00:35
426500 -- (-606.043) (-606.302) (-601.289) [-602.685] * [-603.228] (-604.236) (-602.353) (-603.491) -- 0:00:34
427000 -- [-603.542] (-602.060) (-605.626) (-603.652) * (-602.366) (-606.319) [-602.207] (-605.459) -- 0:00:34
427500 -- [-606.394] (-601.257) (-606.966) (-602.812) * (-603.418) (-605.271) (-603.492) [-601.917] -- 0:00:34
428000 -- (-603.532) (-602.565) [-605.967] (-602.453) * (-601.769) (-601.735) (-603.945) [-605.460] -- 0:00:34
428500 -- [-601.761] (-603.116) (-601.181) (-602.692) * (-603.530) [-604.347] (-603.582) (-602.122) -- 0:00:34
429000 -- (-603.905) (-605.768) [-602.955] (-605.891) * [-603.859] (-606.828) (-604.428) (-605.216) -- 0:00:34
429500 -- (-602.584) (-601.856) [-601.655] (-605.547) * (-605.784) [-601.488] (-604.146) (-602.277) -- 0:00:34
430000 -- (-605.262) [-601.243] (-605.571) (-605.486) * [-603.329] (-605.468) (-603.879) (-602.690) -- 0:00:34
Average standard deviation of split frequencies: 0.015461
430500 -- (-609.364) [-601.687] (-609.586) (-602.238) * (-601.156) (-604.840) (-602.948) [-602.633] -- 0:00:34
431000 -- (-604.073) (-601.546) (-611.051) [-601.343] * (-601.174) (-601.146) (-603.550) [-603.820] -- 0:00:34
431500 -- (-601.207) [-601.794] (-606.756) (-602.269) * [-602.666] (-601.642) (-602.923) (-603.573) -- 0:00:34
432000 -- [-600.961] (-604.117) (-602.683) (-602.217) * [-605.450] (-603.269) (-605.386) (-602.820) -- 0:00:34
432500 -- (-603.098) [-603.663] (-605.793) (-603.632) * (-602.495) (-602.243) (-603.666) [-604.194] -- 0:00:34
433000 -- (-604.330) (-603.092) (-601.486) [-602.326] * (-602.423) (-602.303) [-603.930] (-603.730) -- 0:00:34
433500 -- (-604.606) (-605.890) [-603.419] (-607.212) * [-602.524] (-602.420) (-603.538) (-604.900) -- 0:00:33
434000 -- (-608.056) (-602.103) [-601.930] (-604.325) * (-607.710) [-602.296] (-604.003) (-603.099) -- 0:00:33
434500 -- (-603.303) (-608.312) [-606.716] (-603.334) * [-601.816] (-603.829) (-603.427) (-601.283) -- 0:00:33
435000 -- (-602.832) (-606.802) (-603.129) [-602.760] * (-605.924) (-602.701) (-606.395) [-602.012] -- 0:00:33
Average standard deviation of split frequencies: 0.014934
435500 -- [-601.967] (-612.375) (-603.981) (-603.619) * (-604.192) (-607.142) [-602.279] (-601.879) -- 0:00:33
436000 -- (-602.792) [-604.850] (-601.802) (-603.431) * [-601.905] (-602.127) (-605.600) (-603.124) -- 0:00:33
436500 -- (-603.804) (-604.778) [-603.901] (-601.759) * (-601.883) (-601.471) [-603.963] (-602.754) -- 0:00:33
437000 -- (-602.464) [-604.648] (-602.490) (-603.093) * (-602.284) (-603.921) [-605.596] (-604.661) -- 0:00:33
437500 -- [-601.636] (-600.876) (-602.691) (-607.411) * (-601.555) (-605.728) [-602.712] (-604.250) -- 0:00:33
438000 -- (-607.501) (-604.599) [-601.867] (-605.851) * (-603.624) [-602.190] (-602.836) (-603.510) -- 0:00:34
438500 -- (-605.206) (-601.160) [-601.176] (-603.786) * [-602.371] (-601.848) (-604.122) (-605.847) -- 0:00:34
439000 -- [-602.377] (-603.539) (-601.966) (-602.857) * [-602.127] (-602.769) (-602.761) (-604.308) -- 0:00:34
439500 -- (-603.746) (-604.788) [-604.108] (-606.998) * (-605.069) [-602.257] (-602.424) (-602.756) -- 0:00:34
440000 -- (-602.903) [-603.152] (-601.384) (-606.807) * (-604.505) (-602.953) (-601.584) [-603.563] -- 0:00:34
Average standard deviation of split frequencies: 0.015378
440500 -- [-602.111] (-603.377) (-601.543) (-611.134) * (-602.812) (-602.333) (-603.248) [-601.478] -- 0:00:34
441000 -- [-602.116] (-610.922) (-603.040) (-602.442) * [-600.895] (-604.542) (-600.971) (-603.233) -- 0:00:34
441500 -- (-601.031) (-606.540) (-602.286) [-603.544] * (-601.790) [-605.581] (-606.775) (-601.592) -- 0:00:34
442000 -- (-604.681) [-605.021] (-601.767) (-604.467) * (-601.507) (-602.878) [-602.909] (-606.012) -- 0:00:34
442500 -- (-607.545) (-602.095) [-604.054] (-603.460) * [-602.088] (-602.443) (-603.423) (-603.654) -- 0:00:34
443000 -- (-604.041) (-602.220) (-602.917) [-603.479] * (-604.022) (-603.568) (-601.565) [-602.938] -- 0:00:33
443500 -- (-602.590) (-603.076) [-603.094] (-607.129) * (-602.915) (-604.577) [-601.762] (-603.369) -- 0:00:33
444000 -- (-601.225) (-602.002) (-605.441) [-603.252] * (-602.896) [-602.611] (-604.127) (-602.378) -- 0:00:33
444500 -- (-603.127) (-602.301) [-602.597] (-601.947) * (-602.488) (-603.731) [-603.089] (-603.396) -- 0:00:33
445000 -- (-602.790) (-601.869) (-602.831) [-606.652] * (-605.365) [-602.638] (-601.623) (-602.687) -- 0:00:33
Average standard deviation of split frequencies: 0.014137
445500 -- (-604.547) [-601.568] (-604.104) (-607.207) * (-603.847) (-604.198) (-601.298) [-601.305] -- 0:00:33
446000 -- (-603.059) (-605.777) [-605.941] (-605.487) * (-603.041) (-603.904) [-601.661] (-604.380) -- 0:00:33
446500 -- [-603.018] (-603.325) (-601.877) (-602.774) * [-601.289] (-604.015) (-604.382) (-601.801) -- 0:00:33
447000 -- (-609.996) [-602.959] (-603.685) (-603.100) * [-602.052] (-608.717) (-604.623) (-604.540) -- 0:00:33
447500 -- (-602.227) [-601.755] (-601.167) (-604.680) * (-603.055) (-604.923) [-602.457] (-604.209) -- 0:00:33
448000 -- [-600.957] (-602.157) (-602.830) (-601.841) * (-603.953) (-603.146) [-604.907] (-605.189) -- 0:00:33
448500 -- (-602.810) [-602.013] (-604.104) (-603.979) * (-605.885) (-601.492) [-604.658] (-605.443) -- 0:00:33
449000 -- (-602.150) (-602.838) [-601.478] (-606.260) * (-601.715) (-606.107) (-602.137) [-603.081] -- 0:00:33
449500 -- [-607.728] (-601.649) (-603.776) (-602.348) * (-602.210) (-604.563) [-602.161] (-605.406) -- 0:00:33
450000 -- (-603.489) (-603.905) [-600.766] (-605.040) * [-602.106] (-602.809) (-602.035) (-604.433) -- 0:00:33
Average standard deviation of split frequencies: 0.014574
450500 -- (-602.262) (-603.589) [-607.839] (-605.526) * (-602.479) [-601.576] (-603.085) (-605.037) -- 0:00:32
451000 -- (-603.840) (-603.810) [-607.217] (-603.330) * [-604.837] (-604.207) (-604.849) (-603.439) -- 0:00:32
451500 -- (-603.908) [-603.383] (-608.704) (-605.445) * (-605.532) [-603.439] (-604.916) (-602.445) -- 0:00:32
452000 -- (-606.012) (-601.930) (-604.673) [-602.800] * [-601.914] (-604.383) (-602.035) (-602.545) -- 0:00:32
452500 -- (-605.112) (-606.575) [-601.956] (-601.501) * (-603.228) [-602.430] (-602.428) (-604.376) -- 0:00:32
453000 -- (-603.411) (-604.705) (-602.123) [-605.329] * (-607.815) (-602.365) (-601.068) [-602.299] -- 0:00:32
453500 -- (-604.320) (-601.320) (-601.277) [-602.145] * (-608.629) (-602.337) (-602.513) [-602.410] -- 0:00:32
454000 -- (-604.458) (-601.699) [-601.951] (-603.104) * (-609.337) [-606.494] (-603.943) (-605.935) -- 0:00:33
454500 -- (-602.935) [-601.140] (-606.793) (-602.938) * (-602.537) [-603.451] (-602.624) (-602.418) -- 0:00:33
455000 -- (-606.073) [-600.824] (-603.152) (-601.670) * (-601.621) (-604.650) [-602.484] (-602.415) -- 0:00:33
Average standard deviation of split frequencies: 0.013439
455500 -- (-603.817) [-601.079] (-601.972) (-603.174) * (-601.235) [-601.922] (-603.322) (-604.642) -- 0:00:33
456000 -- [-601.845] (-603.716) (-601.781) (-605.597) * (-606.451) [-604.806] (-606.316) (-606.309) -- 0:00:33
456500 -- [-601.372] (-601.771) (-602.507) (-601.821) * (-606.291) [-600.840] (-604.082) (-608.640) -- 0:00:33
457000 -- [-602.388] (-604.195) (-601.339) (-604.771) * (-605.006) (-601.490) [-601.841] (-601.726) -- 0:00:33
457500 -- [-603.116] (-605.709) (-601.365) (-604.349) * (-601.412) [-603.181] (-602.702) (-604.072) -- 0:00:33
458000 -- (-603.286) (-603.472) [-601.483] (-602.778) * [-602.667] (-604.621) (-603.157) (-604.303) -- 0:00:33
458500 -- (-604.835) (-606.444) (-601.231) [-603.433] * (-605.783) (-603.832) [-605.343] (-603.512) -- 0:00:33
459000 -- [-601.250] (-605.147) (-601.187) (-601.650) * (-605.856) (-604.380) [-605.801] (-605.437) -- 0:00:33
459500 -- (-602.926) [-602.706] (-604.975) (-611.189) * (-608.576) [-601.694] (-603.704) (-604.643) -- 0:00:32
460000 -- (-601.318) (-602.048) [-601.337] (-604.745) * (-604.901) (-602.772) (-603.110) [-603.677] -- 0:00:32
Average standard deviation of split frequencies: 0.013781
460500 -- (-603.645) [-601.195] (-603.229) (-601.103) * (-603.514) (-604.167) [-601.980] (-605.529) -- 0:00:32
461000 -- [-602.384] (-606.897) (-603.893) (-604.143) * (-602.536) (-606.285) [-602.632] (-602.198) -- 0:00:32
461500 -- (-602.246) [-602.045] (-602.210) (-603.419) * (-604.565) (-602.308) (-602.050) [-602.135] -- 0:00:32
462000 -- [-606.295] (-606.599) (-603.560) (-601.845) * (-601.758) (-601.914) [-602.743] (-606.786) -- 0:00:32
462500 -- (-605.463) [-602.748] (-602.089) (-602.869) * (-602.900) [-601.297] (-602.557) (-601.458) -- 0:00:32
463000 -- [-604.535] (-601.842) (-603.426) (-602.700) * [-605.005] (-603.757) (-606.383) (-604.041) -- 0:00:32
463500 -- (-604.567) (-602.258) [-602.145] (-606.842) * (-604.428) (-603.045) (-608.140) [-602.652] -- 0:00:32
464000 -- (-603.951) (-601.508) [-604.288] (-602.951) * (-601.167) (-601.422) [-602.176] (-602.844) -- 0:00:32
464500 -- (-604.573) [-602.802] (-603.066) (-604.607) * [-601.935] (-605.235) (-603.774) (-601.287) -- 0:00:32
465000 -- (-603.552) [-601.445] (-602.097) (-604.241) * [-605.647] (-607.055) (-603.284) (-603.668) -- 0:00:32
Average standard deviation of split frequencies: 0.013893
465500 -- [-601.668] (-603.899) (-604.170) (-603.216) * [-601.766] (-609.171) (-602.676) (-601.947) -- 0:00:32
466000 -- [-602.839] (-601.130) (-602.021) (-609.215) * (-602.484) (-601.902) [-602.822] (-601.787) -- 0:00:32
466500 -- [-606.248] (-601.658) (-603.792) (-603.606) * [-602.252] (-602.442) (-605.396) (-604.670) -- 0:00:32
467000 -- (-602.794) (-604.967) [-603.127] (-603.846) * (-601.814) (-604.270) (-602.836) [-600.776] -- 0:00:31
467500 -- (-602.857) [-602.513] (-604.234) (-603.792) * (-601.602) (-602.850) [-602.619] (-602.817) -- 0:00:31
468000 -- (-600.703) (-606.386) [-602.692] (-601.084) * (-602.553) (-603.564) (-600.996) [-606.927] -- 0:00:31
468500 -- [-603.374] (-604.171) (-603.617) (-606.897) * (-608.433) (-602.928) [-601.264] (-604.136) -- 0:00:31
469000 -- [-601.971] (-601.562) (-601.735) (-604.874) * (-611.994) [-601.531] (-605.111) (-603.991) -- 0:00:31
469500 -- [-603.847] (-602.291) (-602.376) (-602.577) * [-603.950] (-603.346) (-604.614) (-602.812) -- 0:00:31
470000 -- (-601.559) (-604.493) [-602.607] (-602.322) * (-606.559) (-603.814) [-602.841] (-603.524) -- 0:00:32
Average standard deviation of split frequencies: 0.013955
470500 -- [-602.795] (-601.338) (-600.897) (-603.598) * (-603.170) (-604.982) (-605.200) [-602.417] -- 0:00:32
471000 -- [-602.801] (-605.906) (-606.118) (-601.695) * [-602.978] (-604.723) (-603.411) (-601.407) -- 0:00:32
471500 -- (-604.890) (-604.961) [-603.302] (-603.386) * (-601.800) (-602.211) [-603.530] (-601.651) -- 0:00:32
472000 -- (-604.807) (-602.382) [-601.845] (-601.795) * (-604.318) [-601.907] (-601.682) (-604.243) -- 0:00:32
472500 -- (-607.216) (-601.679) [-602.631] (-605.517) * (-602.588) (-604.220) [-602.125] (-603.059) -- 0:00:32
473000 -- (-602.475) [-601.477] (-604.189) (-603.834) * (-603.591) (-602.867) (-604.527) [-600.803] -- 0:00:32
473500 -- (-602.409) (-601.237) [-601.418] (-606.389) * (-605.745) (-603.123) (-608.132) [-601.503] -- 0:00:32
474000 -- (-602.771) [-603.349] (-601.539) (-603.434) * (-600.967) (-601.386) (-604.591) [-602.604] -- 0:00:32
474500 -- (-602.080) (-603.395) (-604.036) [-603.095] * (-604.666) [-608.399] (-602.994) (-604.010) -- 0:00:32
475000 -- [-603.734] (-602.886) (-609.992) (-601.947) * (-603.741) (-606.674) [-603.069] (-602.250) -- 0:00:32
Average standard deviation of split frequencies: 0.013469
475500 -- [-603.860] (-604.092) (-603.250) (-603.533) * [-607.492] (-604.828) (-603.213) (-601.886) -- 0:00:31
476000 -- (-605.396) (-603.734) (-601.291) [-602.379] * (-603.944) [-604.498] (-605.999) (-602.272) -- 0:00:31
476500 -- (-603.506) (-606.424) (-602.385) [-602.946] * (-601.979) [-603.737] (-603.022) (-603.942) -- 0:00:31
477000 -- (-605.096) (-607.732) (-604.197) [-601.289] * (-605.752) (-603.096) [-603.468] (-604.548) -- 0:00:31
477500 -- (-603.588) [-603.348] (-602.963) (-602.073) * (-605.742) (-608.337) [-608.533] (-603.104) -- 0:00:31
478000 -- (-601.616) (-605.104) [-602.980] (-605.184) * (-605.158) [-600.966] (-603.337) (-603.141) -- 0:00:31
478500 -- (-602.399) (-604.193) [-601.285] (-603.411) * (-605.396) (-602.040) [-601.773] (-606.006) -- 0:00:31
479000 -- (-601.881) (-604.515) [-601.848] (-603.185) * (-605.118) (-601.521) [-605.508] (-604.591) -- 0:00:31
479500 -- (-602.031) [-602.178] (-605.265) (-606.061) * (-609.216) [-601.975] (-601.102) (-602.195) -- 0:00:31
480000 -- (-603.731) (-605.660) (-604.739) [-604.152] * (-604.018) [-603.604] (-601.153) (-605.330) -- 0:00:31
Average standard deviation of split frequencies: 0.012946
480500 -- (-603.545) [-606.147] (-602.379) (-602.206) * [-604.856] (-604.087) (-601.305) (-601.483) -- 0:00:31
481000 -- [-602.651] (-606.272) (-602.383) (-602.841) * (-608.284) [-605.973] (-602.109) (-603.892) -- 0:00:31
481500 -- (-602.444) (-601.696) (-603.380) [-603.731] * (-603.379) (-602.982) (-604.234) [-606.860] -- 0:00:31
482000 -- (-605.513) (-602.424) [-603.106] (-601.401) * (-605.835) (-601.395) [-602.363] (-602.264) -- 0:00:31
482500 -- [-601.893] (-605.133) (-604.681) (-601.061) * [-604.392] (-601.597) (-605.715) (-604.338) -- 0:00:31
483000 -- (-601.194) (-606.953) (-602.435) [-602.221] * (-605.509) [-602.527] (-608.034) (-602.349) -- 0:00:31
483500 -- (-601.064) (-607.183) (-601.420) [-602.308] * (-604.283) (-607.970) (-602.088) [-604.622] -- 0:00:30
484000 -- (-603.028) (-606.878) (-602.584) [-603.168] * (-602.716) [-601.914] (-606.618) (-606.165) -- 0:00:30
484500 -- (-602.769) (-605.028) (-602.047) [-602.046] * [-603.976] (-604.281) (-603.790) (-602.825) -- 0:00:30
485000 -- (-602.171) [-601.289] (-601.955) (-601.482) * [-602.923] (-601.587) (-603.105) (-603.449) -- 0:00:30
Average standard deviation of split frequencies: 0.013515
485500 -- [-601.997] (-602.452) (-604.698) (-602.711) * (-603.099) [-605.808] (-602.313) (-602.474) -- 0:00:30
486000 -- (-602.785) [-603.288] (-605.343) (-602.835) * (-602.737) (-603.457) [-602.996] (-606.067) -- 0:00:30
486500 -- (-602.075) (-602.853) [-603.585] (-602.085) * (-604.278) (-607.985) (-602.956) [-601.318] -- 0:00:30
487000 -- (-604.315) (-601.561) (-604.998) [-605.525] * (-601.967) (-607.633) (-602.652) [-601.301] -- 0:00:31
487500 -- (-602.352) (-605.179) (-607.586) [-602.497] * (-601.789) [-605.132] (-602.339) (-602.588) -- 0:00:31
488000 -- (-603.876) (-606.716) (-610.103) [-603.374] * [-602.120] (-603.045) (-605.203) (-602.456) -- 0:00:31
488500 -- [-602.556] (-602.592) (-603.754) (-603.853) * [-603.222] (-602.122) (-605.019) (-603.806) -- 0:00:31
489000 -- (-603.297) [-603.519] (-601.600) (-603.972) * [-602.055] (-601.920) (-603.627) (-602.530) -- 0:00:31
489500 -- (-606.130) (-607.077) [-604.334] (-601.621) * [-601.834] (-602.977) (-605.830) (-602.793) -- 0:00:31
490000 -- (-604.208) (-602.304) [-602.659] (-605.131) * (-601.788) [-603.413] (-604.548) (-601.510) -- 0:00:31
Average standard deviation of split frequencies: 0.012874
490500 -- (-601.926) (-602.052) [-602.564] (-602.750) * [-602.234] (-601.743) (-602.464) (-601.952) -- 0:00:31
491000 -- [-605.436] (-607.977) (-607.707) (-604.868) * (-601.562) (-601.061) [-603.386] (-604.119) -- 0:00:31
491500 -- (-601.940) [-604.268] (-602.865) (-604.188) * (-602.572) (-601.234) [-605.250] (-603.792) -- 0:00:31
492000 -- (-603.799) (-604.213) (-603.596) [-601.525] * (-602.794) [-604.812] (-604.810) (-601.935) -- 0:00:30
492500 -- (-603.390) (-608.848) [-604.887] (-604.205) * (-602.797) (-606.171) [-602.803] (-602.637) -- 0:00:30
493000 -- (-602.141) (-607.647) (-603.792) [-603.922] * [-601.687] (-601.645) (-603.723) (-603.702) -- 0:00:30
493500 -- (-605.006) (-602.205) (-600.982) [-601.781] * (-602.920) (-601.723) [-602.616] (-605.389) -- 0:00:30
494000 -- (-602.183) (-605.482) (-601.200) [-602.088] * (-603.222) (-602.684) [-601.961] (-603.167) -- 0:00:30
494500 -- (-603.896) [-602.529] (-602.306) (-602.141) * (-605.270) [-601.647] (-601.687) (-610.499) -- 0:00:30
495000 -- (-608.900) [-603.075] (-601.809) (-604.415) * (-603.622) [-601.103] (-602.445) (-602.161) -- 0:00:30
Average standard deviation of split frequencies: 0.012926
495500 -- (-608.528) (-605.546) [-604.852] (-604.185) * [-602.743] (-603.290) (-604.315) (-603.224) -- 0:00:30
496000 -- (-604.547) (-601.834) [-600.953] (-602.952) * (-603.037) (-603.605) [-601.805] (-603.231) -- 0:00:30
496500 -- (-601.582) (-605.461) (-603.074) [-601.800] * (-602.676) (-601.820) [-603.493] (-600.869) -- 0:00:30
497000 -- (-602.819) (-603.119) (-602.948) [-603.826] * [-603.254] (-603.725) (-601.629) (-604.389) -- 0:00:30
497500 -- (-601.538) (-602.137) (-604.028) [-606.460] * [-607.324] (-601.818) (-601.944) (-602.558) -- 0:00:30
498000 -- (-605.442) (-601.278) (-602.514) [-604.864] * (-603.145) (-602.710) (-602.634) [-603.488] -- 0:00:30
498500 -- (-605.879) (-605.031) [-602.260] (-603.741) * (-603.020) [-606.567] (-603.826) (-603.057) -- 0:00:30
499000 -- (-601.783) (-607.340) (-601.823) [-601.569] * [-603.052] (-604.224) (-601.274) (-603.409) -- 0:00:30
499500 -- [-602.650] (-607.225) (-601.754) (-602.344) * [-603.346] (-607.563) (-602.871) (-602.114) -- 0:00:30
500000 -- (-601.504) (-603.034) [-608.702] (-602.478) * [-601.090] (-605.759) (-605.102) (-604.229) -- 0:00:30
Average standard deviation of split frequencies: 0.012931
500500 -- (-605.068) (-601.873) [-604.903] (-601.957) * (-601.512) [-603.069] (-608.469) (-604.310) -- 0:00:29
501000 -- (-604.644) (-602.618) [-604.970] (-602.651) * (-604.610) (-602.486) (-603.156) [-601.487] -- 0:00:29
501500 -- [-603.023] (-607.643) (-601.675) (-602.905) * (-604.285) [-603.064] (-601.011) (-603.585) -- 0:00:29
502000 -- (-605.819) [-605.772] (-601.652) (-606.358) * (-603.596) [-602.827] (-605.449) (-605.084) -- 0:00:29
502500 -- (-605.133) (-604.021) [-604.416] (-606.650) * (-604.375) (-602.512) (-602.662) [-602.450] -- 0:00:29
503000 -- [-603.124] (-605.265) (-604.474) (-601.682) * (-604.322) (-606.189) [-602.384] (-601.165) -- 0:00:29
503500 -- (-604.866) [-602.975] (-603.133) (-603.000) * [-605.808] (-604.460) (-602.328) (-601.915) -- 0:00:29
504000 -- (-606.732) [-601.962] (-601.784) (-603.022) * (-604.226) [-601.593] (-603.549) (-601.929) -- 0:00:29
504500 -- (-603.220) [-602.829] (-601.288) (-603.862) * (-605.071) [-603.909] (-606.242) (-603.697) -- 0:00:30
505000 -- [-603.870] (-602.480) (-604.582) (-601.296) * (-603.887) [-601.396] (-605.777) (-604.915) -- 0:00:30
Average standard deviation of split frequencies: 0.012461
505500 -- (-601.625) [-603.485] (-602.894) (-602.104) * (-604.113) (-603.510) (-601.656) [-604.369] -- 0:00:30
506000 -- (-602.358) (-603.339) (-602.306) [-604.386] * (-601.461) [-606.239] (-603.682) (-604.555) -- 0:00:30
506500 -- (-603.865) [-601.223] (-605.123) (-602.422) * (-603.977) [-605.100] (-601.164) (-601.788) -- 0:00:30
507000 -- (-602.747) [-607.941] (-606.585) (-603.526) * (-602.145) (-601.103) [-603.015] (-602.415) -- 0:00:30
507500 -- (-602.127) (-602.417) (-600.950) [-603.547] * (-605.918) (-601.377) (-602.982) [-602.409] -- 0:00:30
508000 -- (-601.928) [-603.104] (-603.197) (-604.469) * (-602.222) (-603.501) [-601.600] (-602.952) -- 0:00:30
508500 -- (-604.403) (-600.879) [-603.582] (-602.653) * [-601.827] (-603.052) (-605.021) (-602.040) -- 0:00:29
509000 -- (-601.958) (-601.238) [-606.009] (-601.520) * (-601.535) [-603.036] (-608.072) (-604.102) -- 0:00:29
509500 -- (-602.089) (-604.371) (-606.033) [-601.534] * [-601.421] (-602.622) (-605.697) (-605.280) -- 0:00:29
510000 -- (-602.515) [-603.835] (-602.543) (-601.326) * (-601.392) (-604.112) [-602.151] (-607.782) -- 0:00:29
