--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:55:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1391/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -941.59          -944.19
2       -941.55          -945.00
--------------------------------------
TOTAL     -941.57          -944.68
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898633    0.090044    0.369331    1.477656    0.864189   1501.00   1501.00    1.000
r(A<->C){all}   0.163370    0.019185    0.000108    0.444501    0.127415    111.77    141.68    1.000
r(A<->G){all}   0.186540    0.022880    0.000018    0.499533    0.149421    127.36    199.90    1.001
r(A<->T){all}   0.161611    0.018690    0.000025    0.435915    0.127294    245.82    287.42    1.000
r(C<->G){all}   0.159448    0.018673    0.000225    0.439473    0.122466    294.70    333.31    1.000
r(C<->T){all}   0.160188    0.017473    0.000197    0.433794    0.128456    187.53    213.20    1.001
r(G<->T){all}   0.168843    0.019482    0.000023    0.450528    0.135072    234.90    280.15    1.000
pi(A){all}      0.191934    0.000223    0.162569    0.220639    0.191953   1079.47   1136.86    1.000
pi(C){all}      0.325191    0.000296    0.293771    0.360587    0.324377   1130.05   1228.52    1.000
pi(G){all}      0.305891    0.000287    0.273584    0.340063    0.305684   1366.21   1378.33    1.000
pi(T){all}      0.176984    0.000207    0.148432    0.204857    0.176696   1290.50   1358.99    1.000
alpha{1,2}      0.423492    0.231512    0.000191    1.358642    0.256990   1220.72   1263.91    1.000
alpha{3}        0.462183    0.240420    0.000169    1.469697    0.302169   1268.04   1306.05    1.000
pinvar{all}     0.997759    0.000007    0.992821    0.999999    0.998620   1104.67   1198.30    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-905.546864
Model 2: PositiveSelection	-905.546699
Model 0: one-ratio	-905.546849
Model 7: beta	-905.546805
Model 8: beta&w>1	-905.546699


Model 0 vs 1	3.0000000151630957E-5

Model 2 vs 1	3.300000000763248E-4

Model 8 vs 7	2.119999999194988E-4
>C1
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C2
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C3
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C4
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C5
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C6
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232 

C1              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C2              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C3              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C4              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C5              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C6              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
                **************************************************

C1              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C2              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C3              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C4              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C5              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C6              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
                **************************************************

C1              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C2              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C3              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C4              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C5              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C6              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
                **************************************************

C1              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C2              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C3              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C4              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C5              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C6              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
                **************************************************

C1              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C2              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C3              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C4              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C5              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C6              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
                ********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  232 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  232 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6960]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6960]--->[6960]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C2              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C3              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C4              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C5              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C6              MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
                **************************************************

C1              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C2              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C3              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C4              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C5              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C6              GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
                **************************************************

C1              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C2              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C3              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C4              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C5              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C6              APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
                **************************************************

C1              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C2              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C3              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C4              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C5              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C6              LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
                **************************************************

C1              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C2              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C3              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C4              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C5              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C6              YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
                ********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C2              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C3              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C4              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C5              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C6              ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
                **************************************************

C1              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C2              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C3              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C4              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C5              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C6              GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
                **************************************************

C1              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C2              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C3              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C4              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C5              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C6              CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
                **************************************************

C1              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C2              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C3              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C4              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C5              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C6              GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
                **************************************************

C1              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C2              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C3              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C4              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C5              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C6              TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
                **************************************************

C1              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C2              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C3              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C4              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C5              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C6              AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
                **************************************************

C1              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C2              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C3              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C4              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C5              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C6              GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
                **************************************************

C1              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C2              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C3              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C4              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C5              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C6              GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
                **************************************************

C1              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C2              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C3              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C4              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C5              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C6              TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
                **************************************************

C1              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C2              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C3              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C4              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C5              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C6              CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
                **************************************************

C1              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C2              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C3              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C4              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C5              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C6              CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
                **************************************************

C1              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C2              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C3              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C4              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C5              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C6              GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
                **************************************************

C1              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C2              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C3              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C4              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C5              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C6              TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
                **************************************************

C1              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C2              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C3              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C4              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C5              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C6              CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
                **********************************************