Average standard deviation of split frequencies: 0.012247
510500 -- (-605.626) (-601.077) [-604.423] (-604.994) * (-601.658) (-605.160) (-604.116) [-605.502] -- 0:00:29
511000 -- [-604.062] (-602.448) (-604.324) (-602.934) * (-603.306) (-604.407) (-601.895) [-603.255] -- 0:00:29
511500 -- (-604.691) [-602.007] (-601.252) (-601.174) * (-602.894) [-603.867] (-603.052) (-602.413) -- 0:00:29
512000 -- (-609.914) (-601.537) [-603.312] (-603.236) * (-602.823) (-605.353) (-603.768) [-605.101] -- 0:00:29
512500 -- (-607.607) (-602.267) [-601.565] (-602.774) * (-603.040) (-602.660) (-605.044) [-602.373] -- 0:00:29
513000 -- [-601.692] (-602.815) (-601.233) (-602.867) * (-602.583) [-601.785] (-601.659) (-604.577) -- 0:00:29
513500 -- [-604.897] (-601.272) (-601.826) (-606.130) * (-601.280) [-602.798] (-605.561) (-601.913) -- 0:00:29
514000 -- [-606.330] (-601.781) (-603.764) (-601.923) * [-602.031] (-603.956) (-603.886) (-603.620) -- 0:00:29
514500 -- (-603.833) [-602.094] (-605.244) (-600.728) * [-601.704] (-603.607) (-603.118) (-601.549) -- 0:00:29
515000 -- [-604.342] (-602.768) (-604.808) (-603.478) * (-603.164) [-601.540] (-603.019) (-604.185) -- 0:00:29
Average standard deviation of split frequencies: 0.012059
515500 -- (-601.070) (-603.265) (-602.152) [-601.227] * [-604.576] (-602.226) (-602.848) (-604.104) -- 0:00:29
516000 -- [-601.717] (-602.990) (-601.550) (-602.672) * (-603.999) (-603.742) [-602.721] (-604.402) -- 0:00:29
516500 -- (-603.369) [-602.686] (-602.064) (-601.425) * [-603.133] (-602.853) (-602.556) (-607.684) -- 0:00:29
517000 -- (-607.229) (-601.243) [-602.425] (-604.012) * (-603.598) [-606.040] (-606.412) (-603.414) -- 0:00:28
517500 -- (-606.096) [-601.814] (-605.159) (-603.675) * [-601.764] (-605.144) (-603.937) (-604.369) -- 0:00:28
518000 -- (-602.886) (-603.305) (-605.881) [-601.779] * (-602.682) (-602.776) [-601.900] (-605.326) -- 0:00:28
518500 -- (-605.139) [-604.770] (-601.942) (-603.959) * (-604.511) (-603.684) [-601.615] (-604.915) -- 0:00:28
519000 -- (-606.069) (-604.023) (-604.784) [-604.933] * (-602.449) (-603.774) [-601.799] (-601.824) -- 0:00:28
519500 -- (-603.533) [-603.892] (-602.027) (-603.359) * [-603.027] (-603.023) (-604.409) (-602.589) -- 0:00:28
520000 -- [-601.470] (-606.714) (-601.958) (-603.022) * (-603.362) [-602.048] (-603.532) (-600.861) -- 0:00:28
Average standard deviation of split frequencies: 0.012072
520500 -- (-605.823) [-603.851] (-606.436) (-603.434) * (-602.327) [-603.807] (-606.729) (-607.379) -- 0:00:28
521000 -- [-601.887] (-601.271) (-604.249) (-604.686) * (-602.325) [-604.813] (-602.513) (-609.182) -- 0:00:28
521500 -- (-602.107) [-607.251] (-604.958) (-602.604) * [-604.557] (-603.000) (-600.944) (-604.784) -- 0:00:29
522000 -- (-603.583) (-605.435) [-604.710] (-602.210) * (-604.408) [-601.918] (-601.174) (-604.736) -- 0:00:29
522500 -- (-602.056) (-602.313) (-604.213) [-607.356] * (-601.051) (-601.192) [-601.963] (-604.600) -- 0:00:29
523000 -- (-603.935) [-605.253] (-606.702) (-602.476) * [-602.310] (-602.940) (-601.904) (-601.256) -- 0:00:29
523500 -- (-602.080) [-602.601] (-603.225) (-602.695) * (-601.157) (-601.921) (-602.379) [-602.698] -- 0:00:29
524000 -- (-601.773) [-602.018] (-602.938) (-601.221) * (-603.708) (-602.452) [-607.857] (-607.420) -- 0:00:29
524500 -- [-604.670] (-603.064) (-602.372) (-603.455) * (-602.964) (-602.455) [-601.893] (-603.417) -- 0:00:29
525000 -- (-603.533) (-602.991) [-603.666] (-607.919) * (-608.013) (-602.637) (-601.967) [-602.662] -- 0:00:28
Average standard deviation of split frequencies: 0.012155
525500 -- (-605.756) (-601.709) [-602.770] (-602.757) * (-612.874) (-602.505) [-602.656] (-604.110) -- 0:00:28
526000 -- (-603.357) [-600.864] (-605.192) (-603.920) * (-602.059) [-601.649] (-602.167) (-604.238) -- 0:00:28
526500 -- (-601.055) (-601.470) [-602.415] (-601.893) * [-601.429] (-604.535) (-604.985) (-601.921) -- 0:00:28
527000 -- [-605.330] (-606.356) (-604.584) (-601.919) * (-601.838) (-603.078) (-602.900) [-603.217] -- 0:00:28
527500 -- [-602.732] (-602.808) (-603.685) (-605.074) * (-603.038) (-602.636) (-606.225) [-605.131] -- 0:00:28
528000 -- (-603.487) [-604.656] (-601.784) (-600.879) * (-605.583) (-604.056) (-609.648) [-607.981] -- 0:00:28
528500 -- (-601.689) (-601.289) [-602.461] (-601.608) * [-605.200] (-604.905) (-604.606) (-604.377) -- 0:00:28
529000 -- (-605.764) (-604.113) (-603.146) [-601.643] * [-604.313] (-604.586) (-604.138) (-605.531) -- 0:00:28
529500 -- (-602.372) (-603.284) [-604.665] (-601.959) * (-606.225) (-602.375) [-602.163] (-602.896) -- 0:00:28
530000 -- [-601.071] (-603.468) (-601.256) (-605.062) * (-605.040) (-602.490) [-601.311] (-604.970) -- 0:00:28
Average standard deviation of split frequencies: 0.011770
530500 -- (-604.896) (-603.726) [-602.901] (-607.917) * (-602.488) (-603.101) [-602.476] (-601.440) -- 0:00:28
531000 -- (-602.876) [-602.474] (-601.957) (-604.641) * [-606.767] (-603.461) (-601.704) (-604.968) -- 0:00:28
531500 -- (-601.226) [-604.290] (-602.784) (-603.438) * (-605.421) (-605.682) (-604.431) [-603.961] -- 0:00:28
532000 -- [-601.335] (-601.281) (-605.809) (-600.865) * (-605.508) [-604.914] (-601.103) (-603.168) -- 0:00:28
532500 -- (-603.360) [-602.897] (-604.417) (-603.725) * [-605.283] (-606.762) (-604.119) (-601.483) -- 0:00:28
533000 -- (-602.477) (-604.849) (-602.921) [-602.829] * (-604.871) (-604.293) (-601.516) [-603.803] -- 0:00:28
533500 -- (-602.514) (-603.511) [-603.183] (-603.482) * (-605.622) (-603.347) (-601.711) [-602.422] -- 0:00:27
534000 -- [-605.375] (-602.665) (-605.123) (-605.159) * (-602.634) [-605.617] (-604.684) (-601.768) -- 0:00:27
534500 -- [-602.179] (-602.609) (-603.784) (-604.809) * (-603.585) (-602.032) [-603.315] (-603.399) -- 0:00:27
535000 -- (-602.166) (-602.203) (-605.462) [-602.635] * (-603.770) (-602.358) (-603.704) [-601.970] -- 0:00:27
Average standard deviation of split frequencies: 0.012698
535500 -- (-604.585) (-603.527) [-601.129] (-603.108) * (-602.438) [-608.626] (-602.416) (-601.759) -- 0:00:27
536000 -- (-605.756) (-603.195) [-601.550] (-603.697) * (-601.374) [-602.345] (-603.535) (-601.197) -- 0:00:27
536500 -- (-603.117) [-604.300] (-602.005) (-604.282) * (-607.503) [-603.754] (-603.852) (-601.528) -- 0:00:27
537000 -- (-602.642) [-604.201] (-602.992) (-603.160) * [-602.146] (-602.397) (-602.072) (-602.575) -- 0:00:27
537500 -- (-603.547) (-602.501) (-601.719) [-603.758] * [-602.548] (-603.834) (-605.419) (-603.117) -- 0:00:27
538000 -- (-602.758) (-606.190) (-602.825) [-601.235] * [-604.456] (-603.936) (-605.188) (-604.216) -- 0:00:28
538500 -- (-607.589) [-603.309] (-603.016) (-601.939) * (-606.064) [-603.525] (-603.908) (-606.333) -- 0:00:28
539000 -- (-604.299) (-603.230) (-603.904) [-605.214] * (-600.953) (-603.165) (-601.838) [-603.093] -- 0:00:28
539500 -- (-601.184) (-601.842) [-603.313] (-605.942) * (-602.617) [-604.676] (-609.836) (-602.711) -- 0:00:28
540000 -- (-602.468) (-605.611) [-604.118] (-604.491) * (-602.421) (-602.482) (-602.492) [-604.654] -- 0:00:28
Average standard deviation of split frequencies: 0.012860
540500 -- (-604.943) (-603.740) (-603.591) [-603.022] * (-601.713) (-602.897) (-602.890) [-601.822] -- 0:00:28
541000 -- (-603.871) [-603.572] (-601.959) (-603.526) * (-602.188) [-603.964] (-604.710) (-601.495) -- 0:00:27
541500 -- (-604.588) (-603.505) [-604.036] (-605.147) * (-606.029) [-605.534] (-603.843) (-602.942) -- 0:00:27
542000 -- (-603.719) [-601.522] (-603.147) (-601.108) * [-605.239] (-601.697) (-603.197) (-602.291) -- 0:00:27
542500 -- (-606.579) [-603.068] (-610.964) (-604.133) * [-603.896] (-602.416) (-607.411) (-603.078) -- 0:00:27
543000 -- [-605.393] (-604.355) (-602.878) (-602.068) * (-603.060) (-601.937) (-604.405) [-601.421] -- 0:00:27
543500 -- (-601.715) (-603.916) (-602.282) [-603.065] * (-606.224) (-602.364) (-602.203) [-601.185] -- 0:00:27
544000 -- (-601.442) (-606.764) (-604.020) [-601.486] * (-601.604) (-603.272) (-605.757) [-602.793] -- 0:00:27
544500 -- (-604.614) (-602.541) [-602.068] (-601.317) * (-601.463) [-601.014] (-604.290) (-605.286) -- 0:00:27
545000 -- (-602.418) (-605.816) [-602.056] (-605.954) * (-601.146) (-601.410) [-603.581] (-604.499) -- 0:00:27
Average standard deviation of split frequencies: 0.012544
545500 -- (-602.692) [-603.059] (-601.816) (-604.970) * (-605.242) (-602.008) (-602.640) [-601.003] -- 0:00:27
546000 -- [-602.162] (-604.185) (-602.357) (-604.232) * (-604.616) (-604.054) [-603.307] (-601.312) -- 0:00:27
546500 -- [-601.885] (-602.874) (-602.395) (-602.766) * (-601.105) [-604.122] (-602.435) (-601.550) -- 0:00:27
547000 -- (-602.261) [-602.548] (-607.671) (-605.918) * (-601.603) [-602.054] (-608.154) (-603.544) -- 0:00:27
547500 -- (-601.589) (-603.824) [-606.925] (-602.709) * (-601.913) [-601.460] (-603.974) (-607.845) -- 0:00:27
548000 -- [-603.035] (-603.992) (-602.054) (-604.803) * [-603.512] (-604.255) (-604.078) (-603.235) -- 0:00:27
548500 -- (-602.525) [-601.280] (-602.271) (-603.204) * (-603.502) (-602.115) [-601.648] (-601.941) -- 0:00:27
549000 -- [-603.408] (-601.819) (-602.872) (-604.786) * (-605.958) (-604.703) [-601.300] (-602.195) -- 0:00:27
549500 -- (-604.534) (-601.987) (-603.868) [-604.491] * (-601.450) (-603.115) [-601.069] (-601.706) -- 0:00:27
550000 -- (-604.455) (-602.777) [-601.642] (-608.073) * (-602.647) [-605.490] (-603.118) (-609.754) -- 0:00:27
Average standard deviation of split frequencies: 0.012589
550500 -- (-602.060) (-601.764) (-603.531) [-604.948] * (-604.844) (-608.081) [-601.005] (-604.125) -- 0:00:26
551000 -- (-605.496) [-601.624] (-603.018) (-603.250) * (-602.222) (-606.726) (-601.450) [-601.787] -- 0:00:26
551500 -- (-601.473) (-602.672) (-607.587) [-601.835] * (-602.292) (-603.966) (-602.518) [-602.862] -- 0:00:26
552000 -- [-604.775] (-603.736) (-606.019) (-602.202) * [-604.849] (-601.066) (-601.685) (-606.930) -- 0:00:26
552500 -- (-601.186) (-603.063) (-605.767) [-601.477] * (-602.382) (-601.951) [-601.953] (-605.938) -- 0:00:26
553000 -- [-602.444] (-605.429) (-605.210) (-603.325) * (-601.237) (-604.330) [-601.811] (-601.400) -- 0:00:26
553500 -- (-603.256) (-602.338) (-602.757) [-606.803] * [-601.609] (-601.328) (-602.925) (-603.371) -- 0:00:26
554000 -- (-602.911) (-603.776) (-603.338) [-607.399] * (-603.086) (-603.639) [-602.690] (-601.813) -- 0:00:26
554500 -- (-602.934) (-604.234) (-601.971) [-603.068] * (-603.426) (-601.773) (-602.514) [-604.674] -- 0:00:26
555000 -- [-605.500] (-604.184) (-601.892) (-603.881) * [-603.708] (-602.095) (-604.454) (-604.105) -- 0:00:27
Average standard deviation of split frequencies: 0.012867
555500 -- [-601.857] (-602.631) (-601.872) (-603.942) * (-601.408) (-601.782) [-603.696] (-606.285) -- 0:00:27
556000 -- (-608.585) (-605.978) (-602.936) [-602.484] * (-601.704) [-601.544] (-603.443) (-602.676) -- 0:00:27
556500 -- (-604.281) [-604.875] (-602.154) (-604.907) * [-605.329] (-604.307) (-604.301) (-601.464) -- 0:00:27
557000 -- [-601.388] (-605.623) (-602.375) (-603.217) * (-605.438) (-606.377) (-604.836) [-601.739] -- 0:00:27
557500 -- (-601.061) [-606.507] (-602.887) (-605.542) * [-604.898] (-602.132) (-604.576) (-605.454) -- 0:00:26
558000 -- (-603.524) (-602.823) [-601.869] (-601.453) * (-600.787) (-602.089) [-602.305] (-603.844) -- 0:00:26
558500 -- (-602.706) [-602.529] (-603.716) (-604.241) * (-601.125) (-602.747) [-602.913] (-602.297) -- 0:00:26
559000 -- (-601.588) [-604.418] (-603.551) (-605.232) * (-601.257) (-605.721) [-602.907] (-608.602) -- 0:00:26
559500 -- [-603.251] (-601.520) (-605.975) (-602.813) * (-601.373) (-605.253) (-601.787) [-604.563] -- 0:00:26
560000 -- (-602.140) (-605.104) (-605.844) [-605.007] * [-604.074] (-604.806) (-604.509) (-602.734) -- 0:00:26
Average standard deviation of split frequencies: 0.012760
560500 -- (-607.219) (-602.169) (-603.063) [-604.779] * (-601.709) [-601.708] (-602.400) (-607.844) -- 0:00:26
561000 -- (-607.159) [-603.636] (-605.340) (-604.994) * (-601.594) [-601.761] (-607.194) (-603.733) -- 0:00:26
561500 -- (-601.842) (-603.694) (-602.770) [-601.892] * (-602.816) [-601.815] (-603.344) (-603.844) -- 0:00:26
562000 -- [-601.043] (-601.812) (-608.186) (-602.411) * (-603.733) (-602.657) (-603.886) [-602.608] -- 0:00:26
562500 -- (-601.651) (-604.342) [-601.845] (-601.195) * [-601.295] (-604.464) (-604.670) (-605.197) -- 0:00:26
563000 -- (-601.466) [-601.956] (-604.090) (-602.486) * (-601.203) (-605.195) (-603.101) [-602.873] -- 0:00:26
563500 -- (-601.979) [-605.865] (-602.347) (-603.416) * [-603.684] (-602.909) (-604.285) (-601.385) -- 0:00:26
564000 -- (-602.442) [-605.852] (-606.193) (-602.499) * [-602.075] (-608.099) (-605.371) (-601.665) -- 0:00:26
564500 -- [-602.023] (-605.209) (-604.152) (-601.371) * [-604.039] (-601.943) (-604.831) (-602.790) -- 0:00:26
565000 -- (-602.739) [-603.571] (-602.176) (-601.949) * (-606.644) [-602.157] (-601.644) (-602.889) -- 0:00:26
Average standard deviation of split frequencies: 0.012447
565500 -- (-603.431) (-607.306) [-602.390] (-603.942) * (-603.444) [-604.802] (-602.338) (-605.212) -- 0:00:26
566000 -- (-604.879) (-603.417) [-602.961] (-603.035) * (-602.391) [-602.322] (-602.814) (-603.331) -- 0:00:26
566500 -- (-603.789) (-602.868) [-603.844] (-603.355) * (-601.881) [-602.241] (-603.627) (-602.842) -- 0:00:26
567000 -- (-605.535) [-603.239] (-601.108) (-602.961) * (-601.881) (-603.006) [-604.255] (-602.112) -- 0:00:25
567500 -- [-601.897] (-602.206) (-602.394) (-603.471) * (-602.910) [-602.392] (-602.813) (-601.742) -- 0:00:25
568000 -- (-603.339) (-601.897) [-603.283] (-603.415) * (-601.973) [-602.306] (-603.228) (-602.783) -- 0:00:25
568500 -- (-602.281) (-603.994) (-603.706) [-603.016] * (-602.816) [-602.535] (-603.536) (-606.446) -- 0:00:25
569000 -- (-608.616) (-603.569) [-604.760] (-603.340) * [-604.612] (-602.349) (-601.447) (-605.442) -- 0:00:25
569500 -- (-604.979) (-601.911) [-602.121] (-600.857) * (-603.981) (-603.681) [-601.932] (-606.814) -- 0:00:25
570000 -- (-601.935) (-604.781) (-601.179) [-602.529] * [-601.682] (-602.978) (-604.803) (-601.957) -- 0:00:25
Average standard deviation of split frequencies: 0.012666
570500 -- [-601.211] (-603.274) (-603.394) (-601.558) * [-603.787] (-603.305) (-601.937) (-603.028) -- 0:00:25
571000 -- [-601.214] (-602.017) (-603.388) (-602.318) * (-603.516) (-605.334) [-601.529] (-604.970) -- 0:00:25
571500 -- (-603.050) (-609.437) [-604.452] (-602.383) * [-602.000] (-606.087) (-605.204) (-605.324) -- 0:00:26
572000 -- (-603.670) [-602.687] (-604.058) (-605.684) * (-602.791) (-606.270) (-604.902) [-602.280] -- 0:00:26
572500 -- (-605.729) (-605.793) [-604.022] (-602.257) * [-602.288] (-601.534) (-605.188) (-605.955) -- 0:00:26
573000 -- [-602.916] (-601.992) (-604.105) (-602.471) * (-602.778) (-605.625) (-601.720) [-605.016] -- 0:00:26
573500 -- [-606.102] (-602.339) (-603.147) (-600.738) * (-607.289) (-602.137) [-603.740] (-602.096) -- 0:00:26
574000 -- (-604.361) (-602.243) (-604.536) [-602.619] * (-605.689) [-601.347] (-603.015) (-604.520) -- 0:00:25
574500 -- (-601.428) (-601.308) (-602.020) [-601.718] * [-602.510] (-603.955) (-603.964) (-604.630) -- 0:00:25
575000 -- (-601.289) (-602.481) (-601.763) [-602.400] * (-605.377) (-601.888) [-601.139] (-604.108) -- 0:00:25
Average standard deviation of split frequencies: 0.013004
575500 -- (-602.567) (-603.867) [-603.579] (-603.204) * [-603.350] (-603.024) (-602.665) (-604.400) -- 0:00:25
576000 -- (-603.104) [-604.156] (-602.768) (-610.432) * (-601.398) (-604.475) [-602.466] (-600.808) -- 0:00:25
576500 -- (-604.399) (-603.722) [-602.487] (-604.137) * (-603.074) (-601.934) (-602.861) [-602.383] -- 0:00:25
577000 -- [-602.467] (-605.972) (-602.668) (-604.548) * [-601.943] (-606.888) (-602.440) (-603.525) -- 0:00:25
577500 -- [-603.053] (-607.444) (-602.247) (-605.068) * (-603.913) (-604.835) (-601.967) [-608.077] -- 0:00:25
578000 -- (-601.516) [-601.480] (-605.467) (-604.921) * (-607.515) (-601.107) [-601.547] (-604.307) -- 0:00:25
578500 -- [-602.424] (-608.062) (-602.736) (-601.085) * (-602.858) [-605.275] (-602.124) (-604.268) -- 0:00:25
579000 -- (-604.640) (-603.692) (-603.626) [-601.207] * [-602.820] (-606.515) (-606.637) (-603.770) -- 0:00:25
579500 -- (-604.009) (-601.512) [-602.758] (-602.146) * (-607.491) (-602.367) [-603.189] (-603.722) -- 0:00:25
580000 -- (-604.901) (-602.046) (-603.600) [-604.986] * (-610.699) (-608.385) [-601.123] (-602.719) -- 0:00:25
Average standard deviation of split frequencies: 0.012764
580500 -- (-604.144) (-603.066) (-602.642) [-601.134] * (-607.785) (-601.157) [-601.828] (-601.065) -- 0:00:25
581000 -- (-602.837) (-606.172) (-603.379) [-602.641] * [-605.758] (-601.272) (-601.036) (-602.771) -- 0:00:25
581500 -- [-604.320] (-602.364) (-603.840) (-602.169) * (-602.601) [-601.344] (-602.298) (-603.734) -- 0:00:25
582000 -- (-601.964) (-604.956) (-601.709) [-604.954] * (-602.233) [-602.790] (-605.369) (-603.634) -- 0:00:25
582500 -- (-602.740) (-604.615) (-603.857) [-603.842] * (-603.745) [-602.493] (-606.040) (-602.703) -- 0:00:25
583000 -- [-603.714] (-603.551) (-607.558) (-600.832) * (-604.527) [-603.295] (-602.411) (-602.932) -- 0:00:25
583500 -- [-601.834] (-606.110) (-602.375) (-602.395) * (-606.952) [-602.428] (-605.883) (-602.907) -- 0:00:24
584000 -- (-603.616) [-604.444] (-602.778) (-601.638) * (-606.250) [-601.972] (-603.164) (-601.548) -- 0:00:24
584500 -- [-603.286] (-601.536) (-603.999) (-601.543) * (-608.673) (-601.795) (-600.983) [-602.819] -- 0:00:24
585000 -- (-602.965) [-603.880] (-603.489) (-604.722) * (-607.010) (-602.491) (-602.123) [-603.477] -- 0:00:24
Average standard deviation of split frequencies: 0.013095
585500 -- [-602.054] (-602.494) (-604.464) (-600.708) * (-603.148) (-601.450) [-603.482] (-605.307) -- 0:00:24
586000 -- (-603.725) (-605.892) (-605.907) [-600.726] * [-602.224] (-601.300) (-604.504) (-603.132) -- 0:00:24
586500 -- [-603.217] (-603.227) (-602.199) (-604.081) * (-604.246) [-601.220] (-607.804) (-602.912) -- 0:00:24
587000 -- (-602.585) (-603.281) [-602.386] (-602.748) * (-601.454) (-603.414) (-606.509) [-605.152] -- 0:00:24
587500 -- (-602.244) (-605.207) [-603.559] (-601.669) * (-603.073) (-604.850) (-601.557) [-604.056] -- 0:00:24
588000 -- [-607.326] (-601.544) (-601.687) (-601.428) * (-602.166) (-604.997) [-601.773] (-604.147) -- 0:00:24
588500 -- (-605.084) (-602.513) [-603.928] (-605.038) * (-603.660) (-600.946) (-601.571) [-602.544] -- 0:00:24
589000 -- [-604.444] (-603.036) (-601.412) (-605.748) * (-601.644) (-601.387) [-602.458] (-601.370) -- 0:00:25
589500 -- [-603.709] (-603.446) (-603.676) (-607.037) * [-601.292] (-602.401) (-601.534) (-602.825) -- 0:00:25
590000 -- (-603.597) [-601.001] (-604.082) (-602.782) * (-604.246) (-610.382) (-603.344) [-602.961] -- 0:00:25
Average standard deviation of split frequencies: 0.013168
590500 -- (-602.305) (-601.229) (-605.189) [-602.764] * (-601.543) (-608.387) [-602.017] (-602.481) -- 0:00:24
591000 -- [-605.463] (-602.312) (-606.437) (-604.235) * (-602.118) (-602.164) (-604.432) [-602.558] -- 0:00:24
591500 -- (-603.545) (-605.591) (-604.585) [-600.846] * (-602.170) (-603.907) (-603.393) [-601.938] -- 0:00:24
592000 -- [-603.288] (-603.003) (-602.985) (-602.737) * (-602.319) [-603.549] (-603.063) (-603.743) -- 0:00:24
592500 -- (-600.922) (-603.253) [-604.174] (-602.944) * [-603.872] (-603.777) (-601.963) (-605.022) -- 0:00:24
593000 -- (-602.122) (-601.840) [-601.910] (-600.925) * (-601.373) (-603.247) [-602.298] (-604.223) -- 0:00:24
593500 -- [-602.336] (-602.830) (-604.717) (-601.658) * [-606.080] (-602.927) (-601.569) (-601.365) -- 0:00:24
594000 -- (-603.043) (-607.690) (-601.862) [-603.155] * [-603.573] (-604.030) (-603.967) (-601.206) -- 0:00:24
594500 -- (-603.841) [-602.757] (-602.914) (-604.751) * (-604.357) (-604.554) (-601.395) [-601.773] -- 0:00:24
595000 -- [-603.877] (-601.098) (-601.510) (-604.656) * (-604.199) (-601.794) (-603.743) [-603.304] -- 0:00:24
Average standard deviation of split frequencies: 0.012479
595500 -- [-604.887] (-601.179) (-604.842) (-601.230) * [-606.329] (-602.237) (-605.471) (-608.218) -- 0:00:24
596000 -- (-602.770) (-601.144) (-606.784) [-601.745] * (-601.573) (-605.909) [-608.320] (-604.461) -- 0:00:24
596500 -- (-605.233) [-603.992] (-605.620) (-601.651) * (-602.029) (-601.285) (-603.551) [-601.737] -- 0:00:24
597000 -- (-603.937) (-601.748) [-603.039] (-602.260) * (-602.586) (-601.850) [-603.207] (-603.511) -- 0:00:24
597500 -- (-604.519) (-604.579) [-604.486] (-601.661) * (-603.451) (-604.410) (-604.396) [-601.215] -- 0:00:24
598000 -- (-603.760) (-602.342) [-601.254] (-601.663) * (-602.548) (-603.530) (-604.916) [-602.074] -- 0:00:24
598500 -- (-602.024) (-604.075) (-601.851) [-603.502] * (-602.389) [-602.215] (-603.887) (-602.176) -- 0:00:24
599000 -- (-602.442) (-602.458) (-602.047) [-604.915] * (-602.579) [-601.595] (-601.709) (-603.862) -- 0:00:24
599500 -- [-601.644] (-603.183) (-601.389) (-604.045) * (-603.866) [-601.188] (-603.364) (-602.159) -- 0:00:24
600000 -- [-604.185] (-606.320) (-603.511) (-607.579) * (-604.015) (-601.752) (-605.167) [-604.034] -- 0:00:24
Average standard deviation of split frequencies: 0.012862
600500 -- (-601.323) [-602.625] (-601.933) (-603.539) * (-603.476) (-603.362) (-602.550) [-603.265] -- 0:00:23
601000 -- [-601.111] (-602.198) (-602.912) (-603.246) * (-601.621) [-603.198] (-600.890) (-602.857) -- 0:00:23
601500 -- (-601.949) (-603.877) [-601.578] (-602.619) * (-602.035) (-604.884) [-602.996] (-601.860) -- 0:00:23
602000 -- [-602.796] (-605.429) (-601.967) (-603.779) * [-602.511] (-604.096) (-604.229) (-603.155) -- 0:00:23
602500 -- (-603.433) (-606.972) [-602.983] (-607.852) * (-601.212) [-603.057] (-602.474) (-604.155) -- 0:00:23
603000 -- (-605.941) (-602.614) [-601.480] (-601.374) * (-603.985) (-602.257) (-607.523) [-603.977] -- 0:00:23
603500 -- (-601.677) (-603.303) (-600.942) [-602.494] * [-600.798] (-602.920) (-604.973) (-604.778) -- 0:00:23
604000 -- [-601.640] (-602.081) (-602.491) (-605.530) * (-606.121) (-606.665) (-603.846) [-605.443] -- 0:00:23
604500 -- (-601.943) [-602.159] (-604.833) (-604.678) * [-601.977] (-606.437) (-604.985) (-600.966) -- 0:00:23
605000 -- [-602.036] (-602.727) (-602.920) (-601.613) * (-601.133) [-602.220] (-600.719) (-603.152) -- 0:00:23
Average standard deviation of split frequencies: 0.013051
605500 -- [-603.456] (-603.144) (-604.045) (-605.603) * (-603.043) [-605.033] (-602.574) (-601.200) -- 0:00:24
606000 -- [-602.209] (-606.818) (-604.161) (-603.661) * (-605.454) (-601.852) (-603.723) [-603.187] -- 0:00:24
606500 -- (-602.381) (-602.395) (-608.386) [-605.736] * (-603.878) (-602.266) (-606.200) [-601.799] -- 0:00:24
607000 -- (-604.061) (-602.360) (-604.673) [-602.142] * (-605.562) [-603.073] (-604.148) (-601.302) -- 0:00:23
607500 -- (-604.018) (-602.982) (-601.797) [-602.251] * (-601.768) (-604.878) [-601.560] (-602.117) -- 0:00:23
608000 -- (-602.969) (-604.007) (-603.131) [-601.839] * (-603.177) (-604.037) (-605.039) [-609.696] -- 0:00:23
608500 -- (-603.016) (-603.515) [-603.128] (-602.197) * (-604.074) [-607.193] (-601.902) (-601.999) -- 0:00:23
609000 -- (-603.278) (-601.895) [-603.486] (-605.002) * (-604.436) [-601.942] (-604.897) (-602.732) -- 0:00:23
609500 -- [-602.889] (-602.995) (-602.864) (-600.934) * [-604.163] (-603.328) (-603.125) (-600.790) -- 0:00:23
610000 -- (-602.658) (-600.845) (-603.539) [-604.543] * (-604.782) (-603.403) (-602.887) [-601.393] -- 0:00:23
Average standard deviation of split frequencies: 0.012609
610500 -- (-605.768) (-604.995) [-602.161] (-604.643) * (-607.623) [-602.069] (-601.429) (-602.380) -- 0:00:23
611000 -- (-604.825) (-602.490) [-600.937] (-602.323) * (-603.026) [-602.435] (-605.640) (-604.008) -- 0:00:23
611500 -- (-603.963) (-602.432) [-602.590] (-602.274) * (-603.099) (-606.015) (-603.202) [-602.576] -- 0:00:23
612000 -- [-601.026] (-603.960) (-602.473) (-602.728) * (-604.791) [-601.791] (-604.257) (-604.254) -- 0:00:23
612500 -- (-606.472) [-602.717] (-604.644) (-602.142) * [-601.417] (-602.494) (-603.741) (-602.813) -- 0:00:23
613000 -- [-605.666] (-601.531) (-612.864) (-602.299) * [-601.023] (-605.313) (-602.055) (-602.229) -- 0:00:23
613500 -- (-604.092) (-604.780) (-606.560) [-602.643] * (-601.481) (-608.225) (-601.874) [-601.375] -- 0:00:23
614000 -- [-600.936] (-602.667) (-605.256) (-602.618) * (-601.100) (-601.945) (-602.085) [-601.632] -- 0:00:23
614500 -- (-601.923) (-605.008) [-604.096] (-602.496) * (-602.257) (-605.030) (-603.920) [-601.790] -- 0:00:23
615000 -- (-606.314) (-601.687) (-602.969) [-601.599] * [-604.243] (-604.019) (-603.550) (-604.594) -- 0:00:23
Average standard deviation of split frequencies: 0.012797
615500 -- (-603.089) (-602.830) (-605.165) [-602.262] * (-601.418) [-603.973] (-607.585) (-603.016) -- 0:00:23
616000 -- (-602.142) (-602.751) (-602.983) [-602.972] * (-602.258) (-601.929) (-603.933) [-601.796] -- 0:00:23
616500 -- (-604.579) [-602.555] (-603.076) (-602.527) * [-601.860] (-602.130) (-601.532) (-601.356) -- 0:00:23
617000 -- (-605.285) (-604.120) [-601.974] (-603.924) * (-602.065) [-601.595] (-601.735) (-603.161) -- 0:00:22
617500 -- (-603.639) (-608.170) (-601.686) [-604.720] * (-601.236) (-601.615) [-602.913] (-601.223) -- 0:00:22
618000 -- (-605.324) [-602.901] (-601.732) (-602.858) * [-601.201] (-600.878) (-601.869) (-602.651) -- 0:00:22
618500 -- (-603.155) (-603.515) [-605.246] (-602.341) * [-601.605] (-602.549) (-601.838) (-604.580) -- 0:00:22
619000 -- (-602.539) [-603.844] (-605.543) (-602.896) * (-605.480) (-601.271) (-601.852) [-604.041] -- 0:00:22
619500 -- (-603.640) [-604.878] (-602.809) (-601.775) * [-604.193] (-603.875) (-605.225) (-603.662) -- 0:00:22
620000 -- [-604.148] (-601.572) (-601.874) (-602.885) * (-603.683) [-603.612] (-605.387) (-601.678) -- 0:00:22
Average standard deviation of split frequencies: 0.012867
620500 -- (-603.776) (-602.861) (-605.541) [-602.894] * (-603.725) (-601.736) [-602.145] (-602.542) -- 0:00:22
621000 -- (-603.450) (-602.108) (-611.921) [-602.246] * (-606.149) (-603.360) [-601.536] (-604.714) -- 0:00:22
621500 -- (-606.505) [-608.835] (-605.376) (-603.302) * (-602.171) (-604.606) [-602.298] (-601.157) -- 0:00:22
622000 -- [-603.971] (-606.750) (-610.701) (-603.833) * (-603.147) [-603.952] (-602.825) (-602.994) -- 0:00:22
622500 -- (-603.170) [-602.542] (-608.012) (-601.653) * [-601.881] (-602.545) (-601.353) (-603.115) -- 0:00:23
623000 -- (-605.370) [-601.133] (-602.458) (-605.253) * (-604.813) [-603.555] (-601.101) (-608.459) -- 0:00:22
623500 -- (-608.723) (-601.189) [-603.872] (-601.600) * (-605.217) (-605.964) (-603.319) [-602.707] -- 0:00:22
624000 -- (-602.577) (-602.146) (-606.714) [-604.279] * [-602.537] (-602.052) (-602.859) (-601.992) -- 0:00:22
624500 -- (-603.421) [-604.943] (-603.783) (-605.933) * (-602.305) [-602.261] (-602.065) (-604.919) -- 0:00:22
625000 -- (-605.111) (-603.207) [-603.955] (-604.966) * (-604.359) (-607.441) (-604.724) [-604.655] -- 0:00:22
Average standard deviation of split frequencies: 0.012713
625500 -- (-603.406) [-601.861] (-604.559) (-604.148) * (-602.554) (-605.450) [-602.619] (-604.854) -- 0:00:22
626000 -- (-601.954) [-605.944] (-604.410) (-602.959) * [-602.255] (-603.190) (-605.886) (-603.794) -- 0:00:22
626500 -- (-602.927) (-603.401) [-601.305] (-603.547) * [-604.043] (-603.134) (-603.641) (-602.418) -- 0:00:22
627000 -- [-603.061] (-603.128) (-602.701) (-606.548) * [-604.159] (-602.671) (-601.256) (-603.192) -- 0:00:22
627500 -- (-606.744) (-602.800) [-602.377] (-603.131) * (-603.198) [-603.462] (-602.671) (-602.603) -- 0:00:22
628000 -- (-606.699) (-602.464) (-601.083) [-601.699] * (-604.936) (-603.813) [-603.401] (-604.427) -- 0:00:22
628500 -- (-603.291) (-602.686) (-602.023) [-602.746] * (-605.875) (-604.234) (-602.161) [-602.166] -- 0:00:22
629000 -- [-602.999] (-604.454) (-602.572) (-602.986) * (-603.395) (-605.329) [-604.300] (-601.562) -- 0:00:22
629500 -- (-603.532) [-602.720] (-604.669) (-600.884) * (-605.298) [-606.083] (-604.435) (-601.638) -- 0:00:22
630000 -- (-601.297) (-602.342) (-603.361) [-602.324] * (-605.952) [-605.035] (-601.333) (-605.288) -- 0:00:22
Average standard deviation of split frequencies: 0.012091
630500 -- [-603.067] (-602.554) (-606.095) (-603.275) * (-602.597) (-605.373) [-602.805] (-605.644) -- 0:00:22
631000 -- (-601.810) (-602.089) [-601.892] (-604.452) * (-603.872) [-601.948] (-602.993) (-602.682) -- 0:00:22
631500 -- (-604.266) (-609.890) [-606.448] (-606.155) * (-606.157) (-602.081) (-602.483) [-600.832] -- 0:00:22
632000 -- (-602.388) (-603.086) (-605.587) [-604.437] * (-603.321) (-601.907) (-602.677) [-601.920] -- 0:00:22
632500 -- [-601.626] (-601.246) (-606.547) (-612.373) * (-602.904) (-602.363) (-606.136) [-601.286] -- 0:00:22
633000 -- (-604.388) (-601.692) [-605.468] (-600.916) * (-604.646) (-601.539) (-603.588) [-601.938] -- 0:00:22
633500 -- [-605.982] (-601.803) (-602.555) (-601.868) * (-603.712) (-602.094) (-603.233) [-603.374] -- 0:00:21
634000 -- (-604.060) (-609.028) (-602.266) [-602.589] * (-604.415) (-602.718) (-602.679) [-602.983] -- 0:00:21
634500 -- [-602.654] (-603.436) (-604.066) (-602.731) * [-603.074] (-604.305) (-606.296) (-604.494) -- 0:00:21
635000 -- [-602.668] (-604.956) (-602.240) (-602.841) * (-604.080) (-605.022) (-605.505) [-602.632] -- 0:00:21
Average standard deviation of split frequencies: 0.012426
635500 -- [-603.041] (-607.056) (-603.101) (-604.487) * (-602.436) [-601.487] (-601.811) (-602.565) -- 0:00:21
636000 -- (-602.420) (-604.960) (-601.561) [-607.396] * (-604.964) (-605.595) (-602.233) [-604.772] -- 0:00:21
636500 -- (-602.186) [-602.944] (-601.603) (-601.988) * (-606.160) [-601.717] (-601.194) (-603.296) -- 0:00:21
637000 -- (-602.141) (-602.063) [-601.983] (-602.961) * (-603.880) (-604.299) (-602.343) [-603.098] -- 0:00:21
637500 -- (-608.846) (-606.035) (-602.033) [-605.978] * [-602.227] (-604.915) (-603.233) (-609.277) -- 0:00:21
638000 -- [-603.412] (-603.952) (-602.455) (-601.890) * (-601.715) (-603.070) [-602.704] (-602.209) -- 0:00:21
638500 -- (-601.460) (-600.899) (-603.173) [-601.874] * (-602.428) (-601.512) (-602.886) [-605.442] -- 0:00:21
639000 -- (-602.119) (-604.504) (-603.303) [-601.963] * (-609.243) (-602.677) [-602.626] (-603.907) -- 0:00:21
639500 -- (-606.125) (-602.142) [-602.536] (-602.275) * (-602.216) (-602.285) [-602.081] (-604.733) -- 0:00:21
640000 -- [-603.087] (-603.001) (-604.532) (-602.061) * (-603.853) [-602.625] (-603.668) (-602.924) -- 0:00:21
Average standard deviation of split frequencies: 0.012336
640500 -- [-602.375] (-601.046) (-601.557) (-604.278) * (-604.293) (-605.974) (-604.755) [-605.360] -- 0:00:21
641000 -- (-601.592) (-604.543) (-607.080) [-601.650] * (-603.840) (-607.394) [-604.544] (-602.968) -- 0:00:21
641500 -- (-605.417) (-604.540) (-604.500) [-601.581] * (-602.634) (-611.374) (-609.790) [-604.291] -- 0:00:21
642000 -- (-602.757) (-602.348) (-602.981) [-602.436] * [-606.544] (-602.362) (-604.101) (-601.546) -- 0:00:21
642500 -- (-602.733) (-604.541) (-602.754) [-601.275] * (-608.760) [-601.792] (-603.766) (-602.782) -- 0:00:21
643000 -- [-601.377] (-602.499) (-604.639) (-603.060) * (-602.239) [-602.423] (-603.803) (-604.054) -- 0:00:21
643500 -- [-604.420] (-604.275) (-604.318) (-603.802) * (-602.505) (-606.449) (-602.994) [-601.750] -- 0:00:21
644000 -- [-601.756] (-601.224) (-604.372) (-602.085) * (-602.099) [-602.639] (-602.441) (-602.782) -- 0:00:21
644500 -- (-602.791) (-602.942) (-603.861) [-601.745] * (-607.750) [-601.697] (-603.725) (-601.556) -- 0:00:21
645000 -- (-602.824) (-601.192) [-601.647] (-604.711) * (-602.516) [-604.200] (-603.200) (-602.212) -- 0:00:21
Average standard deviation of split frequencies: 0.012062
645500 -- [-602.290] (-602.049) (-602.842) (-603.076) * (-602.878) (-602.488) (-603.079) [-603.785] -- 0:00:21
646000 -- (-602.526) (-601.691) [-602.024] (-604.534) * (-601.622) (-605.423) [-603.994] (-605.424) -- 0:00:21
646500 -- (-602.174) (-603.423) [-600.950] (-603.541) * (-602.033) (-603.159) [-603.884] (-605.860) -- 0:00:21
647000 -- (-603.034) (-603.702) (-602.725) [-605.096] * (-608.953) (-608.495) [-603.417] (-601.466) -- 0:00:21
647500 -- (-601.948) (-603.524) [-604.278] (-603.044) * (-607.009) (-607.169) [-602.126] (-605.742) -- 0:00:21
648000 -- (-602.179) (-604.493) [-602.590] (-605.737) * (-603.145) [-606.310] (-601.873) (-602.819) -- 0:00:21
648500 -- (-602.090) (-606.223) [-601.407] (-605.616) * (-602.603) (-605.452) [-602.573] (-610.512) -- 0:00:21
649000 -- (-601.507) (-608.015) [-607.842] (-602.774) * (-604.461) (-605.710) (-604.327) [-605.829] -- 0:00:21
649500 -- [-603.527] (-607.216) (-603.481) (-604.812) * (-604.543) [-601.188] (-603.514) (-609.773) -- 0:00:21
650000 -- [-603.955] (-603.527) (-604.415) (-601.850) * (-602.731) (-604.520) (-604.752) [-602.282] -- 0:00:21
Average standard deviation of split frequencies: 0.011379
650500 -- (-603.020) (-603.707) (-602.931) [-602.181] * (-602.055) [-601.870] (-608.644) (-602.107) -- 0:00:20
651000 -- (-602.510) (-606.111) [-604.462] (-604.823) * (-602.029) (-601.897) (-606.047) [-600.907] -- 0:00:20
651500 -- (-606.166) (-607.967) [-606.232] (-603.634) * (-606.140) (-603.456) [-606.776] (-602.915) -- 0:00:20
652000 -- (-602.351) (-603.185) [-606.217] (-601.272) * [-602.044] (-602.827) (-604.424) (-602.381) -- 0:00:20
652500 -- (-604.507) [-604.231] (-603.113) (-601.734) * (-603.634) (-602.882) (-602.507) [-603.041] -- 0:00:20
653000 -- (-602.228) (-603.959) (-603.203) [-602.446] * [-602.024] (-603.998) (-602.832) (-604.948) -- 0:00:20
653500 -- (-602.081) (-606.241) (-603.211) [-602.980] * (-604.483) (-602.254) (-604.570) [-601.427] -- 0:00:20
654000 -- (-601.087) (-601.686) [-601.706] (-601.818) * (-602.851) [-601.930] (-601.159) (-604.672) -- 0:00:20
654500 -- [-602.342] (-604.294) (-601.578) (-603.345) * (-604.065) (-602.954) (-601.830) [-602.432] -- 0:00:20
655000 -- (-603.289) (-604.319) (-601.956) [-603.417] * (-603.639) (-603.464) [-602.226] (-602.612) -- 0:00:20
Average standard deviation of split frequencies: 0.011033
655500 -- (-604.004) (-603.100) [-601.767] (-602.770) * (-603.886) (-601.343) [-603.343] (-601.757) -- 0:00:20
656000 -- (-602.893) [-603.472] (-602.547) (-602.771) * (-603.765) (-602.270) (-603.583) [-600.885] -- 0:00:20
656500 -- (-606.812) (-606.901) [-603.674] (-602.277) * [-601.770] (-604.246) (-601.762) (-602.650) -- 0:00:20
657000 -- (-603.155) (-604.901) [-604.529] (-603.170) * (-601.164) (-603.812) [-603.280] (-604.941) -- 0:00:20
657500 -- (-602.798) (-603.710) (-606.914) [-602.165] * (-601.283) (-606.243) [-602.366] (-606.362) -- 0:00:20
658000 -- (-602.710) (-604.461) [-601.276] (-601.650) * (-602.183) [-602.119] (-603.551) (-602.571) -- 0:00:20
658500 -- (-603.171) (-602.256) [-605.527] (-601.495) * (-601.412) (-601.813) (-602.529) [-604.411] -- 0:00:20
659000 -- (-605.461) (-613.537) [-602.617] (-603.474) * (-601.249) [-603.388] (-601.023) (-602.701) -- 0:00:20
659500 -- [-602.786] (-603.974) (-602.303) (-606.810) * (-600.951) (-602.707) (-604.888) [-604.228] -- 0:00:20
660000 -- [-603.849] (-605.860) (-602.499) (-603.202) * (-601.923) [-601.403] (-602.706) (-607.687) -- 0:00:20
Average standard deviation of split frequencies: 0.011081
660500 -- (-604.223) [-603.611] (-604.267) (-603.567) * [-607.913] (-601.941) (-602.940) (-607.478) -- 0:00:20
661000 -- (-602.403) [-608.235] (-603.250) (-600.999) * [-604.141] (-601.820) (-606.239) (-604.578) -- 0:00:20
661500 -- [-601.853] (-608.886) (-604.996) (-602.910) * (-606.270) [-603.389] (-604.611) (-606.915) -- 0:00:20
662000 -- [-602.293] (-602.213) (-601.516) (-603.240) * (-605.417) [-602.376] (-601.064) (-603.422) -- 0:00:20
662500 -- (-603.768) (-601.299) (-601.298) [-606.239] * (-605.320) (-603.995) [-601.548] (-601.317) -- 0:00:20
663000 -- (-603.360) [-602.806] (-601.813) (-602.833) * [-606.766] (-602.959) (-603.399) (-601.654) -- 0:00:20
663500 -- (-603.744) (-603.101) (-600.999) [-602.410] * (-603.153) (-605.852) [-605.160] (-601.984) -- 0:00:20
664000 -- (-603.696) (-602.846) (-602.064) [-603.632] * [-607.323] (-607.458) (-605.984) (-605.654) -- 0:00:20
664500 -- (-603.101) [-605.518] (-603.484) (-604.243) * (-603.350) (-604.506) [-602.510] (-600.961) -- 0:00:20
665000 -- [-602.401] (-603.636) (-602.997) (-603.343) * (-602.749) (-602.995) [-601.507] (-605.973) -- 0:00:20
Average standard deviation of split frequencies: 0.011075
665500 -- (-601.670) (-603.327) [-600.965] (-604.426) * (-604.237) (-603.569) [-603.107] (-607.491) -- 0:00:20
666000 -- [-601.966] (-605.249) (-601.765) (-603.137) * (-603.652) (-602.300) [-601.626] (-603.818) -- 0:00:20
666500 -- (-605.375) (-610.912) [-601.016] (-605.633) * (-607.778) [-603.959] (-604.517) (-604.751) -- 0:00:20
667000 -- (-602.652) (-603.423) [-604.626] (-604.802) * [-602.592] (-604.565) (-604.979) (-601.723) -- 0:00:19
667500 -- [-601.620] (-603.272) (-604.911) (-600.841) * (-603.096) (-601.387) (-601.779) [-603.593] -- 0:00:19
668000 -- [-604.005] (-602.277) (-605.103) (-604.289) * [-604.302] (-604.656) (-601.298) (-602.335) -- 0:00:19
668500 -- (-605.867) (-601.443) [-602.087] (-601.297) * (-601.728) (-603.564) (-603.940) [-602.062] -- 0:00:19
669000 -- [-602.207] (-601.730) (-603.375) (-605.501) * (-602.365) (-601.450) [-603.885] (-605.399) -- 0:00:19
669500 -- (-602.978) (-602.927) (-602.208) [-603.454] * [-604.625] (-601.452) (-606.706) (-602.089) -- 0:00:19
670000 -- (-604.866) [-600.856] (-602.511) (-602.346) * (-601.292) (-601.102) [-601.435] (-605.483) -- 0:00:19
Average standard deviation of split frequencies: 0.010915
670500 -- (-603.756) (-602.705) [-609.088] (-601.688) * [-603.691] (-607.303) (-601.905) (-606.977) -- 0:00:19
671000 -- (-601.730) (-602.694) [-605.711] (-602.583) * (-606.588) [-604.681] (-601.600) (-601.248) -- 0:00:19
671500 -- [-602.820] (-602.711) (-606.388) (-603.841) * (-608.147) (-606.761) [-601.697] (-603.001) -- 0:00:19
672000 -- (-604.747) [-600.790] (-603.818) (-603.365) * (-603.223) (-612.584) (-600.809) [-602.273] -- 0:00:19
672500 -- (-601.926) (-602.080) (-603.198) [-601.630] * [-603.218] (-604.422) (-602.727) (-602.495) -- 0:00:19
673000 -- (-605.467) (-602.512) (-602.921) [-602.960] * [-605.480] (-605.516) (-601.060) (-604.432) -- 0:00:19
673500 -- (-602.168) [-602.339] (-603.720) (-600.981) * (-603.520) (-603.753) (-601.080) [-603.677] -- 0:00:19
674000 -- (-602.108) (-601.433) [-602.128] (-604.123) * (-606.349) [-604.447] (-601.772) (-605.139) -- 0:00:19
674500 -- (-602.561) (-601.790) (-602.579) [-602.206] * [-601.640] (-601.719) (-604.099) (-604.329) -- 0:00:19
675000 -- (-605.452) [-602.780] (-602.904) (-602.000) * (-602.606) (-604.644) (-602.954) [-603.077] -- 0:00:19
Average standard deviation of split frequencies: 0.010419
675500 -- [-603.538] (-603.738) (-602.902) (-608.383) * (-602.647) (-609.957) (-601.877) [-602.514] -- 0:00:19
676000 -- (-604.805) (-602.117) (-607.214) [-603.428] * (-603.514) [-601.620] (-601.488) (-602.708) -- 0:00:19
676500 -- (-601.679) (-604.876) [-601.648] (-606.200) * (-601.785) (-601.778) [-602.845] (-601.014) -- 0:00:19
677000 -- (-602.206) [-602.413] (-602.845) (-601.817) * (-601.916) (-602.013) (-601.482) [-606.604] -- 0:00:19