>C1
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C2
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C3
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C4
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C5
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C6
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C1
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C2
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C3
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C4
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C5
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C6
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 696 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859621
      Setting output file names to "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1986993088
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5195715323
      Seed = 1994025904
      Swapseed = 1579859621
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1557.681280 -- -24.965149
         Chain 2 -- -1557.681369 -- -24.965149
         Chain 3 -- -1557.681369 -- -24.965149
         Chain 4 -- -1557.681280 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1557.681132 -- -24.965149
         Chain 2 -- -1557.681369 -- -24.965149
         Chain 3 -- -1557.681369 -- -24.965149
         Chain 4 -- -1557.681280 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1557.681] (-1557.681) (-1557.681) (-1557.681) * [-1557.681] (-1557.681) (-1557.681) (-1557.681) 
        500 -- [-954.608] (-954.175) (-962.748) (-955.263) * (-951.366) [-949.582] (-965.078) (-948.979) -- 0:00:00
       1000 -- (-958.405) [-949.424] (-949.857) (-958.291) * (-957.466) (-946.667) (-952.696) [-951.290] -- 0:00:00
       1500 -- (-963.163) [-944.390] (-953.038) (-946.735) * (-948.165) (-944.885) (-960.005) [-945.712] -- 0:00:00
       2000 -- (-969.235) [-947.143] (-947.818) (-946.521) * (-951.858) (-956.965) (-956.917) [-950.169] -- 0:00:00
       2500 -- (-970.313) (-957.284) (-952.496) [-952.020] * (-952.510) (-948.907) (-951.109) [-949.757] -- 0:00:00
       3000 -- (-946.742) [-949.006] (-948.610) (-959.282) * (-960.177) (-954.218) [-947.548] (-950.771) -- 0:00:00
       3500 -- (-952.227) (-954.794) [-949.829] (-948.770) * (-945.034) (-955.298) [-949.051] (-949.722) -- 0:00:00
       4000 -- (-949.751) [-951.446] (-953.683) (-956.153) * (-952.005) [-953.562] (-955.306) (-949.301) -- 0:00:00
       4500 -- [-952.926] (-947.899) (-952.630) (-957.491) * (-957.881) (-948.740) (-960.711) [-956.874] -- 0:00:00
       5000 -- (-948.957) [-951.243] (-950.736) (-953.606) * [-947.560] (-947.802) (-953.418) (-949.856) -- 0:00:00

      Average standard deviation of split frequencies: 0.074826

       5500 -- (-955.453) [-946.638] (-956.124) (-951.365) * (-950.013) [-950.891] (-946.994) (-950.500) -- 0:00:00
       6000 -- [-946.318] (-947.573) (-950.073) (-955.315) * (-956.053) (-948.041) [-957.190] (-952.474) -- 0:00:00
       6500 -- (-949.924) (-947.165) [-948.939] (-953.018) * (-957.359) [-946.182] (-948.959) (-947.180) -- 0:00:00
       7000 -- [-952.357] (-952.052) (-950.686) (-950.774) * (-961.155) [-955.636] (-951.939) (-947.689) -- 0:00:00
       7500 -- [-955.275] (-955.125) (-950.336) (-955.145) * [-951.578] (-953.955) (-949.874) (-953.109) -- 0:00:00
       8000 -- (-950.310) [-949.500] (-955.815) (-949.020) * (-954.665) (-951.823) [-948.370] (-959.148) -- 0:00:00
       8500 -- (-952.619) (-949.328) (-960.502) [-953.141] * (-963.293) (-950.347) [-952.775] (-956.135) -- 0:00:00
       9000 -- (-953.266) (-951.621) [-950.374] (-951.548) * (-943.217) (-951.252) [-948.323] (-960.267) -- 0:00:00
       9500 -- (-952.519) (-947.321) (-956.561) [-950.050] * (-946.414) [-951.713] (-956.065) (-967.198) -- 0:00:00
      10000 -- (-950.063) [-951.975] (-949.351) (-950.602) * (-944.563) (-951.947) (-947.060) [-945.463] -- 0:00:00

      Average standard deviation of split frequencies: 0.068300

      10500 -- [-956.468] (-945.445) (-943.898) (-956.717) * (-950.724) [-954.167] (-954.934) (-956.582) -- 0:00:00
      11000 -- (-957.641) [-951.445] (-955.780) (-946.906) * (-945.017) (-954.090) [-956.270] (-958.229) -- 0:01:29
      11500 -- (-954.076) (-947.908) (-946.752) [-951.625] * [-943.556] (-956.828) (-949.022) (-940.783) -- 0:01:25
      12000 -- (-947.826) (-952.029) (-949.288) [-948.562] * (-941.980) (-955.182) (-947.748) [-942.984] -- 0:01:22
      12500 -- (-958.275) (-952.306) (-948.835) [-948.808] * [-942.077] (-950.854) (-948.495) (-948.343) -- 0:01:19
      13000 -- (-954.062) (-949.915) [-949.821] (-956.355) * (-948.226) (-962.684) (-949.908) [-943.913] -- 0:01:15
      13500 -- (-951.828) [-950.985] (-951.056) (-954.482) * (-942.313) [-955.234] (-952.928) (-940.464) -- 0:01:13
      14000 -- [-948.185] (-953.669) (-947.409) (-957.142) * (-949.235) [-948.606] (-953.503) (-944.126) -- 0:01:10
      14500 -- (-950.641) (-958.188) [-947.865] (-960.036) * (-944.870) (-958.098) (-952.940) [-942.137] -- 0:01:07
      15000 -- (-957.190) (-950.414) [-953.794] (-949.432) * (-944.936) (-948.140) (-942.101) [-944.530] -- 0:01:05