677500 -- (-601.644) [-603.650] (-605.860) (-604.217) * (-603.309) (-602.512) (-601.515) [-609.387] -- 0:00:19
678000 -- [-603.199] (-603.227) (-602.951) (-604.223) * (-602.805) (-602.092) (-602.735) [-602.252] -- 0:00:19
678500 -- [-603.077] (-603.873) (-603.195) (-604.415) * (-601.637) (-603.093) [-601.851] (-605.218) -- 0:00:19
679000 -- (-603.786) (-603.838) (-602.305) [-605.101] * (-602.370) (-605.201) [-602.027] (-604.011) -- 0:00:19
679500 -- [-602.610] (-601.650) (-601.724) (-606.657) * [-603.856] (-604.121) (-606.533) (-604.386) -- 0:00:19
680000 -- (-604.632) (-606.288) (-602.101) [-602.307] * (-603.631) (-602.160) [-601.654] (-603.477) -- 0:00:19
Average standard deviation of split frequencies: 0.010691
680500 -- (-602.411) (-605.566) (-603.719) [-601.162] * (-604.104) (-602.584) [-602.223] (-605.890) -- 0:00:19
681000 -- (-605.841) [-604.327] (-602.182) (-601.788) * (-603.346) (-604.517) (-602.458) [-601.160] -- 0:00:19
681500 -- [-603.193] (-601.636) (-601.431) (-605.388) * (-602.984) [-604.509] (-603.191) (-607.120) -- 0:00:19
682000 -- [-605.145] (-605.336) (-601.754) (-602.890) * (-600.903) (-602.055) [-602.284] (-602.632) -- 0:00:19
682500 -- (-608.042) (-605.308) [-600.968] (-607.532) * (-605.328) [-602.643] (-604.671) (-606.042) -- 0:00:19
683000 -- [-602.201] (-604.785) (-602.943) (-605.157) * (-608.229) (-601.723) (-603.175) [-607.556] -- 0:00:19
683500 -- (-608.330) (-602.300) [-606.866] (-603.793) * [-603.697] (-604.733) (-603.603) (-605.636) -- 0:00:18
684000 -- [-605.321] (-604.358) (-605.006) (-602.375) * (-602.996) (-602.672) (-602.759) [-601.173] -- 0:00:18
684500 -- (-602.361) (-600.859) (-605.059) [-602.769] * (-601.649) [-600.884] (-604.086) (-604.612) -- 0:00:18
685000 -- (-604.045) [-603.046] (-605.473) (-606.678) * (-603.988) (-605.417) [-601.017] (-603.998) -- 0:00:18
Average standard deviation of split frequencies: 0.011318
685500 -- (-604.835) (-603.976) [-601.868] (-605.876) * (-602.833) [-602.497] (-605.985) (-606.380) -- 0:00:18
686000 -- (-604.700) [-602.617] (-601.563) (-603.701) * (-602.848) (-600.796) [-603.402] (-601.779) -- 0:00:18
686500 -- (-605.034) (-601.568) (-602.816) [-606.945] * (-603.237) (-603.038) (-604.127) [-605.519] -- 0:00:18
687000 -- [-602.206] (-601.675) (-605.171) (-605.886) * (-603.079) (-601.500) [-602.183] (-601.900) -- 0:00:18
687500 -- (-601.485) (-604.127) (-605.061) [-605.010] * (-605.734) (-605.056) [-600.844] (-602.882) -- 0:00:18
688000 -- (-606.527) (-603.981) (-605.272) [-601.870] * [-603.758] (-602.985) (-605.303) (-600.890) -- 0:00:18
688500 -- (-606.642) (-601.994) (-606.060) [-601.327] * [-604.753] (-602.820) (-603.478) (-604.079) -- 0:00:18
689000 -- (-601.990) (-603.442) (-605.546) [-601.121] * (-602.343) (-605.324) (-605.189) [-602.324] -- 0:00:18
689500 -- (-602.398) (-605.481) [-604.831] (-602.473) * [-602.526] (-602.012) (-610.746) (-603.056) -- 0:00:18
690000 -- (-604.130) (-606.041) (-602.944) [-600.873] * (-606.058) (-602.431) (-605.508) [-604.042] -- 0:00:18
Average standard deviation of split frequencies: 0.011006
690500 -- [-601.493] (-603.485) (-602.758) (-603.449) * [-602.374] (-602.108) (-603.602) (-600.900) -- 0:00:18
691000 -- (-602.311) [-603.060] (-604.958) (-603.724) * (-604.502) (-604.625) [-601.437] (-602.849) -- 0:00:18
691500 -- (-603.436) (-602.084) (-603.689) [-604.570] * (-604.636) (-608.325) [-601.161] (-601.045) -- 0:00:18
692000 -- [-602.356] (-605.879) (-603.523) (-602.874) * (-605.030) (-604.012) [-601.804] (-602.089) -- 0:00:18
692500 -- [-604.927] (-603.488) (-603.804) (-602.869) * (-609.367) [-601.557] (-608.876) (-601.614) -- 0:00:18
693000 -- (-604.848) (-602.478) (-601.788) [-602.696] * (-604.076) [-601.527] (-604.932) (-602.276) -- 0:00:18
693500 -- (-603.218) (-601.816) [-601.392] (-603.625) * (-605.686) [-601.508] (-602.337) (-603.813) -- 0:00:18
694000 -- [-603.529] (-602.856) (-601.515) (-603.519) * [-602.393] (-603.379) (-605.848) (-604.141) -- 0:00:18
694500 -- (-604.172) (-604.533) [-603.318] (-603.433) * (-602.636) (-602.090) (-605.322) [-604.503] -- 0:00:18
695000 -- (-603.239) (-603.916) (-602.210) [-603.712] * (-602.500) (-606.320) (-603.283) [-606.183] -- 0:00:18
Average standard deviation of split frequencies: 0.011006
695500 -- [-604.969] (-603.683) (-602.837) (-603.442) * [-601.550] (-603.628) (-604.273) (-606.016) -- 0:00:18
696000 -- (-604.756) (-602.018) [-601.893] (-602.887) * (-605.265) [-606.363] (-608.059) (-605.303) -- 0:00:18
696500 -- [-603.684] (-602.639) (-601.134) (-601.711) * (-604.567) (-603.500) [-602.533] (-601.644) -- 0:00:18
697000 -- (-602.994) (-604.937) [-601.072] (-605.598) * [-602.122] (-605.753) (-605.042) (-603.570) -- 0:00:18
697500 -- (-602.616) (-605.034) (-602.155) [-602.988] * (-605.669) (-603.116) [-605.496] (-603.577) -- 0:00:18
698000 -- (-601.445) (-605.462) [-602.648] (-602.039) * (-601.118) (-602.854) (-603.326) [-603.573] -- 0:00:18
698500 -- (-602.019) (-606.957) (-601.655) [-601.487] * (-601.408) (-606.278) (-603.346) [-607.871] -- 0:00:18
699000 -- (-604.722) [-603.612] (-603.164) (-601.718) * (-601.017) (-603.325) [-603.452] (-601.773) -- 0:00:18
699500 -- (-601.520) (-601.104) [-603.324] (-603.207) * (-601.551) (-603.813) (-602.658) [-601.019] -- 0:00:18
700000 -- (-602.615) (-600.959) [-602.851] (-602.040) * (-604.844) [-601.981] (-602.123) (-607.264) -- 0:00:18
Average standard deviation of split frequencies: 0.011269
700500 -- (-606.097) [-602.251] (-605.263) (-601.715) * (-603.189) (-602.616) [-601.536] (-602.988) -- 0:00:17
701000 -- (-602.736) (-602.633) [-604.920] (-604.572) * [-601.026] (-603.774) (-602.415) (-602.267) -- 0:00:17
701500 -- (-602.270) (-604.529) (-602.369) [-602.478] * [-600.888] (-602.658) (-602.552) (-601.391) -- 0:00:17
702000 -- (-607.924) (-603.704) [-604.134] (-603.730) * (-603.010) [-605.424] (-602.794) (-602.092) -- 0:00:17
702500 -- (-604.348) [-601.667] (-603.018) (-601.904) * (-603.765) (-602.086) [-602.170] (-601.290) -- 0:00:17
703000 -- [-603.187] (-603.431) (-603.369) (-604.653) * [-604.268] (-608.154) (-602.194) (-604.390) -- 0:00:17
703500 -- (-602.385) (-602.774) [-602.019] (-606.237) * [-603.273] (-602.908) (-602.879) (-602.303) -- 0:00:17
704000 -- (-606.710) (-601.362) (-601.181) [-602.774] * [-605.401] (-602.445) (-602.858) (-601.816) -- 0:00:17
704500 -- (-603.453) [-604.562] (-602.656) (-604.612) * (-605.594) [-602.126] (-601.957) (-602.177) -- 0:00:17
705000 -- (-603.041) (-602.679) (-602.229) [-602.928] * [-603.601] (-601.561) (-601.511) (-602.918) -- 0:00:17
Average standard deviation of split frequencies: 0.011977
705500 -- (-601.807) (-603.142) (-601.475) [-601.767] * (-605.003) (-601.425) (-602.325) [-603.294] -- 0:00:17
706000 -- (-601.884) [-601.843] (-606.214) (-601.703) * [-602.695] (-601.106) (-601.180) (-606.532) -- 0:00:17
706500 -- (-601.537) (-600.768) (-603.921) [-604.051] * (-606.593) [-601.021] (-603.592) (-603.984) -- 0:00:17
707000 -- (-603.497) (-602.663) (-604.305) [-601.926] * (-602.246) [-602.726] (-602.359) (-602.238) -- 0:00:17
707500 -- (-602.831) (-603.058) [-601.714] (-602.333) * (-602.676) (-603.039) [-603.990] (-601.834) -- 0:00:17
708000 -- [-606.141] (-602.843) (-603.400) (-602.566) * [-603.879] (-603.079) (-602.755) (-602.441) -- 0:00:17
708500 -- (-601.328) (-602.020) [-603.258] (-601.815) * (-603.030) (-603.630) (-603.798) [-603.273] -- 0:00:17
709000 -- (-601.157) (-605.312) [-606.280] (-607.341) * (-603.847) [-602.197] (-601.889) (-603.566) -- 0:00:17
709500 -- [-602.561] (-602.807) (-605.275) (-609.168) * (-602.561) (-603.204) [-602.212] (-603.702) -- 0:00:17
710000 -- [-602.214] (-604.710) (-605.390) (-603.616) * (-603.388) [-607.571] (-601.827) (-601.875) -- 0:00:17
Average standard deviation of split frequencies: 0.012272
710500 -- (-601.128) (-603.384) [-603.220] (-604.207) * (-607.014) [-607.955] (-602.546) (-602.210) -- 0:00:17
711000 -- (-602.733) [-602.669] (-608.061) (-603.002) * (-602.669) [-604.649] (-603.150) (-603.987) -- 0:00:17
711500 -- (-603.922) (-601.322) (-604.956) [-604.503] * (-602.539) (-607.985) [-603.420] (-607.388) -- 0:00:17
712000 -- [-603.196] (-601.449) (-602.404) (-602.870) * (-602.073) [-601.525] (-604.108) (-601.584) -- 0:00:17
712500 -- (-602.715) (-602.552) (-602.491) [-602.257] * [-603.806] (-602.629) (-603.952) (-601.975) -- 0:00:17
713000 -- (-604.466) (-601.869) (-602.262) [-606.051] * [-604.667] (-602.817) (-601.616) (-606.024) -- 0:00:17
713500 -- (-610.588) [-602.507] (-603.672) (-603.269) * (-604.347) [-603.754] (-601.252) (-606.000) -- 0:00:17
714000 -- (-603.395) (-601.806) [-602.479] (-602.459) * (-605.544) (-601.827) (-601.557) [-606.167] -- 0:00:17
714500 -- (-604.196) [-602.739] (-604.030) (-604.196) * (-601.806) (-602.779) (-604.285) [-600.867] -- 0:00:17
715000 -- (-602.459) (-602.539) [-602.351] (-607.857) * [-605.542] (-601.175) (-602.772) (-603.007) -- 0:00:17
Average standard deviation of split frequencies: 0.011645
715500 -- (-602.185) (-601.754) [-602.156] (-602.458) * (-602.733) (-601.796) [-606.024] (-603.802) -- 0:00:17
716000 -- [-603.181] (-602.724) (-604.106) (-603.824) * (-601.434) (-602.145) (-605.416) [-602.007] -- 0:00:17
716500 -- [-604.797] (-601.711) (-602.449) (-601.759) * (-604.024) [-604.831] (-602.479) (-604.484) -- 0:00:17
717000 -- (-601.613) (-602.329) (-601.148) [-602.364] * (-601.978) (-601.826) [-605.732] (-602.866) -- 0:00:16
717500 -- (-602.088) (-603.030) (-602.232) [-601.600] * (-602.090) (-606.132) [-601.203] (-602.130) -- 0:00:16
718000 -- (-603.363) (-603.543) [-602.914] (-602.184) * [-601.239] (-603.399) (-601.772) (-604.232) -- 0:00:16
718500 -- [-601.598] (-602.821) (-601.043) (-602.544) * (-601.901) (-603.196) (-602.225) [-602.886] -- 0:00:16
719000 -- (-601.459) [-602.715] (-603.075) (-603.611) * [-602.035] (-603.094) (-600.833) (-602.246) -- 0:00:16
719500 -- [-601.961] (-602.218) (-607.705) (-601.991) * (-605.067) (-602.204) (-601.175) [-602.540] -- 0:00:16
720000 -- [-601.742] (-601.132) (-603.370) (-601.899) * (-610.792) (-604.190) (-602.860) [-604.247] -- 0:00:16
Average standard deviation of split frequencies: 0.011447
720500 -- (-603.748) (-602.755) (-602.455) [-602.361] * (-603.463) (-605.231) [-602.968] (-604.572) -- 0:00:16
721000 -- (-601.475) (-603.895) [-601.160] (-602.605) * (-602.744) (-604.592) (-605.422) [-602.233] -- 0:00:16
721500 -- (-602.312) (-606.009) (-603.879) [-602.952] * (-602.649) [-602.550] (-601.721) (-603.181) -- 0:00:16
722000 -- [-602.473] (-603.412) (-603.490) (-601.357) * [-601.521] (-601.865) (-605.371) (-602.026) -- 0:00:16
722500 -- (-602.441) (-604.418) [-602.791] (-601.568) * [-603.319] (-602.811) (-604.153) (-604.222) -- 0:00:16
723000 -- (-603.650) [-601.769] (-602.834) (-600.705) * (-602.104) [-601.449] (-602.494) (-602.378) -- 0:00:16
723500 -- (-607.817) (-603.813) [-602.668] (-603.344) * (-603.041) (-608.265) (-606.544) [-602.476] -- 0:00:16
724000 -- (-604.585) (-605.460) (-604.092) [-601.918] * (-605.351) (-601.292) (-605.837) [-603.572] -- 0:00:16
724500 -- (-604.749) (-602.276) (-603.522) [-605.514] * (-606.455) (-602.531) (-602.262) [-602.458] -- 0:00:16
725000 -- (-603.914) (-601.854) (-607.034) [-601.927] * (-605.168) (-602.621) (-601.732) [-602.469] -- 0:00:16
Average standard deviation of split frequencies: 0.011566
725500 -- (-603.251) (-601.109) (-605.508) [-607.027] * (-606.960) [-602.018] (-602.141) (-601.798) -- 0:00:16
726000 -- (-607.141) [-601.363] (-601.943) (-602.646) * (-604.360) [-601.628] (-602.240) (-601.834) -- 0:00:16
726500 -- (-603.474) (-604.388) (-601.850) [-602.516] * (-604.480) [-602.509] (-604.920) (-606.566) -- 0:00:16
727000 -- [-605.381] (-602.036) (-601.457) (-601.512) * (-608.062) [-603.872] (-601.643) (-605.035) -- 0:00:16
727500 -- (-604.164) [-606.967] (-602.449) (-605.348) * [-601.737] (-603.876) (-601.569) (-603.302) -- 0:00:16
728000 -- (-603.439) [-603.118] (-602.816) (-603.791) * (-602.740) [-601.044] (-606.726) (-603.787) -- 0:00:16
728500 -- (-602.924) (-606.043) [-605.061] (-602.380) * (-600.881) (-601.564) [-602.142] (-604.137) -- 0:00:16
729000 -- (-602.711) (-601.311) (-605.592) [-603.172] * (-600.901) (-601.432) (-605.513) [-610.932] -- 0:00:16
729500 -- (-605.477) (-601.210) (-604.394) [-602.018] * (-602.826) [-602.226] (-606.674) (-614.903) -- 0:00:16
730000 -- (-602.670) [-601.607] (-603.580) (-602.202) * (-603.111) (-601.281) (-602.688) [-608.611] -- 0:00:16
Average standard deviation of split frequencies: 0.011694
730500 -- (-603.576) (-600.942) (-603.372) [-603.528] * (-604.021) [-602.114] (-601.479) (-605.356) -- 0:00:16
731000 -- (-602.758) [-600.876] (-604.134) (-604.206) * (-603.070) (-602.579) (-601.140) [-604.436] -- 0:00:16
731500 -- (-603.004) (-604.022) (-606.059) [-603.691] * (-602.836) (-602.006) (-603.780) [-602.056] -- 0:00:16
732000 -- [-606.551] (-602.732) (-602.851) (-601.668) * (-601.657) (-606.515) [-602.811] (-603.480) -- 0:00:16
732500 -- [-607.676] (-606.101) (-603.190) (-601.700) * (-601.998) (-601.798) (-603.013) [-601.091] -- 0:00:16
733000 -- (-608.384) (-604.080) [-603.784] (-603.152) * (-601.559) (-603.362) [-601.864] (-603.113) -- 0:00:16
733500 -- (-603.576) [-602.403] (-605.664) (-604.526) * [-604.871] (-602.708) (-604.772) (-603.168) -- 0:00:15
734000 -- (-605.128) (-604.885) [-602.830] (-602.342) * (-603.793) (-602.853) [-603.344] (-604.173) -- 0:00:15
734500 -- (-603.377) [-602.351] (-603.661) (-602.567) * (-602.468) [-603.084] (-605.779) (-602.472) -- 0:00:15
735000 -- (-602.782) (-603.673) [-601.379] (-602.636) * (-603.266) (-603.353) (-602.974) [-605.969] -- 0:00:15
Average standard deviation of split frequencies: 0.011849
735500 -- (-605.719) [-603.794] (-601.515) (-607.438) * (-608.780) (-601.761) (-602.757) [-604.505] -- 0:00:15
736000 -- (-605.062) (-605.138) [-603.795] (-602.142) * [-603.940] (-602.620) (-601.677) (-603.297) -- 0:00:15
736500 -- (-602.057) (-605.703) (-606.232) [-602.525] * [-601.131] (-603.382) (-602.080) (-602.580) -- 0:00:15
737000 -- (-602.224) [-606.320] (-605.747) (-606.961) * [-600.927] (-603.316) (-601.996) (-606.262) -- 0:00:15
737500 -- (-603.401) (-604.572) [-605.319] (-605.500) * (-601.390) (-602.530) [-601.206] (-605.553) -- 0:00:15
738000 -- (-604.582) [-603.370] (-602.210) (-601.765) * [-602.757] (-601.479) (-602.673) (-605.881) -- 0:00:15
738500 -- (-603.567) (-603.156) [-603.396] (-604.177) * (-601.700) (-603.140) [-602.388] (-602.874) -- 0:00:15
739000 -- (-602.982) (-602.338) [-602.425] (-601.554) * (-601.800) [-602.002] (-602.373) (-610.427) -- 0:00:15
739500 -- (-603.647) [-601.910] (-601.977) (-601.353) * (-604.074) (-605.068) (-603.693) [-607.392] -- 0:00:15
740000 -- (-606.970) (-603.248) [-603.284] (-603.511) * (-603.520) [-608.006] (-605.257) (-602.031) -- 0:00:15
Average standard deviation of split frequencies: 0.011655
740500 -- (-602.303) (-601.635) [-602.537] (-602.223) * (-602.964) [-604.905] (-606.910) (-603.331) -- 0:00:15
741000 -- (-602.374) [-601.448] (-604.512) (-605.170) * [-603.028] (-602.331) (-603.230) (-601.929) -- 0:00:15
741500 -- (-606.013) [-602.364] (-604.812) (-604.848) * [-602.526] (-603.653) (-602.367) (-604.790) -- 0:00:15
742000 -- (-603.085) (-603.719) [-605.075] (-607.401) * (-602.303) (-603.654) (-603.166) [-601.803] -- 0:00:15
742500 -- (-601.895) (-603.181) (-602.942) [-604.041] * [-605.116] (-602.793) (-606.451) (-604.004) -- 0:00:15
743000 -- [-603.636] (-603.777) (-603.646) (-602.456) * [-603.469] (-602.902) (-602.041) (-604.557) -- 0:00:15
743500 -- [-602.942] (-604.016) (-603.394) (-601.915) * [-606.874] (-602.341) (-608.025) (-604.672) -- 0:00:15
744000 -- (-602.413) [-601.650] (-603.086) (-602.479) * (-605.903) (-601.358) [-601.057] (-602.594) -- 0:00:15
744500 -- (-605.670) [-603.562] (-602.489) (-608.765) * (-603.079) (-601.637) [-603.985] (-604.279) -- 0:00:15
745000 -- (-603.175) (-601.768) (-602.220) [-601.248] * (-604.727) [-603.050] (-602.877) (-603.835) -- 0:00:15
Average standard deviation of split frequencies: 0.011848
745500 -- [-601.839] (-606.054) (-602.894) (-601.173) * (-604.303) [-604.515] (-606.053) (-601.690) -- 0:00:15
746000 -- (-602.489) (-605.749) [-601.835] (-604.917) * [-605.162] (-604.034) (-603.226) (-602.728) -- 0:00:15
746500 -- (-603.621) (-604.363) [-603.383] (-602.705) * (-600.968) (-604.057) [-605.997] (-602.290) -- 0:00:15
747000 -- (-605.955) (-605.325) [-602.660] (-603.811) * (-600.877) [-602.394] (-602.232) (-605.207) -- 0:00:15
747500 -- [-603.342] (-603.634) (-603.926) (-602.269) * (-603.254) (-602.445) [-604.117] (-601.423) -- 0:00:15
748000 -- (-603.062) (-601.994) (-607.368) [-604.923] * (-601.267) (-602.647) (-602.832) [-601.796] -- 0:00:15
748500 -- [-602.318] (-602.675) (-602.175) (-604.124) * (-604.380) (-601.936) (-602.474) [-603.203] -- 0:00:15
749000 -- [-603.639] (-602.816) (-601.542) (-601.321) * (-600.986) [-603.879] (-601.693) (-603.104) -- 0:00:15
749500 -- (-602.499) [-601.324] (-602.099) (-601.154) * (-603.019) (-604.099) [-601.699] (-603.044) -- 0:00:15
750000 -- [-602.856] (-604.955) (-603.141) (-601.249) * (-605.471) [-608.470] (-604.492) (-602.954) -- 0:00:15
Average standard deviation of split frequencies: 0.011735
750500 -- (-605.493) (-602.309) (-601.693) [-602.104] * [-601.487] (-604.667) (-602.209) (-601.782) -- 0:00:14
751000 -- [-604.543] (-600.976) (-603.225) (-600.976) * (-601.462) [-602.639] (-604.497) (-601.717) -- 0:00:14
751500 -- (-603.073) [-601.969] (-603.782) (-601.891) * [-604.693] (-603.367) (-601.955) (-601.652) -- 0:00:14
752000 -- (-603.395) (-602.461) [-605.620] (-601.650) * (-604.283) (-603.819) [-600.992] (-604.019) -- 0:00:14
752500 -- [-603.588] (-605.866) (-602.397) (-602.349) * [-601.690] (-601.555) (-606.754) (-603.915) -- 0:00:14
753000 -- (-602.211) (-604.611) [-601.343] (-601.962) * (-601.589) [-601.359] (-602.823) (-602.335) -- 0:00:14
753500 -- [-602.807] (-603.259) (-601.307) (-602.201) * (-602.418) (-601.345) (-602.456) [-602.423] -- 0:00:14
754000 -- (-603.351) (-602.212) [-603.061] (-602.420) * (-603.097) (-606.242) (-601.317) [-602.852] -- 0:00:14
754500 -- (-603.845) [-602.155] (-605.453) (-604.066) * (-605.477) [-603.361] (-602.929) (-603.571) -- 0:00:14
755000 -- (-605.102) (-601.558) [-603.805] (-601.919) * (-604.377) (-602.922) [-605.599] (-605.893) -- 0:00:14
Average standard deviation of split frequencies: 0.011640
755500 -- (-602.878) (-603.268) (-603.043) [-601.902] * (-602.380) [-602.831] (-603.569) (-601.708) -- 0:00:14
756000 -- [-601.384] (-602.508) (-609.206) (-601.680) * (-604.783) (-605.441) (-601.910) [-601.514] -- 0:00:14
756500 -- (-601.852) (-602.033) [-603.095] (-601.996) * (-605.539) (-605.208) (-601.935) [-601.447] -- 0:00:14
757000 -- [-604.601] (-603.397) (-603.297) (-602.456) * (-604.182) [-604.532] (-606.061) (-601.379) -- 0:00:14
757500 -- (-603.179) (-601.671) [-602.876] (-604.543) * (-604.912) (-606.010) (-603.139) [-602.531] -- 0:00:14
758000 -- (-604.069) [-603.072] (-601.803) (-605.585) * (-602.996) (-606.053) [-603.520] (-602.026) -- 0:00:14
758500 -- (-604.092) (-607.703) [-602.908] (-603.597) * (-602.113) (-605.606) (-601.606) [-602.816] -- 0:00:14
759000 -- (-603.853) (-603.334) (-603.112) [-602.509] * (-602.915) (-604.970) (-601.890) [-605.078] -- 0:00:14
759500 -- [-601.862] (-603.065) (-600.977) (-602.663) * (-603.410) (-600.783) (-601.471) [-603.154] -- 0:00:14
760000 -- (-603.151) (-602.471) [-603.402] (-605.346) * (-602.251) [-601.394] (-602.708) (-601.938) -- 0:00:14
Average standard deviation of split frequencies: 0.011196
760500 -- (-608.980) (-602.566) [-601.333] (-603.665) * (-603.850) [-602.139] (-604.474) (-602.495) -- 0:00:14
761000 -- [-603.374] (-603.915) (-606.322) (-601.432) * (-602.833) (-602.102) [-601.861] (-603.308) -- 0:00:14
761500 -- [-605.409] (-602.447) (-603.019) (-602.333) * (-603.941) (-600.839) [-601.836] (-603.432) -- 0:00:14
762000 -- (-605.465) (-603.280) [-601.758] (-605.122) * (-601.954) (-606.216) (-605.829) [-603.584] -- 0:00:14
762500 -- [-604.179] (-601.225) (-610.661) (-601.792) * [-602.043] (-601.176) (-602.357) (-605.026) -- 0:00:14
763000 -- (-602.503) (-602.461) (-607.853) [-602.318] * [-601.110] (-605.044) (-603.156) (-603.552) -- 0:00:14
763500 -- (-603.890) (-604.968) [-601.755] (-603.432) * (-601.720) (-605.858) (-601.998) [-603.632] -- 0:00:14
764000 -- (-604.149) [-602.410] (-602.374) (-603.594) * [-602.554] (-604.709) (-606.227) (-603.368) -- 0:00:14
764500 -- (-603.771) (-605.589) [-602.578] (-602.329) * (-604.860) (-601.995) [-603.799] (-603.617) -- 0:00:14
765000 -- (-602.366) (-603.724) (-602.585) [-602.336] * (-603.629) [-602.721] (-602.431) (-602.407) -- 0:00:14
Average standard deviation of split frequencies: 0.010962
765500 -- [-602.961] (-605.490) (-607.609) (-604.449) * [-604.375] (-606.404) (-601.683) (-608.061) -- 0:00:14
766000 -- (-601.367) (-606.207) (-604.186) [-606.810] * [-602.142] (-602.292) (-602.216) (-604.668) -- 0:00:14
766500 -- (-601.680) (-602.895) [-601.977] (-602.398) * (-603.567) [-602.925] (-601.012) (-602.320) -- 0:00:14
767000 -- [-601.119] (-604.069) (-601.377) (-604.261) * [-602.351] (-605.003) (-603.659) (-603.658) -- 0:00:13
767500 -- (-601.346) (-602.339) [-602.010] (-603.181) * (-604.818) (-601.836) (-603.984) [-603.386] -- 0:00:13
768000 -- (-605.465) [-604.339] (-602.528) (-603.785) * (-603.942) [-602.991] (-603.160) (-604.008) -- 0:00:13
768500 -- [-603.652] (-602.850) (-603.902) (-605.366) * (-602.670) (-603.925) [-603.859] (-601.122) -- 0:00:13
769000 -- (-601.589) [-603.916] (-602.840) (-602.494) * (-607.186) (-603.647) (-604.618) [-603.685] -- 0:00:13
769500 -- (-603.036) (-603.838) (-603.391) [-601.928] * [-603.349] (-603.583) (-603.285) (-604.093) -- 0:00:13
770000 -- (-602.671) (-603.875) (-601.542) [-603.644] * (-602.016) [-601.324] (-602.519) (-610.394) -- 0:00:13
Average standard deviation of split frequencies: 0.011049
770500 -- (-602.027) (-603.915) [-605.115] (-603.136) * [-606.196] (-602.675) (-605.110) (-604.477) -- 0:00:13
771000 -- (-602.630) (-605.433) (-602.836) [-602.837] * (-601.341) (-610.468) [-603.357] (-606.400) -- 0:00:13
771500 -- (-604.607) (-604.008) (-604.582) [-602.397] * [-601.873] (-605.567) (-604.819) (-603.795) -- 0:00:13
772000 -- (-607.104) (-602.322) [-602.273] (-602.510) * (-603.638) [-607.489] (-602.389) (-600.884) -- 0:00:13
772500 -- (-603.335) [-604.927] (-600.750) (-603.368) * (-603.499) (-604.823) (-602.229) [-601.163] -- 0:00:13
773000 -- (-603.591) (-603.046) (-602.680) [-602.224] * (-603.573) (-601.672) (-603.608) [-601.869] -- 0:00:13
773500 -- (-601.620) (-601.513) (-604.093) [-602.256] * [-603.795] (-601.547) (-601.595) (-603.370) -- 0:00:13
774000 -- [-601.771] (-603.951) (-605.567) (-604.280) * (-605.602) [-601.079] (-607.298) (-603.523) -- 0:00:13
774500 -- [-606.942] (-605.716) (-604.232) (-601.231) * (-601.805) (-602.817) [-603.702] (-607.220) -- 0:00:13
775000 -- (-603.816) [-601.192] (-604.289) (-601.706) * [-601.764] (-600.912) (-606.041) (-601.377) -- 0:00:13
Average standard deviation of split frequencies: 0.010669
775500 -- [-603.047] (-602.701) (-604.087) (-604.100) * (-601.244) (-600.987) [-603.573] (-605.430) -- 0:00:13
776000 -- [-601.958] (-603.795) (-601.017) (-604.022) * [-601.708] (-602.395) (-600.718) (-604.201) -- 0:00:13
776500 -- (-601.043) (-602.566) [-603.780] (-604.878) * (-603.273) (-602.028) [-604.001] (-604.393) -- 0:00:13
777000 -- [-601.702] (-602.090) (-609.695) (-604.361) * (-603.664) [-601.361] (-602.771) (-605.203) -- 0:00:13
777500 -- [-600.959] (-603.222) (-603.832) (-603.248) * (-601.492) (-602.223) [-602.402] (-602.598) -- 0:00:13
778000 -- (-603.190) [-604.419] (-602.454) (-601.649) * (-601.484) (-601.704) [-603.724] (-602.649) -- 0:00:13
778500 -- [-606.975] (-602.508) (-607.259) (-601.857) * (-601.700) (-601.940) [-602.941] (-602.030) -- 0:00:13
779000 -- (-604.542) (-602.041) (-607.228) [-605.037] * [-602.380] (-602.502) (-604.262) (-606.487) -- 0:00:13
779500 -- (-605.122) (-603.648) [-603.723] (-603.721) * (-601.496) (-601.674) [-603.908] (-604.575) -- 0:00:13
780000 -- (-603.243) [-601.456] (-609.629) (-605.406) * (-606.885) (-601.656) (-601.391) [-601.425] -- 0:00:13
Average standard deviation of split frequencies: 0.010794
780500 -- (-602.476) [-605.134] (-602.358) (-606.430) * (-601.297) (-601.415) [-601.354] (-602.021) -- 0:00:13
781000 -- (-601.337) [-602.930] (-601.800) (-605.334) * (-604.403) (-603.531) [-604.983] (-604.219) -- 0:00:13
781500 -- (-604.342) (-603.167) [-600.871] (-603.720) * (-603.492) [-602.307] (-608.290) (-601.704) -- 0:00:13
782000 -- (-604.938) (-603.049) [-607.248] (-602.072) * (-603.362) [-602.550] (-606.788) (-608.838) -- 0:00:13
782500 -- (-603.607) (-602.928) [-604.225] (-601.879) * [-603.384] (-602.882) (-603.660) (-605.969) -- 0:00:13
783000 -- (-602.330) (-602.186) (-601.658) [-603.408] * (-601.814) (-605.644) (-603.646) [-601.372] -- 0:00:13
783500 -- [-603.228] (-604.081) (-602.659) (-605.771) * [-604.376] (-604.525) (-603.893) (-602.496) -- 0:00:12
784000 -- [-602.741] (-603.817) (-601.274) (-603.382) * (-608.842) (-603.976) (-603.774) [-604.506] -- 0:00:12
784500 -- (-604.023) (-603.144) (-601.770) [-602.460] * (-604.556) (-603.209) [-602.674] (-602.489) -- 0:00:12
785000 -- (-602.602) [-602.619] (-601.749) (-604.064) * (-601.709) (-602.533) [-602.820] (-604.706) -- 0:00:12
Average standard deviation of split frequencies: 0.010983
785500 -- [-601.674] (-604.079) (-602.929) (-603.660) * (-601.193) (-603.958) (-605.125) [-605.737] -- 0:00:12
786000 -- (-601.970) [-601.631] (-605.860) (-601.075) * (-602.209) [-604.206] (-604.993) (-601.638) -- 0:00:12
786500 -- [-603.412] (-601.140) (-610.550) (-603.343) * (-602.684) (-604.034) (-601.976) [-602.185] -- 0:00:12
787000 -- (-601.618) [-603.835] (-604.381) (-603.716) * (-602.136) [-605.223] (-602.224) (-602.400) -- 0:00:12
787500 -- (-604.877) [-604.099] (-607.553) (-604.645) * (-601.187) [-602.341] (-606.635) (-605.141) -- 0:00:12
788000 -- (-604.812) [-602.353] (-602.336) (-606.384) * [-601.887] (-601.490) (-603.952) (-603.464) -- 0:00:12
788500 -- (-605.267) (-603.656) [-600.669] (-603.696) * (-602.142) (-602.313) [-603.461] (-604.812) -- 0:00:12
789000 -- (-603.923) [-602.946] (-602.114) (-603.639) * (-604.800) (-603.068) [-601.891] (-603.948) -- 0:00:12
789500 -- (-603.113) [-602.113] (-602.263) (-601.365) * (-602.198) (-603.607) (-602.777) [-601.877] -- 0:00:12
790000 -- (-605.441) (-602.125) [-603.984] (-601.480) * (-603.130) (-601.345) [-601.937] (-602.203) -- 0:00:12
Average standard deviation of split frequencies: 0.010918
790500 -- (-606.158) (-601.347) [-607.332] (-601.728) * (-607.650) [-601.478] (-602.771) (-602.709) -- 0:00:12
791000 -- (-602.672) (-605.886) [-602.566] (-601.541) * [-604.879] (-601.783) (-603.066) (-603.814) -- 0:00:12
791500 -- (-607.440) (-611.601) [-602.614] (-602.164) * (-601.280) (-602.248) (-603.795) [-602.330] -- 0:00:12
792000 -- [-605.629] (-602.236) (-601.603) (-600.998) * (-601.421) [-604.659] (-601.303) (-603.421) -- 0:00:12
792500 -- (-602.308) [-603.691] (-602.793) (-604.391) * (-602.557) [-601.647] (-605.384) (-603.738) -- 0:00:12
793000 -- (-602.459) (-603.476) [-602.869] (-602.892) * (-605.278) (-602.149) (-601.770) [-607.301] -- 0:00:12
793500 -- (-602.865) (-602.739) (-601.921) [-601.237] * (-604.184) [-600.903] (-602.553) (-602.641) -- 0:00:12
794000 -- (-602.998) (-602.400) (-601.948) [-602.988] * (-603.389) (-601.661) [-601.170] (-604.969) -- 0:00:12
794500 -- [-601.844] (-604.096) (-602.617) (-605.281) * (-606.823) (-602.046) [-602.054] (-602.688) -- 0:00:12
795000 -- (-601.582) [-603.271] (-603.491) (-602.304) * (-606.329) (-605.033) (-602.075) [-601.857] -- 0:00:12
Average standard deviation of split frequencies: 0.011067
795500 -- (-601.830) (-603.310) [-604.993] (-602.130) * [-607.648] (-603.746) (-600.677) (-602.315) -- 0:00:12
796000 -- [-600.837] (-603.597) (-602.805) (-601.625) * [-602.800] (-603.988) (-601.302) (-603.433) -- 0:00:12
796500 -- (-601.427) (-605.525) [-604.966] (-601.595) * (-606.056) (-602.789) (-601.471) [-604.880] -- 0:00:12
797000 -- (-601.655) (-603.411) [-602.896] (-602.420) * (-606.005) (-602.359) (-601.624) [-601.677] -- 0:00:12
797500 -- (-601.613) (-602.025) [-602.098] (-602.061) * (-604.016) [-605.409] (-601.551) (-601.112) -- 0:00:12
798000 -- (-601.088) (-601.706) (-603.985) [-603.640] * (-607.480) (-602.117) [-606.349] (-602.357) -- 0:00:12
798500 -- (-602.894) (-603.910) [-603.138] (-604.979) * (-607.326) (-602.847) [-601.956] (-604.598) -- 0:00:12
799000 -- (-604.601) [-601.191] (-602.868) (-606.273) * (-601.985) (-605.010) (-601.343) [-603.539] -- 0:00:12
799500 -- (-601.875) [-602.007] (-602.896) (-602.915) * (-604.050) (-605.701) [-601.406] (-603.099) -- 0:00:12
800000 -- (-601.487) (-603.388) [-608.095] (-601.597) * [-601.636] (-603.801) (-603.386) (-606.173) -- 0:00:12
Average standard deviation of split frequencies: 0.011113
800500 -- (-603.638) [-601.333] (-603.608) (-606.629) * (-603.318) (-601.387) [-603.887] (-601.211) -- 0:00:11
801000 -- [-601.283] (-602.038) (-604.693) (-601.835) * (-602.456) (-601.673) (-603.743) [-601.071] -- 0:00:11
801500 -- (-602.051) (-601.151) [-601.974] (-606.508) * (-603.094) (-602.281) (-603.230) [-601.670] -- 0:00:11
802000 -- [-601.004] (-602.142) (-605.121) (-603.753) * (-604.664) [-602.058] (-602.688) (-605.821) -- 0:00:11
802500 -- (-603.686) [-604.474] (-603.937) (-605.190) * (-602.532) (-606.172) (-603.942) [-604.263] -- 0:00:11
803000 -- (-604.516) (-602.689) [-602.470] (-606.960) * [-603.029] (-603.816) (-603.511) (-603.544) -- 0:00:11
803500 -- (-602.991) (-603.512) (-602.441) [-604.667] * (-605.265) (-604.982) (-601.701) [-603.374] -- 0:00:11
804000 -- [-603.482] (-604.248) (-601.711) (-603.117) * [-603.613] (-604.444) (-605.227) (-602.625) -- 0:00:11
804500 -- [-603.885] (-602.377) (-601.397) (-603.507) * [-603.021] (-604.249) (-604.705) (-601.455) -- 0:00:11
805000 -- (-603.306) (-603.017) (-601.501) [-603.885] * (-604.070) (-602.713) (-602.696) [-602.093] -- 0:00:11
Average standard deviation of split frequencies: 0.010674
805500 -- [-602.193] (-601.847) (-601.207) (-602.495) * (-604.723) (-602.642) (-602.592) [-601.892] -- 0:00:11
806000 -- (-605.660) (-600.909) (-601.973) [-602.717] * (-605.124) [-602.011] (-602.167) (-603.643) -- 0:00:11
806500 -- [-607.185] (-602.118) (-608.590) (-601.811) * (-605.011) (-602.183) [-601.495] (-601.604) -- 0:00:11
807000 -- (-604.997) (-601.454) (-607.823) [-601.778] * [-602.697] (-606.244) (-600.998) (-601.881) -- 0:00:11
807500 -- (-604.785) (-603.760) (-602.685) [-602.018] * [-605.775] (-601.541) (-603.600) (-601.120) -- 0:00:11
808000 -- (-604.284) (-604.806) [-603.616] (-601.911) * (-603.795) (-601.251) [-601.447] (-605.303) -- 0:00:11
808500 -- (-601.668) (-602.364) (-604.145) [-605.661] * (-606.909) (-608.258) (-602.681) [-601.935] -- 0:00:11
809000 -- (-602.648) [-605.284] (-602.066) (-605.988) * (-603.053) (-602.741) [-603.007] (-604.250) -- 0:00:11
809500 -- [-602.808] (-604.523) (-605.533) (-602.287) * (-607.688) [-602.370] (-606.996) (-605.932) -- 0:00:11
810000 -- [-605.246] (-606.075) (-602.924) (-602.272) * [-603.051] (-601.970) (-607.396) (-601.812) -- 0:00:11
Average standard deviation of split frequencies: 0.010467
810500 -- (-604.319) [-603.776] (-604.163) (-603.738) * (-601.866) (-601.421) (-606.045) [-602.559] -- 0:00:11
811000 -- (-602.730) [-605.744] (-601.548) (-605.468) * [-604.575] (-602.497) (-609.405) (-602.317) -- 0:00:11
811500 -- (-604.071) (-602.355) [-601.999] (-602.215) * (-605.257) (-604.719) (-603.617) [-602.132] -- 0:00:11
812000 -- (-604.643) [-602.873] (-602.880) (-601.367) * (-606.388) [-602.194] (-603.341) (-603.388) -- 0:00:11
812500 -- (-603.685) (-602.413) (-605.304) [-604.513] * (-604.519) (-604.651) [-603.253] (-602.067) -- 0:00:11
813000 -- (-603.038) (-602.207) [-601.573] (-606.862) * [-604.633] (-602.599) (-604.736) (-601.986) -- 0:00:11
813500 -- [-605.369] (-606.349) (-602.977) (-603.907) * (-607.532) (-602.315) [-602.501] (-605.615) -- 0:00:11
814000 -- (-605.039) [-603.496] (-601.397) (-602.462) * (-601.134) (-602.939) (-601.119) [-601.709] -- 0:00:11
814500 -- (-601.764) [-604.730] (-603.050) (-603.330) * (-600.885) (-602.605) [-602.731] (-603.812) -- 0:00:11
815000 -- [-602.184] (-604.712) (-605.993) (-603.653) * [-605.649] (-602.782) (-604.136) (-601.491) -- 0:00:11
Average standard deviation of split frequencies: 0.010637
815500 -- [-601.227] (-604.061) (-601.786) (-601.639) * (-603.844) (-601.770) (-603.045) [-602.385] -- 0:00:11
816000 -- (-601.024) [-601.194] (-602.338) (-604.068) * (-605.195) (-605.000) [-601.817] (-606.403) -- 0:00:11
816500 -- (-602.945) [-603.590] (-607.870) (-602.006) * [-604.285] (-602.132) (-603.959) (-603.845) -- 0:00:11
817000 -- [-601.998] (-603.070) (-609.098) (-609.617) * [-602.206] (-607.084) (-603.202) (-602.309) -- 0:00:10
817500 -- (-606.282) (-601.941) [-602.377] (-603.458) * (-603.030) (-605.684) [-606.416] (-605.291) -- 0:00:10
818000 -- (-603.941) (-603.449) [-602.608] (-601.329) * [-602.299] (-601.952) (-606.134) (-603.053) -- 0:00:10
818500 -- (-601.702) (-605.192) [-603.169] (-600.781) * (-602.625) (-601.935) (-602.106) [-601.997] -- 0:00:10
819000 -- (-602.565) (-605.394) [-601.919] (-602.215) * [-602.370] (-601.457) (-601.261) (-606.599) -- 0:00:10
819500 -- (-601.978) (-601.447) [-601.026] (-602.598) * (-603.490) (-601.983) [-602.145] (-609.654) -- 0:00:10
820000 -- (-603.788) (-601.106) (-601.879) [-604.752] * (-608.429) [-604.432] (-602.049) (-605.129) -- 0:00:10
Average standard deviation of split frequencies: 0.010813
820500 -- (-604.885) (-603.118) [-601.950] (-604.486) * (-603.057) (-601.478) (-603.967) [-603.437] -- 0:00:10
821000 -- (-601.475) (-604.357) [-602.049] (-602.010) * [-602.339] (-602.926) (-606.622) (-601.797) -- 0:00:10
821500 -- (-601.621) (-604.478) [-601.353] (-600.827) * [-606.330] (-602.956) (-602.568) (-603.251) -- 0:00:10
822000 -- (-606.529) (-608.340) [-602.140] (-605.240) * (-606.327) [-600.864] (-604.336) (-604.100) -- 0:00:10
822500 -- (-605.795) (-602.076) [-604.594] (-606.251) * (-604.416) (-604.064) (-601.389) [-601.230] -- 0:00:10
823000 -- [-602.128] (-603.818) (-606.879) (-604.922) * [-604.228] (-604.417) (-602.174) (-601.549) -- 0:00:10
823500 -- (-603.847) [-604.537] (-603.711) (-606.629) * (-603.235) (-603.289) [-602.106] (-603.154) -- 0:00:10
824000 -- (-604.855) (-603.402) (-603.235) [-601.615] * [-603.321] (-602.569) (-601.523) (-601.564) -- 0:00:10
824500 -- (-602.078) (-602.816) (-601.195) [-604.734] * (-602.224) (-601.788) (-604.410) [-607.309] -- 0:00:10
825000 -- [-601.350] (-603.883) (-600.870) (-603.476) * (-607.174) [-601.913] (-603.283) (-601.662) -- 0:00:10
Average standard deviation of split frequencies: 0.011097
825500 -- (-602.131) (-606.327) (-605.058) [-601.101] * (-604.978) (-604.230) (-604.249) [-601.215] -- 0:00:10
826000 -- (-601.619) (-605.808) (-603.022) [-603.237] * (-604.943) (-602.772) (-608.805) [-604.987] -- 0:00:10
826500 -- [-604.620] (-602.430) (-602.723) (-603.568) * (-604.458) (-604.986) (-605.814) [-601.327] -- 0:00:10
827000 -- [-601.172] (-604.627) (-602.327) (-605.289) * (-603.820) (-605.501) [-602.658] (-603.413) -- 0:00:10
827500 -- (-602.307) (-601.374) (-604.765) [-602.288] * [-607.503] (-601.215) (-605.166) (-605.282) -- 0:00:10
828000 -- [-603.963] (-601.931) (-604.375) (-602.636) * (-607.959) [-601.702] (-602.657) (-606.304) -- 0:00:10
828500 -- (-608.198) [-601.469] (-602.808) (-602.868) * [-602.921] (-604.865) (-603.654) (-603.226) -- 0:00:10
829000 -- (-603.714) (-601.306) [-601.018] (-603.743) * (-604.760) (-602.952) (-605.316) [-603.687] -- 0:00:10
829500 -- (-602.705) (-601.570) [-602.201] (-608.464) * (-600.999) [-602.396] (-601.323) (-600.882) -- 0:00:10
830000 -- (-602.995) (-603.780) (-604.356) [-603.908] * (-602.740) (-601.989) (-601.198) [-605.080] -- 0:00:10
Average standard deviation of split frequencies: 0.010972
830500 -- [-602.429] (-604.191) (-602.414) (-601.646) * [-602.534] (-601.693) (-601.453) (-603.601) -- 0:00:10
831000 -- (-601.914) (-602.687) (-601.343) [-607.524] * [-602.610] (-606.221) (-604.827) (-603.347) -- 0:00:10
831500 -- [-604.755] (-602.491) (-602.403) (-603.196) * (-607.332) (-605.555) [-602.301] (-607.651) -- 0:00:10
832000 -- (-605.301) (-601.847) (-603.246) [-602.345] * (-603.420) [-603.675] (-602.940) (-603.619) -- 0:00:10
832500 -- [-604.265] (-603.341) (-604.735) (-602.063) * (-603.743) [-601.333] (-602.541) (-607.773) -- 0:00:10
833000 -- (-601.596) (-604.379) (-602.035) [-606.120] * (-601.867) (-602.465) (-601.370) [-602.431] -- 0:00:10
833500 -- [-602.977] (-604.019) (-603.398) (-603.801) * (-602.030) (-607.432) [-606.306] (-600.860) -- 0:00:09
834000 -- (-605.275) [-601.643] (-604.831) (-604.817) * [-605.222] (-606.386) (-602.066) (-600.617) -- 0:00:09
834500 -- (-604.596) (-602.208) (-604.640) [-604.762] * [-602.617] (-604.718) (-603.130) (-604.307) -- 0:00:09
835000 -- [-601.110] (-604.952) (-602.089) (-603.151) * [-606.719] (-604.210) (-604.474) (-604.307) -- 0:00:09
Average standard deviation of split frequencies: 0.010482
835500 -- [-603.157] (-605.040) (-601.466) (-604.960) * [-602.545] (-601.745) (-602.190) (-604.484) -- 0:00:09
836000 -- (-601.184) (-603.712) (-603.241) [-602.668] * (-604.466) [-601.554] (-602.447) (-602.530) -- 0:00:09
836500 -- (-608.456) (-603.422) (-605.005) [-602.187] * (-603.509) (-604.798) (-601.185) [-602.435] -- 0:00:09
837000 -- (-601.097) (-604.494) (-605.336) [-600.801] * (-602.444) [-604.260] (-601.554) (-603.354) -- 0:00:09
837500 -- (-603.521) (-602.722) (-603.080) [-602.190] * [-604.627] (-606.082) (-601.116) (-604.422) -- 0:00:09
838000 -- [-602.351] (-602.255) (-607.942) (-601.273) * (-601.873) (-601.974) (-601.351) [-601.459] -- 0:00:09
838500 -- (-603.502) (-605.391) (-602.268) [-600.969] * (-602.270) (-601.670) [-601.863] (-601.974) -- 0:00:09
839000 -- (-601.546) [-602.637] (-602.468) (-600.859) * (-601.660) [-602.545] (-601.553) (-604.297) -- 0:00:09
839500 -- (-602.594) (-601.962) (-602.312) [-601.543] * (-602.040) [-602.621] (-603.097) (-603.415) -- 0:00:09
840000 -- (-602.901) [-601.171] (-601.810) (-601.676) * (-603.307) (-601.804) (-603.357) [-601.222] -- 0:00:09
Average standard deviation of split frequencies: 0.010997
840500 -- (-602.795) (-604.572) (-602.424) [-601.688] * (-607.438) [-603.026] (-604.116) (-603.196) -- 0:00:09
841000 -- (-603.676) (-605.720) [-602.826] (-604.369) * [-603.461] (-605.324) (-604.787) (-605.568) -- 0:00:09
841500 -- (-601.330) [-605.359] (-603.423) (-605.065) * (-604.893) [-601.913] (-608.334) (-603.525) -- 0:00:09
842000 -- (-601.430) (-604.187) (-604.595) [-604.815] * (-604.324) [-602.933] (-605.297) (-603.614) -- 0:00:09
842500 -- (-603.349) (-604.172) (-606.387) [-602.997] * [-604.453] (-603.233) (-607.013) (-603.690) -- 0:00:09
843000 -- [-604.611] (-605.506) (-603.786) (-602.040) * [-603.066] (-602.351) (-602.810) (-602.525) -- 0:00:09
843500 -- (-609.337) (-602.735) (-601.780) [-604.021] * (-602.992) (-604.058) (-605.611) [-601.691] -- 0:00:09
844000 -- (-607.065) (-603.749) [-603.775] (-603.456) * (-604.845) (-604.805) [-604.366] (-601.315) -- 0:00:09
844500 -- (-603.770) (-603.329) [-602.947] (-602.368) * (-603.896) (-604.117) [-602.867] (-602.142) -- 0:00:09
845000 -- (-605.712) (-602.793) [-604.793] (-603.586) * [-603.458] (-605.175) (-605.058) (-605.392) -- 0:00:09
Average standard deviation of split frequencies: 0.010711
845500 -- (-602.949) (-608.779) (-604.935) [-601.332] * (-602.851) (-607.439) [-604.069] (-603.754) -- 0:00:09
846000 -- [-602.094] (-605.986) (-602.398) (-601.619) * (-604.574) (-602.340) (-602.583) [-604.406] -- 0:00:09
846500 -- (-604.742) [-604.773] (-602.136) (-605.060) * (-602.127) [-602.545] (-602.849) (-602.779) -- 0:00:09
847000 -- [-602.183] (-606.533) (-602.851) (-602.387) * (-603.578) [-604.137] (-601.441) (-602.337) -- 0:00:09
847500 -- (-603.787) (-605.685) (-605.083) [-603.272] * (-603.974) (-605.985) (-602.607) [-602.769] -- 0:00:09
848000 -- (-606.231) [-602.203] (-605.523) (-602.852) * (-602.128) (-605.393) (-603.517) [-602.424] -- 0:00:09
848500 -- [-605.994] (-601.210) (-603.597) (-601.805) * (-605.256) [-603.893] (-604.776) (-602.109) -- 0:00:09
849000 -- (-602.597) [-603.100] (-603.156) (-601.194) * (-603.724) (-603.909) [-604.160] (-603.126) -- 0:00:09
849500 -- (-603.716) [-602.363] (-603.539) (-601.079) * (-606.342) [-601.493] (-602.377) (-604.957) -- 0:00:09
850000 -- [-601.062] (-602.887) (-602.742) (-602.151) * (-603.365) (-601.984) (-601.484) [-602.730] -- 0:00:09
Average standard deviation of split frequencies: 0.010898
850500 -- [-601.929] (-603.801) (-603.887) (-602.081) * [-603.371] (-602.768) (-602.870) (-605.194) -- 0:00:08
851000 -- [-601.655] (-605.646) (-603.924) (-602.853) * (-605.495) (-604.917) (-603.765) [-604.797] -- 0:00:08
851500 -- [-605.207] (-603.430) (-606.291) (-606.651) * (-603.269) [-601.607] (-603.084) (-602.013) -- 0:00:08
852000 -- [-603.221] (-603.794) (-603.428) (-607.577) * (-603.262) (-603.448) (-608.102) [-601.791] -- 0:00:08
852500 -- (-603.741) [-601.728] (-602.587) (-601.671) * (-606.109) [-604.488] (-603.203) (-607.893) -- 0:00:08
853000 -- (-603.339) (-602.144) [-601.244] (-601.630) * (-602.712) [-605.599] (-603.833) (-607.462) -- 0:00:08
853500 -- (-602.004) (-605.305) [-606.374] (-606.071) * (-605.103) [-602.214] (-605.140) (-610.753) -- 0:00:08
854000 -- (-603.142) (-604.127) [-602.531] (-603.604) * [-602.685] (-603.578) (-602.243) (-608.572) -- 0:00:08
854500 -- [-606.378] (-602.028) (-602.140) (-602.227) * (-603.475) [-606.280] (-603.037) (-604.375) -- 0:00:08
855000 -- [-605.015] (-603.175) (-602.732) (-601.762) * (-604.420) [-601.424] (-601.838) (-604.301) -- 0:00:08
Average standard deviation of split frequencies: 0.010658
855500 -- [-601.741] (-602.811) (-603.436) (-605.136) * (-605.586) (-605.805) (-602.737) [-605.395] -- 0:00:08
856000 -- [-601.424] (-604.703) (-604.938) (-602.233) * [-601.707] (-603.932) (-602.900) (-607.950) -- 0:00:08
856500 -- [-601.544] (-604.171) (-603.482) (-601.607) * (-600.996) (-602.402) [-604.990] (-603.487) -- 0:00:08
857000 -- [-606.632] (-602.446) (-601.722) (-606.108) * [-602.654] (-605.167) (-604.534) (-603.986) -- 0:00:08
857500 -- (-603.091) (-602.240) [-601.217] (-601.824) * (-603.482) (-603.647) [-605.459] (-602.367) -- 0:00:08
858000 -- (-602.997) (-601.749) [-601.047] (-601.029) * [-604.405] (-601.213) (-604.372) (-607.401) -- 0:00:08
858500 -- (-603.628) (-605.874) (-603.512) [-601.856] * (-601.114) (-606.410) (-605.071) [-601.685] -- 0:00:08
859000 -- (-602.788) [-605.126] (-604.643) (-604.442) * [-605.635] (-602.033) (-604.295) (-601.635) -- 0:00:08
859500 -- (-601.532) [-605.262] (-603.151) (-604.316) * (-602.527) (-601.645) (-604.044) [-605.371] -- 0:00:08
860000 -- (-603.555) (-601.271) (-601.701) [-603.438] * (-601.723) (-603.306) [-604.825] (-604.652) -- 0:00:08
Average standard deviation of split frequencies: 0.010441
860500 -- (-606.720) (-602.623) [-601.918] (-602.502) * (-602.793) (-601.892) (-604.647) [-604.816] -- 0:00:08
861000 -- (-602.849) [-601.857] (-604.788) (-601.983) * [-601.777] (-603.432) (-601.380) (-602.034) -- 0:00:08
861500 -- [-604.115] (-602.518) (-601.903) (-603.881) * (-605.294) (-600.956) (-604.639) [-602.702] -- 0:00:08
862000 -- (-602.213) [-603.108] (-606.021) (-603.833) * (-602.766) [-603.166] (-602.699) (-602.555) -- 0:00:08
862500 -- (-604.071) [-603.100] (-607.094) (-603.023) * (-604.970) (-601.135) (-602.749) [-603.212] -- 0:00:08
863000 -- (-602.818) (-602.877) [-601.727] (-605.975) * (-606.188) (-601.417) (-602.010) [-601.720] -- 0:00:08
863500 -- (-603.619) (-604.093) (-602.946) [-601.418] * (-602.587) (-601.899) (-603.617) [-601.119] -- 0:00:08
864000 -- (-604.728) [-602.587] (-604.860) (-603.050) * (-602.209) (-602.629) [-602.999] (-601.128) -- 0:00:08
864500 -- (-605.741) (-605.937) (-604.316) [-602.613] * (-608.667) (-602.503) (-603.061) [-601.093] -- 0:00:08
865000 -- (-601.947) (-604.177) (-602.056) [-603.714] * (-603.794) (-602.068) (-606.658) [-603.517] -- 0:00:08
Average standard deviation of split frequencies: 0.010343
865500 -- (-601.971) (-602.624) [-602.553] (-602.994) * (-603.607) [-602.211] (-603.015) (-602.964) -- 0:00:08
866000 -- [-604.029] (-603.708) (-603.028) (-604.764) * (-604.860) (-602.552) (-603.463) [-602.468] -- 0:00:08
866500 -- [-602.903] (-603.360) (-603.073) (-607.208) * [-604.282] (-602.839) (-602.756) (-610.652) -- 0:00:08
867000 -- (-604.906) (-603.681) [-602.027] (-608.775) * (-604.734) (-601.413) (-603.849) [-603.901] -- 0:00:07
867500 -- (-604.789) (-602.565) [-604.643] (-604.888) * [-604.144] (-601.154) (-605.452) (-603.626) -- 0:00:07
868000 -- (-607.089) [-601.469] (-603.092) (-603.906) * (-603.747) (-602.936) [-603.058] (-601.697) -- 0:00:07
868500 -- (-606.425) [-601.824] (-607.364) (-604.254) * (-605.561) (-602.150) [-604.321] (-601.452) -- 0:00:07
869000 -- [-604.205] (-601.652) (-606.992) (-603.583) * (-605.010) [-600.734] (-604.217) (-602.294) -- 0:00:07
869500 -- (-604.089) (-603.542) [-601.415] (-608.849) * [-605.222] (-602.216) (-602.316) (-607.854) -- 0:00:07
870000 -- (-603.727) (-602.766) [-602.355] (-603.782) * (-604.716) [-600.975] (-604.093) (-608.267) -- 0:00:07
Average standard deviation of split frequencies: 0.010351
870500 -- [-603.398] (-603.494) (-602.272) (-606.846) * [-600.740] (-606.387) (-603.142) (-605.063) -- 0:00:07
871000 -- (-603.680) (-601.198) (-601.331) [-602.418] * (-601.289) (-603.300) [-603.101] (-604.683) -- 0:00:07
871500 -- [-606.831] (-601.782) (-603.647) (-601.729) * (-601.699) [-603.218] (-602.473) (-602.852) -- 0:00:07
872000 -- (-602.577) [-601.635] (-602.927) (-601.714) * (-604.170) (-603.355) (-602.524) [-602.152] -- 0:00:07
872500 -- (-605.354) [-602.306] (-604.231) (-603.592) * (-602.439) (-607.260) (-600.830) [-601.899] -- 0:00:07
873000 -- (-608.741) (-601.255) (-602.024) [-602.880] * (-602.175) (-606.604) (-600.817) [-601.200] -- 0:00:07
873500 -- [-605.880] (-603.797) (-604.476) (-601.300) * [-602.652] (-604.141) (-601.039) (-601.359) -- 0:00:07
874000 -- (-603.092) (-606.215) [-602.110] (-603.316) * [-601.831] (-603.362) (-605.201) (-602.364) -- 0:00:07
874500 -- [-603.208] (-606.494) (-605.279) (-602.823) * (-601.521) (-603.567) (-603.329) [-607.704] -- 0:00:07
875000 -- (-602.088) (-603.591) (-609.663) [-601.908] * (-602.829) [-603.966] (-606.399) (-605.165) -- 0:00:07
Average standard deviation of split frequencies: 0.010193
875500 -- [-602.868] (-604.653) (-605.227) (-602.009) * (-602.055) (-602.101) (-604.058) [-602.448] -- 0:00:07
876000 -- (-605.950) (-603.177) (-605.995) [-603.654] * (-601.415) (-605.094) [-604.496] (-601.533) -- 0:00:07
876500 -- [-603.027] (-605.892) (-605.745) (-605.271) * (-606.424) [-607.451] (-601.790) (-602.121) -- 0:00:07
877000 -- [-603.512] (-604.939) (-604.063) (-609.918) * (-602.059) [-603.640] (-606.010) (-604.291) -- 0:00:07
877500 -- [-602.995] (-602.399) (-603.939) (-604.023) * (-605.032) [-602.943] (-604.772) (-606.468) -- 0:00:07
878000 -- (-604.206) (-602.592) [-602.634] (-604.113) * (-602.714) (-605.551) [-603.070] (-604.831) -- 0:00:07
878500 -- (-607.683) (-605.280) [-601.335] (-608.106) * (-603.574) [-605.444] (-603.109) (-606.556) -- 0:00:07
879000 -- (-607.839) [-604.648] (-602.666) (-605.620) * [-602.639] (-605.259) (-602.499) (-609.500) -- 0:00:07
879500 -- (-609.059) (-602.350) (-608.097) [-602.219] * (-603.867) (-601.221) (-603.526) [-604.750] -- 0:00:07
880000 -- [-604.311] (-606.464) (-602.077) (-602.930) * [-603.757] (-601.136) (-604.550) (-601.820) -- 0:00:07
Average standard deviation of split frequencies: 0.010170
880500 -- (-604.093) [-601.697] (-601.970) (-604.703) * (-601.753) (-605.550) (-601.333) [-602.633] -- 0:00:07
881000 -- (-604.697) (-601.822) (-603.928) [-601.353] * [-602.710] (-605.391) (-602.437) (-602.766) -- 0:00:07
881500 -- (-602.357) (-601.696) (-603.707) [-604.372] * [-602.644] (-605.547) (-603.725) (-607.073) -- 0:00:07
882000 -- (-601.630) (-602.441) [-603.416] (-605.917) * [-601.357] (-601.004) (-603.479) (-603.178) -- 0:00:07
882500 -- (-605.559) [-601.483] (-603.162) (-608.644) * (-602.689) [-602.884] (-603.266) (-610.579) -- 0:00:07
883000 -- [-602.294] (-604.102) (-605.054) (-608.832) * (-604.073) (-601.575) (-601.389) [-601.613] -- 0:00:07
883500 -- (-602.411) (-603.102) [-603.403] (-605.261) * [-604.369] (-602.416) (-601.084) (-601.713) -- 0:00:06
884000 -- (-604.283) (-604.901) [-603.502] (-601.556) * (-603.406) (-602.955) (-601.803) [-601.827] -- 0:00:06
884500 -- (-607.719) (-604.044) (-603.808) [-602.032] * (-603.794) (-602.746) [-601.448] (-601.576) -- 0:00:06
885000 -- (-603.421) [-601.683] (-603.106) (-603.569) * (-601.863) (-602.830) [-601.793] (-602.629) -- 0:00:06
Average standard deviation of split frequencies: 0.009890
885500 -- (-601.907) (-604.004) [-602.800] (-602.566) * [-603.838] (-602.208) (-603.323) (-610.374) -- 0:00:06
886000 -- (-602.510) [-602.899] (-601.694) (-603.809) * (-605.595) (-603.930) [-602.268] (-601.972) -- 0:00:06
886500 -- (-604.065) (-602.267) (-605.453) [-606.063] * [-602.275] (-603.650) (-606.854) (-602.949) -- 0:00:06
887000 -- (-605.993) (-601.110) [-606.172] (-603.630) * (-601.590) (-605.281) [-604.736] (-603.012) -- 0:00:06
887500 -- (-604.503) (-604.181) (-604.385) [-602.823] * (-602.001) [-602.275] (-604.589) (-601.561) -- 0:00:06
888000 -- (-605.132) (-605.327) [-603.692] (-603.336) * (-604.486) (-602.622) [-602.132] (-603.330) -- 0:00:06
888500 -- (-606.683) [-605.161] (-604.501) (-602.097) * [-601.617] (-601.921) (-603.123) (-607.696) -- 0:00:06
889000 -- [-606.793] (-603.682) (-604.232) (-602.537) * [-601.013] (-604.194) (-602.375) (-601.964) -- 0:00:06
889500 -- [-601.814] (-603.055) (-606.505) (-603.373) * (-601.760) (-602.432) [-602.904] (-602.658) -- 0:00:06
890000 -- (-601.055) (-602.884) [-603.970] (-602.741) * (-605.144) (-604.237) (-602.594) [-602.130] -- 0:00:06
Average standard deviation of split frequencies: 0.010118
890500 -- (-601.781) [-603.127] (-601.060) (-601.905) * (-602.690) [-607.948] (-603.819) (-602.543) -- 0:00:06
891000 -- (-610.147) [-604.850] (-601.371) (-603.272) * (-603.806) (-606.022) (-605.235) [-602.697] -- 0:00:06
891500 -- (-603.556) (-608.466) (-601.573) [-602.275] * (-606.541) [-603.139] (-604.896) (-602.153) -- 0:00:06
892000 -- (-600.894) (-605.118) (-602.072) [-603.006] * (-606.157) [-601.973] (-606.126) (-604.442) -- 0:00:06
892500 -- (-601.323) [-602.206] (-603.756) (-602.468) * (-601.719) (-603.700) [-601.447] (-604.067) -- 0:00:06
893000 -- (-601.606) [-601.872] (-603.674) (-604.614) * (-604.443) (-607.065) [-601.462] (-603.076) -- 0:00:06
893500 -- (-603.379) (-603.443) [-606.116] (-604.618) * (-601.601) (-604.587) [-601.871] (-602.700) -- 0:00:06
894000 -- (-602.907) (-601.540) (-602.586) [-602.238] * (-606.178) [-604.039] (-603.130) (-603.880) -- 0:00:06
894500 -- [-601.524] (-602.523) (-605.076) (-604.330) * [-603.814] (-603.423) (-601.903) (-604.186) -- 0:00:06
895000 -- (-601.072) (-608.943) [-604.324] (-604.571) * [-601.741] (-601.835) (-607.972) (-605.232) -- 0:00:06
Average standard deviation of split frequencies: 0.010089
895500 -- [-602.351] (-602.848) (-604.774) (-602.579) * (-604.137) (-602.533) (-604.292) [-603.076] -- 0:00:06
896000 -- [-601.792] (-601.055) (-603.895) (-609.712) * [-604.029] (-604.062) (-606.301) (-601.305) -- 0:00:06
896500 -- (-602.008) (-604.711) [-607.849] (-608.644) * (-604.420) [-604.962] (-603.230) (-601.484) -- 0:00:06
897000 -- [-600.867] (-601.573) (-603.411) (-609.156) * (-602.329) (-602.702) (-601.883) [-601.650] -- 0:00:06
897500 -- [-601.996] (-603.919) (-601.361) (-605.735) * [-602.671] (-607.404) (-607.093) (-602.637) -- 0:00:06
898000 -- (-602.430) (-604.135) (-602.068) [-601.863] * (-602.177) [-603.485] (-603.628) (-602.618) -- 0:00:06
898500 -- (-603.301) [-602.804] (-606.780) (-603.880) * (-602.877) [-602.360] (-601.246) (-603.470) -- 0:00:06
899000 -- [-606.534] (-603.405) (-607.638) (-603.289) * (-602.965) [-603.411] (-602.819) (-603.511) -- 0:00:06
899500 -- (-605.515) (-602.363) (-606.844) [-604.407] * (-601.504) [-602.019] (-603.728) (-605.025) -- 0:00:06
900000 -- [-605.073] (-601.990) (-603.692) (-604.542) * (-602.933) (-602.189) (-603.131) [-601.580] -- 0:00:06
Average standard deviation of split frequencies: 0.009945
900500 -- (-604.680) (-602.479) [-602.145] (-602.470) * (-603.273) (-602.410) [-601.726] (-602.740) -- 0:00:05
901000 -- (-601.079) (-602.003) (-602.004) [-601.771] * (-602.096) (-605.337) (-602.328) [-601.437] -- 0:00:05
901500 -- [-603.689] (-602.998) (-602.286) (-605.718) * (-605.919) (-603.329) (-601.961) [-605.288] -- 0:00:05
902000 -- (-607.705) (-601.304) (-602.774) [-603.699] * (-605.084) (-605.691) (-601.787) [-602.495] -- 0:00:05
902500 -- (-601.637) (-601.610) (-602.474) [-602.047] * (-602.975) (-603.284) [-604.331] (-604.603) -- 0:00:05
903000 -- (-602.801) (-602.804) (-602.395) [-606.574] * [-602.320] (-602.301) (-603.490) (-602.158) -- 0:00:05
903500 -- (-602.481) (-602.532) (-602.124) [-603.131] * [-601.838] (-604.124) (-603.013) (-603.520) -- 0:00:05
904000 -- (-604.013) (-605.209) [-603.343] (-603.166) * (-603.261) (-606.820) (-602.776) [-602.753] -- 0:00:05
904500 -- (-603.857) (-604.121) [-601.918] (-603.904) * (-603.762) (-605.013) (-605.864) [-605.607] -- 0:00:05
905000 -- [-601.498] (-604.346) (-604.300) (-603.461) * (-606.135) [-601.365] (-603.128) (-604.653) -- 0:00:05
Average standard deviation of split frequencies: 0.010008
905500 -- (-601.108) (-603.386) (-605.408) [-601.126] * (-602.611) [-602.701] (-606.080) (-602.500) -- 0:00:05
906000 -- (-605.075) [-605.330] (-603.919) (-605.989) * [-601.527] (-602.156) (-602.887) (-601.415) -- 0:00:05
906500 -- (-603.873) (-602.384) [-601.401] (-602.023) * (-604.746) (-604.428) (-601.876) [-601.711] -- 0:00:05
907000 -- (-602.238) (-602.045) (-601.267) [-600.877] * (-602.132) [-601.923] (-603.424) (-601.136) -- 0:00:05
907500 -- (-605.478) (-605.347) (-601.135) [-605.233] * (-601.813) (-602.176) (-606.492) [-602.891] -- 0:00:05
908000 -- (-608.717) (-602.495) [-602.255] (-601.896) * [-604.711] (-603.621) (-603.414) (-602.512) -- 0:00:05
908500 -- (-608.566) (-602.721) (-602.737) [-601.441] * (-603.009) (-611.834) [-603.147] (-601.884) -- 0:00:05
909000 -- (-603.790) (-603.374) [-605.587] (-601.645) * (-603.504) (-604.432) [-604.608] (-607.156) -- 0:00:05
909500 -- (-607.954) (-601.862) [-607.430] (-606.708) * (-603.178) (-603.170) [-606.062] (-603.675) -- 0:00:05
910000 -- [-605.512] (-603.553) (-601.858) (-603.692) * (-611.774) [-603.337] (-604.285) (-602.432) -- 0:00:05
Average standard deviation of split frequencies: 0.009988
910500 -- (-603.278) [-605.134] (-603.229) (-603.427) * [-604.153] (-601.833) (-601.164) (-601.923) -- 0:00:05
911000 -- (-601.505) (-602.542) [-602.416] (-602.610) * (-601.262) (-604.747) [-603.398] (-604.316) -- 0:00:05
911500 -- (-602.526) [-601.368] (-603.839) (-601.605) * (-601.938) (-602.601) [-602.497] (-606.722) -- 0:00:05
912000 -- (-602.984) [-602.970] (-604.493) (-606.141) * (-602.506) (-607.936) [-602.892] (-606.288) -- 0:00:05
912500 -- [-603.811] (-603.595) (-603.442) (-601.400) * [-603.309] (-602.224) (-602.539) (-606.177) -- 0:00:05
913000 -- (-601.150) (-605.078) [-601.346] (-601.119) * (-604.127) (-601.997) (-603.245) [-601.424] -- 0:00:05
913500 -- (-601.297) (-604.667) [-602.501] (-601.852) * (-602.837) (-601.928) (-609.038) [-603.201] -- 0:00:05
914000 -- (-601.303) [-602.678] (-601.955) (-604.428) * (-604.737) (-604.163) [-604.980] (-603.487) -- 0:00:05
914500 -- (-604.154) (-604.536) [-603.155] (-604.866) * (-603.962) [-604.767] (-605.476) (-604.887) -- 0:00:05
915000 -- [-603.110] (-603.314) (-603.351) (-603.615) * (-602.401) (-602.613) [-603.405] (-609.658) -- 0:00:05
Average standard deviation of split frequencies: 0.010003
915500 -- (-602.661) [-603.616] (-601.882) (-602.869) * (-604.527) (-603.807) [-604.406] (-605.446) -- 0:00:05
916000 -- (-603.880) [-603.232] (-603.075) (-605.697) * (-602.517) (-605.152) (-601.813) [-601.586] -- 0:00:05
916500 -- (-603.495) [-603.101] (-604.343) (-601.997) * (-605.706) [-604.579] (-602.435) (-601.660) -- 0:00:05
917000 -- [-602.908] (-603.279) (-602.686) (-602.086) * [-604.802] (-601.982) (-601.775) (-606.793) -- 0:00:04
917500 -- (-610.155) (-603.398) (-606.330) [-603.648] * (-604.961) [-602.031] (-602.819) (-603.052) -- 0:00:04
918000 -- (-611.469) (-608.610) [-603.246] (-605.178) * (-604.065) (-604.938) (-602.314) [-604.244] -- 0:00:04
918500 -- (-606.674) (-601.686) [-605.399] (-604.668) * (-602.403) [-603.236] (-601.432) (-605.806) -- 0:00:04
919000 -- (-603.948) (-601.072) (-605.937) [-603.700] * [-602.086] (-603.770) (-603.036) (-603.982) -- 0:00:04
919500 -- [-602.298] (-602.207) (-604.657) (-603.440) * (-602.982) (-604.711) (-600.737) [-601.578] -- 0:00:04
920000 -- (-604.140) (-602.680) [-605.840] (-601.575) * (-602.775) [-601.727] (-601.287) (-602.928) -- 0:00:04
Average standard deviation of split frequencies: 0.010090
920500 -- (-602.033) [-602.877] (-607.110) (-601.235) * (-602.303) (-604.064) (-603.223) [-603.379] -- 0:00:04
921000 -- (-603.776) (-602.677) [-602.168] (-600.921) * (-602.239) (-607.707) [-603.954] (-602.168) -- 0:00:04
921500 -- [-602.128] (-601.935) (-601.583) (-603.009) * (-608.161) (-602.934) (-601.952) [-608.369] -- 0:00:04
922000 -- [-604.119] (-602.169) (-601.135) (-602.981) * [-601.547] (-604.540) (-602.541) (-604.266) -- 0:00:04
922500 -- (-603.717) (-602.497) [-601.550] (-604.255) * (-601.497) (-604.564) (-603.264) [-604.746] -- 0:00:04
923000 -- (-604.241) (-601.836) [-603.102] (-603.436) * (-601.720) [-601.774] (-602.966) (-605.434) -- 0:00:04
923500 -- (-602.483) [-606.034] (-602.697) (-602.307) * (-600.890) (-603.421) [-604.457] (-603.821) -- 0:00:04
924000 -- (-604.821) (-601.970) [-601.714] (-603.526) * (-601.614) (-604.077) [-606.225] (-603.763) -- 0:00:04
924500 -- (-604.139) (-601.859) (-602.511) [-602.371] * (-603.783) [-611.299] (-604.531) (-603.797) -- 0:00:04
925000 -- [-602.647] (-604.778) (-602.440) (-602.628) * [-607.058] (-604.658) (-604.556) (-606.181) -- 0:00:04
Average standard deviation of split frequencies: 0.010032
925500 -- (-602.012) (-602.404) (-602.438) [-601.351] * [-605.455] (-606.435) (-603.336) (-607.397) -- 0:00:04
926000 -- (-605.075) [-603.454] (-603.894) (-605.177) * [-604.220] (-607.071) (-603.011) (-601.868) -- 0:00:04
926500 -- (-608.397) (-603.453) (-601.803) [-604.300] * [-605.206] (-606.020) (-603.736) (-602.128) -- 0:00:04
927000 -- (-602.995) (-601.811) (-601.787) [-602.011] * (-605.130) (-601.550) [-601.979] (-600.722) -- 0:00:04
927500 -- (-602.710) [-606.892] (-601.854) (-603.851) * (-604.767) [-606.601] (-602.508) (-601.202) -- 0:00:04
928000 -- (-603.184) (-603.531) [-604.268] (-605.530) * (-601.584) (-602.741) (-602.511) [-601.017] -- 0:00:04
928500 -- (-603.864) (-602.239) [-602.730] (-607.588) * (-603.159) (-603.512) (-602.245) [-603.116] -- 0:00:04
929000 -- (-601.969) (-601.542) (-604.433) [-601.469] * (-600.881) (-604.059) [-604.623] (-604.732) -- 0:00:04
929500 -- [-604.726] (-603.440) (-601.333) (-602.269) * (-601.108) (-602.481) [-602.709] (-602.326) -- 0:00:04
930000 -- (-601.701) [-602.232] (-601.746) (-602.938) * (-601.435) (-604.547) [-603.145] (-601.271) -- 0:00:04
Average standard deviation of split frequencies: 0.009773
930500 -- (-600.933) (-604.572) [-602.157] (-601.839) * [-601.121] (-605.669) (-603.270) (-601.890) -- 0:00:04
931000 -- (-601.610) (-608.960) (-608.160) [-602.837] * (-601.517) (-605.596) [-607.208] (-601.562) -- 0:00:04
931500 -- (-603.340) (-601.955) [-606.595] (-601.964) * (-602.756) (-601.838) (-603.618) [-601.723] -- 0:00:04
932000 -- (-605.860) (-601.514) (-603.927) [-602.688] * (-602.999) (-602.669) [-608.138] (-608.495) -- 0:00:04
932500 -- (-606.076) (-602.293) (-602.057) [-602.215] * (-606.574) [-604.120] (-604.013) (-607.024) -- 0:00:04
933000 -- (-601.962) (-602.138) (-602.424) [-601.774] * (-604.831) (-604.938) (-603.906) [-602.586] -- 0:00:04
933500 -- (-603.073) (-600.889) [-602.234] (-601.491) * (-604.346) (-601.698) [-602.823] (-603.441) -- 0:00:03
934000 -- (-601.685) (-601.807) (-601.837) [-602.444] * (-605.261) (-606.191) [-602.441] (-603.117) -- 0:00:03
934500 -- (-601.972) [-606.354] (-602.025) (-601.734) * (-603.309) [-604.571] (-603.405) (-604.049) -- 0:00:03
935000 -- (-603.541) (-606.220) [-603.398] (-603.505) * [-601.074] (-603.093) (-605.456) (-602.328) -- 0:00:03
Average standard deviation of split frequencies: 0.009538
935500 -- (-603.349) [-604.213] (-605.170) (-605.187) * (-603.829) [-607.213] (-602.825) (-605.537) -- 0:00:03
936000 -- [-603.372] (-604.011) (-602.845) (-603.741) * (-604.234) [-602.098] (-605.184) (-608.636) -- 0:00:03
936500 -- (-601.297) [-602.814] (-601.118) (-603.690) * [-603.437] (-606.896) (-602.036) (-605.217) -- 0:00:03
937000 -- (-602.245) (-603.392) (-604.103) [-601.866] * (-605.702) [-607.076] (-602.336) (-605.257) -- 0:00:03
937500 -- (-604.125) [-603.078] (-602.019) (-608.775) * (-606.568) (-605.129) [-601.547] (-602.938) -- 0:00:03
938000 -- (-601.333) (-602.964) [-602.042] (-604.661) * (-605.357) (-605.788) [-602.891] (-601.284) -- 0:00:03
938500 -- (-601.270) [-602.937] (-603.485) (-603.954) * [-605.029] (-604.453) (-603.055) (-601.745) -- 0:00:03
939000 -- [-602.711] (-603.263) (-601.279) (-603.950) * (-602.597) [-602.325] (-601.645) (-608.808) -- 0:00:03
939500 -- [-601.999] (-602.488) (-600.957) (-602.316) * (-602.567) (-601.568) [-602.543] (-607.241) -- 0:00:03
940000 -- (-601.500) (-603.145) (-603.151) [-602.123] * (-602.260) (-602.022) [-602.833] (-605.315) -- 0:00:03
Average standard deviation of split frequencies: 0.008419
940500 -- [-602.689] (-610.594) (-601.300) (-602.507) * (-601.996) (-604.198) (-602.905) [-602.268] -- 0:00:03
941000 -- (-605.028) (-603.823) [-601.152] (-603.285) * [-603.791] (-601.615) (-603.672) (-603.270) -- 0:00:03
941500 -- (-601.851) (-604.678) [-602.529] (-607.379) * (-603.970) [-601.524] (-610.167) (-603.320) -- 0:00:03
942000 -- (-603.907) [-601.807] (-602.249) (-606.920) * [-603.946] (-602.012) (-601.623) (-603.264) -- 0:00:03
942500 -- (-605.096) [-601.713] (-600.994) (-602.221) * (-601.116) (-601.767) [-603.227] (-602.496) -- 0:00:03
943000 -- (-604.937) [-601.337] (-601.020) (-601.721) * [-603.091] (-602.672) (-602.324) (-603.465) -- 0:00:03
943500 -- (-605.854) (-602.344) [-602.315] (-602.309) * (-603.198) (-604.288) (-604.263) [-603.010] -- 0:00:03
944000 -- (-605.519) [-602.529] (-603.878) (-604.441) * [-602.265] (-603.658) (-601.901) (-602.361) -- 0:00:03
944500 -- (-607.633) (-601.437) [-603.118] (-603.971) * (-604.466) [-604.057] (-603.014) (-602.451) -- 0:00:03
945000 -- (-603.687) [-601.853] (-601.929) (-602.178) * (-601.682) (-603.801) [-605.894] (-600.980) -- 0:00:03
Average standard deviation of split frequencies: 0.009497
945500 -- (-603.826) [-601.804] (-601.113) (-603.255) * [-603.336] (-602.115) (-605.393) (-602.543) -- 0:00:03
946000 -- (-602.099) [-600.758] (-601.191) (-604.631) * (-606.855) (-603.765) (-601.378) [-603.362] -- 0:00:03
946500 -- (-600.963) [-600.964] (-605.162) (-605.109) * (-604.854) [-602.851] (-601.136) (-608.039) -- 0:00:03
947000 -- [-605.369] (-601.569) (-604.563) (-605.713) * (-604.062) (-605.676) (-601.173) [-607.014] -- 0:00:03
947500 -- (-603.013) (-601.716) (-602.955) [-603.558] * (-601.476) (-604.339) [-600.793] (-602.329) -- 0:00:03
948000 -- [-603.597] (-604.298) (-603.264) (-604.004) * (-605.607) (-601.045) [-603.317] (-603.879) -- 0:00:03
948500 -- [-604.207] (-604.669) (-603.333) (-602.530) * [-602.496] (-601.744) (-603.315) (-603.768) -- 0:00:03
949000 -- (-602.902) [-602.730] (-605.803) (-604.711) * (-601.045) (-606.079) (-602.979) [-606.413] -- 0:00:03
949500 -- (-602.223) [-605.210] (-604.362) (-608.632) * (-602.596) (-605.687) (-604.414) [-601.616] -- 0:00:03
950000 -- (-602.574) [-604.298] (-602.685) (-603.274) * (-601.819) (-602.824) (-602.199) [-603.218] -- 0:00:03
Average standard deviation of split frequencies: 0.008231
950500 -- (-601.567) (-602.762) [-601.320] (-604.771) * (-603.380) (-603.667) (-603.652) [-601.800] -- 0:00:02
951000 -- [-602.499] (-603.271) (-604.277) (-603.974) * (-605.344) (-601.965) (-604.944) [-602.443] -- 0:00:02
951500 -- [-601.311] (-604.011) (-605.280) (-600.871) * (-602.384) [-603.624] (-605.505) (-601.796) -- 0:00:02
952000 -- (-601.537) (-601.209) [-603.611] (-600.763) * (-601.338) [-602.716] (-602.853) (-602.213) -- 0:00:02
952500 -- (-602.632) (-601.211) (-601.374) [-606.032] * (-603.758) (-601.685) (-605.579) [-601.701] -- 0:00:02
953000 -- [-601.939] (-601.292) (-606.040) (-608.259) * (-601.559) (-601.937) [-603.849] (-606.160) -- 0:00:02
953500 -- (-602.343) [-601.468] (-602.016) (-607.937) * (-601.864) (-605.052) [-603.026] (-604.822) -- 0:00:02
954000 -- (-603.774) (-603.069) [-604.750] (-602.893) * (-602.040) [-604.859] (-602.170) (-605.377) -- 0:00:02
954500 -- [-601.832] (-601.665) (-602.466) (-601.649) * (-606.361) [-601.269] (-603.976) (-603.176) -- 0:00:02
955000 -- (-603.553) (-601.476) (-602.554) [-602.766] * (-604.424) (-601.361) (-603.676) [-603.299] -- 0:00:02
Average standard deviation of split frequencies: 0.007922
955500 -- (-602.897) (-602.420) (-605.110) [-603.527] * [-605.175] (-601.919) (-605.047) (-603.479) -- 0:00:02
956000 -- (-603.147) [-604.286] (-602.366) (-605.414) * [-603.132] (-603.166) (-605.836) (-603.252) -- 0:00:02
956500 -- (-603.012) (-603.763) [-601.421] (-604.413) * (-605.756) (-601.963) (-603.214) [-607.363] -- 0:00:02
957000 -- [-601.148] (-601.852) (-602.036) (-605.234) * [-604.827] (-601.792) (-603.483) (-602.090) -- 0:00:02
957500 -- (-603.196) [-604.435] (-604.669) (-603.537) * (-601.867) (-605.466) [-601.518] (-602.008) -- 0:00:02
958000 -- (-602.102) [-602.395] (-603.858) (-605.647) * [-602.750] (-602.743) (-601.683) (-603.688) -- 0:00:02
958500 -- (-602.812) (-602.002) (-606.904) [-606.758] * (-602.663) (-605.027) [-601.539] (-604.806) -- 0:00:02
959000 -- [-602.043] (-602.135) (-605.262) (-601.827) * [-602.807] (-604.448) (-603.747) (-602.063) -- 0:00:02
959500 -- [-603.482] (-602.075) (-603.629) (-605.389) * (-608.306) [-602.630] (-601.633) (-605.792) -- 0:00:02
960000 -- (-605.722) (-602.034) [-602.019] (-605.753) * [-601.457] (-601.645) (-605.295) (-610.577) -- 0:00:02
Average standard deviation of split frequencies: 0.007753
960500 -- (-603.865) (-602.139) (-602.118) [-602.960] * (-604.020) [-603.163] (-607.180) (-605.554) -- 0:00:02
961000 -- (-602.935) (-603.842) [-603.547] (-603.648) * (-602.496) (-601.328) [-602.876] (-610.918) -- 0:00:02
961500 -- (-602.783) [-601.364] (-604.016) (-602.108) * (-603.501) [-601.844] (-600.892) (-605.606) -- 0:00:02
962000 -- (-601.960) (-602.405) (-603.907) [-604.372] * (-603.091) (-602.510) [-602.110] (-601.493) -- 0:00:02
962500 -- [-603.079] (-604.536) (-602.899) (-605.202) * (-601.712) [-603.337] (-604.873) (-604.595) -- 0:00:02
963000 -- (-603.864) [-602.869] (-603.468) (-606.125) * (-602.660) [-604.605] (-603.157) (-605.357) -- 0:00:02
963500 -- [-603.019] (-603.127) (-602.034) (-606.298) * (-602.756) (-601.585) [-602.113] (-602.368) -- 0:00:02
964000 -- [-602.199] (-603.111) (-602.519) (-605.388) * [-602.040] (-601.458) (-602.465) (-603.215) -- 0:00:02
964500 -- [-604.467] (-604.111) (-602.390) (-604.683) * (-602.944) (-603.268) [-603.158] (-601.634) -- 0:00:02
965000 -- (-605.415) (-602.853) [-601.883] (-607.624) * (-606.307) (-603.428) (-601.092) [-602.397] -- 0:00:02
Average standard deviation of split frequencies: 0.007808
965500 -- (-605.615) [-603.083] (-605.521) (-601.427) * (-603.402) (-601.974) [-601.966] (-602.874) -- 0:00:02
966000 -- (-602.728) [-603.962] (-602.875) (-603.376) * (-605.736) (-603.918) (-604.176) [-603.620] -- 0:00:02
966500 -- [-606.406] (-603.864) (-601.613) (-601.800) * [-604.550] (-602.012) (-609.755) (-605.222) -- 0:00:02
967000 -- (-601.826) (-605.613) (-604.244) [-602.895] * [-602.267] (-602.317) (-603.520) (-603.653) -- 0:00:01
967500 -- [-601.608] (-603.614) (-605.088) (-601.760) * [-601.652] (-604.235) (-604.269) (-602.566) -- 0:00:01
968000 -- (-602.723) [-605.914] (-604.386) (-602.047) * [-602.079] (-604.492) (-603.093) (-602.487) -- 0:00:01
968500 -- [-602.985] (-606.117) (-602.920) (-605.021) * (-604.862) (-603.503) [-602.946] (-604.320) -- 0:00:01
969000 -- (-602.151) (-609.158) (-604.639) [-605.551] * (-601.192) (-604.538) [-602.317] (-607.373) -- 0:00:01
969500 -- (-602.917) (-602.797) (-605.001) [-603.806] * (-605.838) (-608.686) [-603.053] (-601.880) -- 0:00:01
970000 -- (-603.305) (-604.441) [-603.433] (-604.590) * (-602.313) (-604.053) (-604.298) [-603.051] -- 0:00:01
Average standard deviation of split frequencies: 0.007965
970500 -- [-601.768] (-602.081) (-603.576) (-606.804) * (-603.692) [-602.943] (-601.288) (-603.206) -- 0:00:01
971000 -- (-603.109) (-604.112) [-603.444] (-606.070) * (-602.488) (-604.314) [-602.096] (-601.049) -- 0:00:01
971500 -- [-604.458] (-607.649) (-601.990) (-603.565) * (-603.129) (-602.946) (-603.715) [-600.812] -- 0:00:01
972000 -- (-609.323) [-602.499] (-601.934) (-604.338) * (-604.436) (-603.967) (-602.868) [-600.805] -- 0:00:01
972500 -- (-604.949) [-602.217] (-607.222) (-604.093) * (-604.377) (-601.215) [-602.032] (-604.821) -- 0:00:01
973000 -- (-603.341) (-605.630) (-602.680) [-602.602] * (-602.148) [-602.582] (-603.991) (-603.894) -- 0:00:01
973500 -- (-603.147) (-603.958) (-605.300) [-602.525] * [-602.543] (-602.550) (-605.532) (-603.194) -- 0:00:01
974000 -- (-603.001) [-602.830] (-602.952) (-601.629) * (-602.450) [-601.652] (-602.126) (-601.615) -- 0:00:01
974500 -- (-605.102) (-601.819) (-603.750) [-602.214] * (-602.210) (-603.459) [-601.186] (-601.847) -- 0:00:01
975000 -- (-603.443) (-602.894) [-602.055] (-601.773) * (-601.768) (-604.499) [-601.224] (-604.758) -- 0:00:01
Average standard deviation of split frequencies: 0.007470
975500 -- (-603.857) (-602.243) (-601.402) [-601.276] * [-603.986] (-601.622) (-601.698) (-601.526) -- 0:00:01
976000 -- (-603.179) [-602.607] (-602.846) (-601.294) * (-603.926) (-603.335) [-604.583] (-604.292) -- 0:00:01
976500 -- (-602.762) (-606.292) (-600.919) [-601.662] * (-602.712) [-603.270] (-607.947) (-602.909) -- 0:00:01
977000 -- (-604.271) (-605.441) (-603.153) [-604.747] * (-604.959) [-602.531] (-604.515) (-603.752) -- 0:00:01
977500 -- (-601.033) [-603.509] (-604.026) (-601.976) * [-607.435] (-602.247) (-605.056) (-603.120) -- 0:00:01
978000 -- (-604.831) (-601.917) (-601.343) [-603.228] * (-609.020) (-606.932) (-602.715) [-604.478] -- 0:00:01
978500 -- (-601.087) (-604.062) (-601.610) [-603.931] * (-601.813) (-601.969) [-601.872] (-602.764) -- 0:00:01
979000 -- (-603.269) [-602.721] (-601.695) (-603.496) * (-604.516) [-600.780] (-602.091) (-607.271) -- 0:00:01
979500 -- (-602.439) (-602.014) [-603.355] (-601.420) * (-606.075) [-601.043] (-601.770) (-601.081) -- 0:00:01
980000 -- (-601.260) [-604.191] (-604.157) (-601.870) * (-604.733) (-603.024) (-602.735) [-601.715] -- 0:00:01
Average standard deviation of split frequencies: 0.007659
980500 -- (-602.264) (-603.587) (-604.322) [-601.494] * (-601.476) [-601.758] (-603.659) (-601.231) -- 0:00:01
981000 -- (-601.951) (-603.739) [-607.759] (-603.204) * (-601.828) (-603.768) (-603.709) [-602.480] -- 0:00:01
981500 -- [-601.419] (-605.841) (-603.940) (-602.174) * (-602.012) (-609.750) [-601.120] (-601.942) -- 0:00:01
982000 -- (-606.239) (-603.164) (-602.451) [-600.970] * [-601.961] (-601.742) (-600.819) (-601.910) -- 0:00:01
982500 -- [-603.901] (-602.579) (-603.038) (-601.855) * (-602.617) (-601.605) [-601.631] (-601.509) -- 0:00:01
983000 -- (-601.516) (-603.027) [-601.636] (-604.860) * (-601.916) [-603.363] (-601.642) (-602.787) -- 0:00:01
983500 -- (-602.771) [-604.131] (-602.776) (-607.502) * [-604.189] (-602.531) (-602.465) (-601.322) -- 0:00:00
984000 -- [-603.566] (-608.493) (-602.892) (-602.276) * (-602.545) (-602.330) [-603.124] (-600.841) -- 0:00:00
984500 -- [-604.422] (-605.496) (-605.842) (-602.383) * (-606.705) (-602.805) (-602.560) [-605.185] -- 0:00:00
985000 -- (-611.329) [-602.725] (-602.941) (-602.779) * [-604.329] (-606.101) (-608.523) (-607.030) -- 0:00:00
Average standard deviation of split frequencies: 0.008008
985500 -- (-602.525) (-604.215) (-602.697) [-603.727] * (-604.264) (-604.677) [-605.509] (-604.529) -- 0:00:00
986000 -- (-602.120) [-604.409] (-601.618) (-602.740) * [-601.062] (-605.743) (-606.081) (-605.425) -- 0:00:00
986500 -- (-602.798) (-602.011) (-603.282) [-601.464] * [-602.455] (-602.635) (-603.261) (-612.887) -- 0:00:00
987000 -- (-601.413) [-601.337] (-605.440) (-602.905) * (-604.982) (-607.319) [-601.506] (-611.335) -- 0:00:00
987500 -- (-605.157) (-602.096) (-601.698) [-603.053] * (-602.300) (-603.190) [-603.433] (-601.877) -- 0:00:00
988000 -- (-604.003) (-605.408) (-604.067) [-601.876] * (-603.977) (-606.680) (-602.437) [-604.240] -- 0:00:00
988500 -- (-602.384) [-603.711] (-608.814) (-603.500) * (-604.072) (-602.727) [-603.512] (-601.734) -- 0:00:00
989000 -- [-602.525] (-603.175) (-602.522) (-603.136) * (-606.299) [-602.830] (-603.216) (-604.329) -- 0:00:00
989500 -- (-604.628) (-601.835) (-601.205) [-603.206] * [-605.280] (-604.887) (-602.161) (-604.461) -- 0:00:00
990000 -- [-604.167] (-602.867) (-601.375) (-604.842) * (-601.646) (-612.864) (-601.463) [-614.493] -- 0:00:00
Average standard deviation of split frequencies: 0.007970
990500 -- (-605.704) [-602.085] (-602.596) (-605.728) * [-603.135] (-609.049) (-602.927) (-603.477) -- 0:00:00
991000 -- (-606.183) [-602.403] (-604.714) (-604.261) * (-602.563) (-601.975) (-602.403) [-602.072] -- 0:00:00
991500 -- (-603.086) (-605.493) [-604.177] (-605.516) * (-602.883) [-606.065] (-602.345) (-604.912) -- 0:00:00
992000 -- (-603.213) (-605.625) (-602.406) [-604.338] * (-603.494) (-608.047) [-603.223] (-603.429) -- 0:00:00
992500 -- (-608.753) (-602.506) [-603.372] (-602.074) * (-605.605) (-601.218) (-602.504) [-602.188] -- 0:00:00
993000 -- (-601.968) (-601.827) (-602.093) [-601.005] * (-606.359) [-601.895] (-601.825) (-601.540) -- 0:00:00
993500 -- (-603.254) (-602.348) (-603.279) [-602.077] * (-608.785) [-606.694] (-603.934) (-602.698) -- 0:00:00
994000 -- (-607.029) [-602.810] (-601.430) (-602.939) * (-601.789) (-601.469) (-607.306) [-602.242] -- 0:00:00
994500 -- (-602.894) (-603.627) (-602.982) [-606.775] * (-601.630) (-601.584) (-602.004) [-605.165] -- 0:00:00
995000 -- [-601.372] (-603.009) (-602.975) (-606.243) * [-602.674] (-603.691) (-602.610) (-604.949) -- 0:00:00
Average standard deviation of split frequencies: 0.008105
995500 -- (-603.175) [-606.018] (-603.480) (-605.944) * (-601.795) (-602.760) [-602.726] (-602.553) -- 0:00:00
996000 -- [-600.771] (-608.084) (-608.197) (-603.680) * (-602.590) [-605.270] (-602.999) (-603.332) -- 0:00:00
996500 -- (-602.382) (-608.648) (-601.532) [-602.607] * (-603.157) (-604.212) [-601.786] (-604.148) -- 0:00:00
997000 -- [-602.561] (-609.079) (-605.802) (-602.663) * (-604.255) (-606.330) [-601.791] (-602.802) -- 0:00:00
997500 -- [-605.811] (-603.401) (-602.680) (-602.139) * (-602.972) (-606.707) (-603.507) [-604.561] -- 0:00:00
998000 -- (-602.501) (-601.369) [-603.311] (-611.701) * [-603.253] (-603.225) (-602.198) (-602.691) -- 0:00:00
998500 -- (-604.387) (-601.941) (-604.067) [-605.080] * (-601.353) (-604.246) [-603.426] (-601.982) -- 0:00:00
999000 -- (-603.448) (-603.667) [-601.346] (-602.409) * [-605.500] (-603.471) (-602.993) (-602.782) -- 0:00:00
999500 -- (-604.015) [-601.825] (-603.838) (-601.428) * (-605.062) (-603.380) [-600.982] (-603.727) -- 0:00:00
1000000 -- (-601.097) [-602.326] (-601.870) (-603.697) * (-606.284) (-602.155) (-604.979) [-603.366] -- 0:00:00
Average standard deviation of split frequencies: 0.007449
Analysis completed in 60 seconds
Analysis used 58.49 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -600.63
Likelihood of best state for "cold" chain of run 2 was -600.63
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.0 % ( 21 %) Dirichlet(Pi{all})
34.5 % ( 22 %) Slider(Pi{all})
78.2 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 60 %) Multiplier(Alpha{3})
23.9 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.3 % ( 28 %) Dirichlet(Pi{all})
33.5 % ( 23 %) Slider(Pi{all})
78.9 % ( 61 %) Multiplier(Alpha{1,2})
77.2 % ( 45 %) Multiplier(Alpha{3})
23.8 % ( 25 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 165999 0.82 0.67
3 | 167672 166547 0.84
4 | 166851 166397 166534
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167257 0.82 0.67
3 | 166400 166174 0.84
4 | 166575 166652 166942
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -602.45
| 1 12 2 |
| 2 2 1 |
| 2 1 1 2 |
|1 1 2 1 2 1 1 2 2 |
| 1 2 1 1 21 2122 *2 2 1 1* 1 1 2 |
| 1 12 1 2 2 1 2 221 *1 1 2 * 1 |
| 1 * 1 2 1 1 2 1 1 2 1|
| 2 21 * 2 222 1 22 2 112 1 |
| 2 2 1 1 1 1 |
|2 1221 1 1 2 2 1 |
| 1 1 1 |
| 2 12 2 |
| 2 2 |
| 2 2 2|
| 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -604.03
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -602.36 -604.83
2 -602.34 -607.37
--------------------------------------
TOTAL -602.35 -606.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904712 0.092399 0.373498 1.498828 0.870764 1338.26 1419.63 1.002
r(A<->C){all} 0.161972 0.018709 0.000022 0.439099 0.125089 261.16 281.87 1.003
r(A<->G){all} 0.164245 0.020235 0.000229 0.459012 0.123836 270.64 271.56 1.002
r(A<->T){all} 0.168962 0.020481 0.000091 0.460043 0.127567 237.53 251.55 1.006
r(C<->G){all} 0.164661 0.017870 0.000018 0.426145 0.130630 220.89 264.00 1.001
r(C<->T){all} 0.176134 0.021191 0.000025 0.482313 0.139652 184.20 246.36 1.000
r(G<->T){all} 0.164026 0.019815 0.000051 0.448639 0.126614 184.65 184.91 1.002
pi(A){all} 0.209059 0.000369 0.174908 0.248435 0.208783 1316.49 1321.90 1.000
pi(C){all} 0.273116 0.000449 0.232463 0.315812 0.272908 1301.96 1313.83 1.000
pi(G){all} 0.328526 0.000482 0.283033 0.368090 0.328464 1380.88 1440.94 1.000
pi(T){all} 0.189299 0.000343 0.155684 0.225835 0.189101 1308.82 1356.65 1.000
alpha{1,2} 0.422504 0.241666 0.000328 1.377334 0.247719 1152.80 1216.23 1.000
alpha{3} 0.454529 0.221748 0.000330 1.379971 0.306091 1270.88 1385.94 1.000
pinvar{all} 0.996263 0.000023 0.987522 0.999997 0.997747 1154.24 1283.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- .*..*.
9 -- ..*.*.
10 -- ...*.*
11 -- ..*..*
12 -- .****.
13 -- ..**..
14 -- .*.*..
15 -- .*...*
16 -- ..****
17 -- ....**
18 -- .**.**
19 -- ...**.
20 -- .**...
21 -- .***.*
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.001413 0.155230 0.157229 2
8 443 0.147568 0.003298 0.145237 0.149900 2
9 442 0.147235 0.000000 0.147235 0.147235 2
10 440 0.146569 0.012248 0.137908 0.155230 2
11 437 0.145570 0.000471 0.145237 0.145903 2
12 430 0.143238 0.012248 0.134577 0.151899 2
13 429 0.142905 0.005182 0.139241 0.146569 2
14 428 0.142572 0.002827 0.140573 0.144570 2
15 427 0.142239 0.001413 0.141239 0.143238 2
16 426 0.141905 0.024497 0.124584 0.159227 2
17 426 0.141905 0.010364 0.134577 0.149234 2
18 414 0.137908 0.014133 0.127915 0.147901 2
19 411 0.136909 0.001413 0.135909 0.137908 2
20 409 0.136243 0.011777 0.127915 0.144570 2
21 387 0.128914 0.000471 0.128581 0.129247 2
22 265 0.088274 0.017430 0.075949 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097524 0.009653 0.000026 0.297649 0.066643 1.001 2
length{all}[2] 0.100905 0.010156 0.000016 0.312203 0.068961 1.000 2
length{all}[3] 0.102818 0.010781 0.000040 0.311323 0.071565 1.000 2
length{all}[4] 0.095702 0.008831 0.000148 0.282982 0.065977 1.000 2
length{all}[5] 0.102820 0.010227 0.000061 0.300580 0.072545 1.000 2
length{all}[6] 0.102874 0.011043 0.000008 0.304710 0.070188 1.000 2
length{all}[7] 0.097140 0.009189 0.000247 0.281155 0.065819 0.999 2
length{all}[8] 0.099106 0.011372 0.000058 0.320216 0.065015 0.999 2
length{all}[9] 0.102928 0.010720 0.000389 0.311677 0.069175 1.000 2
length{all}[10] 0.108474 0.011616 0.000557 0.319998 0.074161 0.998 2
length{all}[11] 0.105809 0.011435 0.000062 0.313202 0.073032 1.004 2
length{all}[12] 0.106816 0.010746 0.000124 0.333184 0.077994 0.999 2
length{all}[13] 0.103389 0.009838 0.000069 0.317730 0.071477 1.008 2
length{all}[14] 0.099625 0.008642 0.000289 0.289916 0.071538 0.998 2
length{all}[15] 0.097302 0.009254 0.000068 0.283683 0.065400 0.998 2
length{all}[16] 0.094655 0.009896 0.000465 0.306708 0.064375 1.000 2
length{all}[17] 0.102203 0.009244 0.000218 0.299821 0.076865 1.000 2
length{all}[18] 0.087828 0.007327 0.000392 0.255414 0.067389 1.009 2
length{all}[19] 0.105365 0.010854 0.000419 0.309971 0.073454 1.002 2
length{all}[20] 0.103678 0.011046 0.000724 0.341369 0.072877 1.000 2
length{all}[21] 0.089393 0.008448 0.000345 0.256375 0.065464 0.997 2
length{all}[22] 0.108246 0.013524 0.000016 0.327248 0.075321 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007449
Maximum standard deviation of split frequencies = 0.024497
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 441
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 147 / 147 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 147 / 147 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044285 0.058716 0.051332 0.063857 0.054039 0.043239 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -615.658312
Iterating by ming2
Initial: fx= 615.658312
x= 0.04429 0.05872 0.05133 0.06386 0.05404 0.04324 0.30000 1.30000
1 h-m-p 0.0000 0.0003 351.5239 +++ 578.340591 m 0.0003 14 | 1/8
2 h-m-p 0.0017 0.0087 39.0794 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 323.5091 ++ 577.578994 m 0.0000 46 | 2/8
4 h-m-p 0.0001 0.0146 26.1291 ---------.. | 2/8
5 h-m-p 0.0000 0.0000 289.2702 ++ 573.468266 m 0.0000 75 | 3/8
6 h-m-p 0.0006 0.0188 20.8094 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 250.7691 ++ 572.281303 m 0.0000 106 | 4/8
8 h-m-p 0.0003 0.0267 15.3284 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 204.7637 ++ 570.912626 m 0.0000 136 | 5/8
10 h-m-p 0.0005 0.0412 10.2150 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 144.8496 ++ 570.158865 m 0.0000 167 | 6/8
12 h-m-p 0.2454 8.0000 0.0000 +++ 570.158865 m 8.0000 179 | 6/8
13 h-m-p 0.1271 8.0000 0.0000 +++ 570.158865 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0377 +++++ 570.158865 m 8.0000 209 | 6/8
15 h-m-p 1.0228 8.0000 0.2947 Y 570.158864 0 2.4178 222 | 6/8
16 h-m-p 1.6000 8.0000 0.0368 C 570.158864 0 1.8722 235 | 6/8
17 h-m-p 1.6000 8.0000 0.0071 --C 570.158864 0 0.0250 250 | 6/8
18 h-m-p 1.6000 8.0000 0.0000 ----N 570.158864 0 0.0016 267 | 6/8
19 h-m-p 0.7942 8.0000 0.0000 --C 570.158864 0 0.0177 282
Out..
lnL = -570.158864
283 lfun, 283 eigenQcodon, 1698 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020729 0.020018 0.014922 0.036072 0.095509 0.042621 0.890140 0.781959 0.407933
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.657411
np = 9
lnL0 = -603.231943
Iterating by ming2
Initial: fx= 603.231943
x= 0.02073 0.02002 0.01492 0.03607 0.09551 0.04262 0.89014 0.78196 0.40793
1 h-m-p 0.0000 0.0001 348.4761 ++ 590.492700 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 112.9058 ++ 586.793875 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 739.8878 ++ 586.438519 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 4413.4537 ++ 580.311144 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 5454.0266 ++ 578.530630 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 4903.0944 ++ 570.158900 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 570.158900 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.0873 +++++ 570.158877 m 8.0000 104 | 6/9
9 h-m-p 0.3711 1.8556 0.1217 ++ 570.158875 m 1.8556 119 | 7/9
10 h-m-p 0.4250 2.1250 0.1395 ++ 570.158874 m 2.1250 134 | 7/9
11 h-m-p 0.0378 0.1892 5.4599 ----------Y 570.158874 0 0.0000 158 | 7/9
12 h-m-p 0.0172 0.0860 0.0000 ------Y 570.158874 0 0.0000 176 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 -------N 570.158874 0 0.0000 197
Out..
lnL = -570.158874
198 lfun, 594 eigenQcodon, 2376 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036468 0.022046 0.025152 0.024868 0.018850 0.079827 0.628580 1.281978 0.483542 0.403155 2.238675
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.953419
np = 11
lnL0 = -599.134923
Iterating by ming2
Initial: fx= 599.134923
x= 0.03647 0.02205 0.02515 0.02487 0.01885 0.07983 0.62858 1.28198 0.48354 0.40315 2.23868
1 h-m-p 0.0000 0.0001 330.6678 ++ 583.623038 m 0.0001 16 | 1/11
2 h-m-p 0.0003 0.0014 48.1339 ++ 580.846548 m 0.0014 30 | 2/11
3 h-m-p 0.0000 0.0000 6223.6835 ++ 579.078523 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 7576.2091 ++ 578.932925 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 3432.1941 ++ 575.532587 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 3974338.5848 ++ 571.863071 m 0.0000 86 | 6/11
7 h-m-p 0.0303 0.6977 2.5825 --------------.. | 6/11
8 h-m-p 0.0000 0.0001 143.5802 ++ 570.158884 m 0.0001 126 | 7/11
9 h-m-p 0.0630 8.0000 0.0000 ++++ 570.158884 m 8.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 0.0556 +++++ 570.158878 m 8.0000 163 | 7/11
11 h-m-p 0.3415 2.2301 1.3028 ++ 570.158863 m 2.2301 181 | 8/11
12 h-m-p 1.6000 8.0000 0.0474 ++ 570.158863 m 8.0000 195 | 8/11
13 h-m-p 0.4153 4.5386 0.9128 ---------C 570.158863 0 0.0000 221 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 570.158863 m 8.0000 241 | 8/11
15 h-m-p 0.0160 8.0000 0.6072 +++Y 570.158862 0 0.6505 261 | 8/11
16 h-m-p 1.6000 8.0000 0.0333 Y 570.158862 0 0.7151 278 | 8/11
17 h-m-p 1.6000 8.0000 0.0009 +C 570.158862 0 6.4000 296 | 8/11
18 h-m-p 1.6000 8.0000 0.0002 ++ 570.158862 m 8.0000 313 | 8/11
19 h-m-p 0.0160 8.0000 0.1600 ++++Y 570.158862 0 3.1540 334 | 8/11
20 h-m-p 1.6000 8.0000 0.0587 ++ 570.158862 m 8.0000 351 | 8/11
21 h-m-p 0.0303 8.0000 15.5035 C 570.158861 0 0.0368 368 | 8/11
22 h-m-p 0.6421 3.2103 0.4623 ---------------Y 570.158861 0 0.0000 397 | 8/11
23 h-m-p 0.0160 8.0000 1.0198 +++C 570.158861 0 1.0240 417 | 8/11
24 h-m-p 1.6000 8.0000 0.1275 -------N 570.158861 0 0.0000 438 | 8/11
25 h-m-p 0.6125 8.0000 0.0000 ++ 570.158861 m 8.0000 455 | 8/11
26 h-m-p 0.0160 8.0000 0.2801 +++++ 570.158858 m 8.0000 475 | 8/11
27 h-m-p 0.9814 8.0000 2.2832 +Y 570.158855 0 2.5603 493 | 8/11
28 h-m-p 1.6000 8.0000 0.0036 -----Y 570.158855 0 0.0004 512 | 8/11
29 h-m-p 0.0160 8.0000 0.0002 +++++ 570.158855 m 8.0000 532 | 8/11
30 h-m-p 0.0335 8.0000 0.0555 ++++ 570.158855 m 8.0000 551 | 8/11
31 h-m-p 1.6000 8.0000 0.0115 Y 570.158855 0 1.1667 568 | 8/11
32 h-m-p 1.6000 8.0000 0.0011 +Y 570.158855 0 6.4000 586 | 8/11
33 h-m-p 1.6000 8.0000 0.0035 ++ 570.158855 m 8.0000 603 | 8/11
34 h-m-p 1.6000 8.0000 0.0027 ++ 570.158855 m 8.0000 620 | 8/11
35 h-m-p 0.1029 8.0000 0.2131 ++C 570.158855 0 1.6343 639 | 8/11
36 h-m-p 1.6000 8.0000 0.0754 ++ 570.158855 m 8.0000 656 | 8/11
37 h-m-p 1.6000 8.0000 0.1740 Y 570.158855 0 1.1375 673 | 8/11
38 h-m-p 1.6000 8.0000 0.0081 C 570.158855 0 1.6000 690 | 8/11
39 h-m-p 0.0027 1.3738 7.3423 --------Y 570.158855 0 0.0000 715 | 8/11
40 h-m-p 0.0160 8.0000 0.0010 ----N 570.158855 0 0.0000 733 | 8/11
41 h-m-p 0.0160 8.0000 0.0002 -N 570.158855 0 0.0010 751 | 8/11
42 h-m-p 0.4399 8.0000 0.0000 N 570.158855 0 0.4399 768 | 8/11
43 h-m-p 0.0187 8.0000 0.0000 Y 570.158855 0 0.0047 785
Out..
lnL = -570.158855
786 lfun, 3144 eigenQcodon, 14148 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -570.160105 S = -570.155966 -0.001581
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:05
did 20 / 45 patterns 0:05
did 30 / 45 patterns 0:05
did 40 / 45 patterns 0:05
did 45 / 45 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017814 0.109598 0.030939 0.075429 0.012261 0.098146 0.000100 0.750034 1.305845
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.083532
np = 9
lnL0 = -617.949956
Iterating by ming2
Initial: fx= 617.949956
x= 0.01781 0.10960 0.03094 0.07543 0.01226 0.09815 0.00011 0.75003 1.30584
1 h-m-p 0.0000 0.0000 327.1329 ++ 617.612221 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0230 32.4485 +++++ 606.954286 m 0.0230 29 | 2/9
3 h-m-p 0.0001 0.0004 378.3634 ++ 582.462991 m 0.0004 41 | 3/9
4 h-m-p 0.0022 0.0108 12.9245 ++ 579.281078 m 0.0108 53 | 4/9
5 h-m-p 0.0000 0.0002 352.6462 ++ 574.332426 m 0.0002 65 | 5/9
6 h-m-p 0.0001 0.0005 54.3187 ++ 573.893459 m 0.0005 77 | 6/9
7 h-m-p 0.0000 0.0002 109.7975 ++ 571.690818 m 0.0002 89 | 7/9
8 h-m-p 0.0023 0.2971 4.9023 ------------.. | 7/9
9 h-m-p 0.0000 0.0001 146.3902 ++ 570.158943 m 0.0001 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 N 570.158943 0 1.6000 135 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 Y 570.158943 0 0.0160 148 | 7/9
12 h-m-p 0.0298 0.1490 0.0000 Y 570.158943 0 0.0298 162
Out..
lnL = -570.158943
163 lfun, 1793 eigenQcodon, 9780 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050413 0.092378 0.095823 0.042461 0.078832 0.067339 0.000100 0.900000 0.367417 1.348319 2.038790
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.353437
np = 11
lnL0 = -623.154996
Iterating by ming2
Initial: fx= 623.154996
x= 0.05041 0.09238 0.09582 0.04246 0.07883 0.06734 0.00011 0.90000 0.36742 1.34832 2.03879
1 h-m-p 0.0000 0.0000 267.3195 ++ 623.026227 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 514.1227 +++ 593.403120 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0000 2817.3261 ++ 588.395756 m 0.0000 45 | 3/11
4 h-m-p 0.0009 0.0121 30.3670 ++ 579.188220 m 0.0121 59 | 4/11
5 h-m-p 0.0004 0.0020 46.1869 ++ 577.486692 m 0.0020 73 | 5/11
6 h-m-p 0.0000 0.0002 558.9035 ++ 572.031461 m 0.0002 87 | 6/11
7 h-m-p 0.0093 0.0467 5.2492 ++ 570.409250 m 0.0467 101 | 6/11
8 h-m-p 0.0224 0.1122 10.4952 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 209.4571 ++ 570.397380 m 0.0000 140 | 7/11
10 h-m-p 0.0000 0.0000 95.6967 ++ 570.158941 m 0.0000 154 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 570.158941 m 8.0000 168 | 8/11
12 h-m-p 0.0160 8.0000 0.0604 +++++ 570.158862 m 8.0000 188 | 8/11
13 h-m-p 1.6000 8.0000 0.0224 ++ 570.158857 m 8.0000 205 | 8/11
14 h-m-p 0.2513 1.2564 0.2668 ++ 570.158852 m 1.2564 222 | 9/11
15 h-m-p 0.3604 8.0000 0.0271 +++ 570.158852 m 8.0000 240 | 9/11
16 h-m-p 0.1742 8.0000 1.2465 +++ 570.158843 m 8.0000 257 | 9/11
17 h-m-p 1.6000 8.0000 0.0501 ----------------.. | 9/11
18 h-m-p 0.0160 8.0000 0.0000 ----Y 570.158843 0 0.0000 305 | 9/11
19 h-m-p 0.0160 8.0000 0.0000 -------N 570.158843 0 0.0000 328
Out..
lnL = -570.158843
329 lfun, 3948 eigenQcodon, 21714 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -570.156344 S = -570.155478 -0.000379
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:13
did 20 / 45 patterns 0:13
did 30 / 45 patterns 0:13
did 40 / 45 patterns 0:13
did 45 / 45 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=147
NC_011896_1_WP_010908309_1_1469_MLBR_RS06945 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
NC_002677_1_NP_301988_1_860_ML1390 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF
**************************************************
NC_011896_1_WP_010908309_1_1469_MLBR_RS06945 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
NC_002677_1_NP_301988_1_860_ML1390 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775 DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN
**************************************************
NC_011896_1_WP_010908309_1_1469_MLBR_RS06945 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
NC_002677_1_NP_301988_1_860_ML1390 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775 LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
***********************************************
>NC_011896_1_WP_010908309_1_1469_MLBR_RS06945 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC >NC_002677_1_NP_301988_1_860_ML1390 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC >NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC >NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC >NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC >NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775 ATGGGCGCCTATCAGACCGTGGTGGTGGGAACCGATGGTTCAGATTCGTC GTTGCGTGCGGTGGACCGGGCAGGCAAAATTGCCGGGTCGGATGCCAAGC TGATCATCGCGTCGGCCTACCTGCCCCAGCATGACAATGCTCGGGCGTTC GACATATTGAAGGACGAAAGCTACAAAGTGACGGGTACTGCCCCGATCTA CGAGATCCTGCATGACGCGAAGGAGCGAGCGCACGCCGCCGGTGCTAAGA ACGTCGAAGAGCGACCGGTTGTCGGCGCTCCGGTCGATGCGCTGGTGAAC CTTGCCGAGAAAACAAATGCCGATCTGCTAGTGGTTGGCAATGTCGGTCT GAGCACGATCGCAGGTCGACTGTTGGGATCGGTGCCGGCCAACGTCTCGC GTCGGGCCAAGATCGACGTCTTGATCGTGCACACCACGCAC
>NC_011896_1_WP_010908309_1_1469_MLBR_RS06945 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH >NC_002677_1_NP_301988_1_860_ML1390 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH >NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH >NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH >NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH >NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775 MGAYQTVVVGTDGSDSSLRAVDRAGKIAGSDAKLIIASAYLPQHDNARAF DILKDESYKVTGTAPIYEILHDAKERAHAAGAKNVEERPVVGAPVDALVN LAEKTNADLLVVGNVGLSTIAGRLLGSVPANVSRRAKIDVLIVHTTH
#NEXUS
[ID: 5438336661]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908309_1_1469_MLBR_RS06945
NC_002677_1_NP_301988_1_860_ML1390
NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110
NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660
NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595
NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908309_1_1469_MLBR_RS06945,
2 NC_002677_1_NP_301988_1_860_ML1390,
3 NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110,
4 NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660,
5 NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595,
6 NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06664274,2:0.06896091,3:0.07156457,4:0.065977,5:0.07254507,6:0.07018839);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06664274,2:0.06896091,3:0.07156457,4:0.065977,5:0.07254507,6:0.07018839);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -602.36 -604.83
2 -602.34 -607.37
--------------------------------------
TOTAL -602.35 -606.75
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1390/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904712 0.092399 0.373498 1.498828 0.870764 1338.26 1419.63 1.002
r(A<->C){all} 0.161972 0.018709 0.000022 0.439099 0.125089 261.16 281.87 1.003
r(A<->G){all} 0.164245 0.020235 0.000229 0.459012 0.123836 270.64 271.56 1.002
r(A<->T){all} 0.168962 0.020481 0.000091 0.460043 0.127567 237.53 251.55 1.006
r(C<->G){all} 0.164661 0.017870 0.000018 0.426145 0.130630 220.89 264.00 1.001
r(C<->T){all} 0.176134 0.021191 0.000025 0.482313 0.139652 184.20 246.36 1.000
r(G<->T){all} 0.164026 0.019815 0.000051 0.448639 0.126614 184.65 184.91 1.002
pi(A){all} 0.209059 0.000369 0.174908 0.248435 0.208783 1316.49 1321.90 1.000
pi(C){all} 0.273116 0.000449 0.232463 0.315812 0.272908 1301.96 1313.83 1.000
pi(G){all} 0.328526 0.000482 0.283033 0.368090 0.328464 1380.88 1440.94 1.000
pi(T){all} 0.189299 0.000343 0.155684 0.225835 0.189101 1308.82 1356.65 1.000
alpha{1,2} 0.422504 0.241666 0.000328 1.377334 0.247719 1152.80 1216.23 1.000
alpha{3} 0.454529 0.221748 0.000330 1.379971 0.306091 1270.88 1385.94 1.000
pinvar{all} 0.996263 0.000023 0.987522 0.999997 0.997747 1154.24 1283.42 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1390/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 147
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 3 3 3 3 3 3
CTG 7 7 7 7 7 7 | CCG 4 4 4 4 4 4 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 3 3 3 3 3 3 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 5 5 5 5 5 5
GTC 6 6 6 6 6 6 | GCC 11 11 11 11 11 11 | GAC 6 6 6 6 6 6 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 6 6 6 6 6 6 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908309_1_1469_MLBR_RS06945
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
#2: NC_002677_1_NP_301988_1_860_ML1390
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
#3: NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
#4: NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
#5: NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
#6: NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 36 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 12
CTC 0 | CCC 6 | CAC 18 | CGC 0
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 18
CTG 42 | CCG 24 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 0
ATC 42 | ACC 18 | AAC 18 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 6 | ACG 18 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 30
GTC 36 | GCC 66 | GAC 36 | GGC 24
GTA 0 | GCA 12 | Glu E GAA 12 | GGA 12
GTG 54 | GCG 36 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10884 C:0.19728 A:0.23129 G:0.46259
position 2: T:0.27891 C:0.28571 A:0.28571 G:0.14966
position 3: T:0.17687 C:0.34014 A:0.10884 G:0.37415
Average T:0.18821 C:0.27438 A:0.20862 G:0.32880
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -570.158864 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.890140 2.038790
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908309_1_1469_MLBR_RS06945: 0.000004, NC_002677_1_NP_301988_1_860_ML1390: 0.000004, NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110: 0.000004, NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660: 0.000004, NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595: 0.000004, NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.89014
omega (dN/dS) = 2.03879
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
7..2 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
7..3 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
7..4 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
7..5 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
7..6 0.000 334.6 106.4 2.0388 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -570.158874 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.628580 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908309_1_1469_MLBR_RS06945: 0.000004, NC_002677_1_NP_301988_1_860_ML1390: 0.000004, NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110: 0.000004, NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660: 0.000004, NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595: 0.000004, NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.62858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 336.5 104.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -570.158855 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.117216 0.795113 0.000001 10.989430
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908309_1_1469_MLBR_RS06945: 0.000004, NC_002677_1_NP_301988_1_860_ML1390: 0.000004, NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110: 0.000004, NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660: 0.000004, NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595: 0.000004, NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.11722 0.79511 0.08767
w: 0.00000 1.00000 10.98943
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
7..2 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
7..3 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
7..4 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
7..5 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
7..6 0.000 343.2 97.8 1.7586 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908309_1_1469_MLBR_RS06945)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908309_1_1469_MLBR_RS06945)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -570.158943 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.441054
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908309_1_1469_MLBR_RS06945: 0.000004, NC_002677_1_NP_301988_1_860_ML1390: 0.000004, NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110: 0.000004, NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660: 0.000004, NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595: 0.000004, NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.44105
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 343.2 97.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -570.158843 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.463835 12.485158
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908309_1_1469_MLBR_RS06945: 0.000004, NC_002677_1_NP_301988_1_860_ML1390: 0.000004, NZ_LVXE01000004_1_WP_010908309_1_1796_A3216_RS03110: 0.000004, NZ_LYPH01000077_1_WP_010908309_1_2629_A8144_RS12660: 0.000004, NZ_CP029543_1_WP_010908309_1_1491_DIJ64_RS07595: 0.000004, NZ_AP014567_1_WP_010908309_1_1527_JK2ML_RS07775: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.46384
(p1 = 0.99999) w = 12.48516
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 12.48516
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
7..2 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
7..3 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
7..4 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
7..5 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
7..6 0.000 343.2 97.8 12.4850 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908309_1_1469_MLBR_RS06945)
Pr(w>1) post mean +- SE for w
1 M 1.000** 12.485
2 G 1.000** 12.485
3 A 1.000** 12.485
4 Y 1.000** 12.485
5 Q 1.000** 12.485
6 T 1.000** 12.485
7 V 1.000** 12.485
8 V 1.000** 12.485
9 V 1.000** 12.485
10 G 1.000** 12.485
11 T 1.000** 12.485
12 D 1.000** 12.485
13 G 1.000** 12.485
14 S 1.000** 12.485
15 D 1.000** 12.485
16 S 1.000** 12.485
17 S 1.000** 12.485
18 L 1.000** 12.485
19 R 1.000** 12.485
20 A 1.000** 12.485
21 V 1.000** 12.485
22 D 1.000** 12.485
23 R 1.000** 12.485
24 A 1.000** 12.485
25 G 1.000** 12.485
26 K 1.000** 12.485
27 I 1.000** 12.485
28 A 1.000** 12.485
29 G 1.000** 12.485
30 S 1.000** 12.485
31 D 1.000** 12.485
32 A 1.000** 12.485
33 K 1.000** 12.485
34 L 1.000** 12.485
35 I 1.000** 12.485
36 I 1.000** 12.485
37 A 1.000** 12.485
38 S 1.000** 12.485
39 A 1.000** 12.485
40 Y 1.000** 12.485
41 L 1.000** 12.485
42 P 1.000** 12.485
43 Q 1.000** 12.485
44 H 1.000** 12.485
45 D 1.000** 12.485
46 N 1.000** 12.485
47 A 1.000** 12.485
48 R 1.000** 12.485
49 A 1.000** 12.485
50 F 1.000** 12.485
51 D 1.000** 12.485
52 I 1.000** 12.485
53 L 1.000** 12.485
54 K 1.000** 12.485
55 D 1.000** 12.485
56 E 1.000** 12.485
57 S 1.000** 12.485
58 Y 1.000** 12.485
59 K 1.000** 12.485
60 V 1.000** 12.485
61 T 1.000** 12.485
62 G 1.000** 12.485
63 T 1.000** 12.485
64 A 1.000** 12.485
65 P 1.000** 12.485
66 I 1.000** 12.485
67 Y 1.000** 12.485
68 E 1.000** 12.485
69 I 1.000** 12.485
70 L 1.000** 12.485
71 H 1.000** 12.485
72 D 1.000** 12.485
73 A 1.000** 12.485
74 K 1.000** 12.485
75 E 1.000** 12.485
76 R 1.000** 12.485
77 A 1.000** 12.485
78 H 1.000** 12.485
79 A 1.000** 12.485
80 A 1.000** 12.485
81 G 1.000** 12.485
82 A 1.000** 12.485
83 K 1.000** 12.485
84 N 1.000** 12.485
85 V 1.000** 12.485
86 E 1.000** 12.485
87 E 1.000** 12.485
88 R 1.000** 12.485
89 P 1.000** 12.485
90 V 1.000** 12.485
91 V 1.000** 12.485
92 G 1.000** 12.485
93 A 1.000** 12.485
94 P 1.000** 12.485
95 V 1.000** 12.485
96 D 1.000** 12.485
97 A 1.000** 12.485
98 L 1.000** 12.485
99 V 1.000** 12.485
100 N 1.000** 12.485
101 L 1.000** 12.485
102 A 1.000** 12.485
103 E 1.000** 12.485
104 K 1.000** 12.485
105 T 1.000** 12.485
106 N 1.000** 12.485
107 A 1.000** 12.485
108 D 1.000** 12.485
109 L 1.000** 12.485
110 L 1.000** 12.485
111 V 1.000** 12.485
112 V 1.000** 12.485
113 G 1.000** 12.485
114 N 1.000** 12.485
115 V 1.000** 12.485
116 G 1.000** 12.485
117 L 1.000** 12.485
118 S 1.000** 12.485
119 T 1.000** 12.485
120 I 1.000** 12.485
121 A 1.000** 12.485
122 G 1.000** 12.485
123 R 1.000** 12.485
124 L 1.000** 12.485
125 L 1.000** 12.485
126 G 1.000** 12.485
127 S 1.000** 12.485
128 V 1.000** 12.485
129 P 1.000** 12.485
130 A 1.000** 12.485
131 N 1.000** 12.485
132 V 1.000** 12.485
133 S 1.000** 12.485
134 R 1.000** 12.485
135 R 1.000** 12.485
136 A 1.000** 12.485
137 K 1.000** 12.485
138 I 1.000** 12.485
139 D 1.000** 12.485
140 V 1.000** 12.485
141 L 1.000** 12.485
142 I 1.000** 12.485
143 V 1.000** 12.485
144 H 1.000** 12.485
145 T 1.000** 12.485
146 T 1.000** 12.485
147 H 1.000** 12.485
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908309_1_1469_MLBR_RS06945)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -570.158874 Model 2: PositiveSelection -570.158855 Model 0: one-ratio -570.158864 Model 7: beta -570.158943 Model 8: beta&w>1 -570.158843 Model 0 vs 1 1.9999999949504854E-5 Model 2 vs 1 3.799999990405922E-5 Model 8 vs 7 1.999999999497959E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