      Average standard deviation of split frequencies: 0.063578

      15500 -- [-947.892] (-956.269) (-952.173) (-961.132) * (-945.160) (-953.152) [-946.227] (-945.429) -- 0:01:03
      16000 -- [-952.408] (-952.515) (-951.836) (-950.946) * [-943.961] (-954.484) (-943.028) (-941.521) -- 0:01:01
      16500 -- (-949.361) (-949.382) (-949.389) [-954.205] * [-944.861] (-953.193) (-943.142) (-941.426) -- 0:00:59
      17000 -- (-950.940) (-954.120) [-951.656] (-952.281) * (-941.805) [-945.507] (-943.870) (-941.557) -- 0:00:57
      17500 -- (-957.827) [-952.664] (-955.433) (-952.515) * (-944.884) [-950.365] (-942.138) (-942.491) -- 0:00:56
      18000 -- [-954.429] (-946.302) (-949.300) (-954.968) * (-941.250) (-967.206) [-942.077] (-943.410) -- 0:00:54
      18500 -- (-955.882) (-955.965) (-956.966) [-945.787] * (-945.457) [-940.987] (-944.550) (-943.384) -- 0:00:53
      19000 -- (-949.316) (-955.784) [-947.868] (-945.682) * [-945.673] (-941.540) (-942.996) (-941.896) -- 0:00:51
      19500 -- (-955.600) (-951.308) [-951.317] (-946.634) * (-943.059) (-943.825) [-943.025] (-943.370) -- 0:00:50
      20000 -- (-947.588) (-951.161) (-961.100) [-946.336] * [-941.466] (-940.637) (-944.182) (-942.743) -- 0:00:49

      Average standard deviation of split frequencies: 0.059559

      20500 -- (-950.401) [-950.454] (-962.815) (-941.629) * (-944.992) (-943.028) [-941.800] (-944.928) -- 0:00:47
      21000 -- (-952.007) [-957.798] (-941.731) (-940.662) * (-941.760) (-942.382) [-941.777] (-943.437) -- 0:00:46
      21500 -- (-949.282) (-957.653) [-941.273] (-942.570) * (-942.925) (-941.679) [-942.048] (-946.276) -- 0:00:45
      22000 -- (-965.481) (-954.773) (-941.805) [-941.224] * (-941.128) (-941.909) [-942.672] (-944.297) -- 0:00:44
      22500 -- (-949.949) (-968.303) (-941.283) [-941.442] * [-941.128] (-942.568) (-942.252) (-943.130) -- 0:00:43
      23000 -- (-947.277) (-962.438) [-941.973] (-941.141) * (-944.132) (-941.159) (-941.302) [-941.914] -- 0:00:42
      23500 -- (-948.789) (-949.070) [-942.301] (-943.951) * (-943.632) [-940.611] (-942.891) (-945.088) -- 0:00:41
      24000 -- (-950.127) [-944.815] (-941.315) (-944.048) * (-945.773) [-940.587] (-942.683) (-940.540) -- 0:00:40
      24500 -- [-950.334] (-951.627) (-941.617) (-941.965) * (-945.171) (-942.985) [-943.049] (-943.052) -- 0:00:39
      25000 -- (-949.244) [-945.440] (-941.279) (-947.355) * (-948.988) (-945.678) (-940.752) [-940.795] -- 0:00:39

      Average standard deviation of split frequencies: 0.044421

      25500 -- (-952.252) [-948.212] (-941.371) (-943.676) * (-942.664) [-940.641] (-943.684) (-943.834) -- 0:00:38
      26000 -- (-956.755) (-952.704) [-943.006] (-946.595) * [-941.154] (-940.414) (-941.784) (-942.087) -- 0:01:14
      26500 -- (-951.883) (-947.548) [-941.943] (-940.702) * (-943.176) [-941.944] (-943.693) (-941.462) -- 0:01:13
      27000 -- (-954.585) (-951.432) (-942.267) [-940.601] * (-942.085) [-943.807] (-944.029) (-946.085) -- 0:01:12
      27500 -- (-955.753) [-950.763] (-944.191) (-944.999) * (-942.618) (-940.823) (-944.562) [-944.428] -- 0:01:10
      28000 -- (-950.339) [-953.353] (-943.686) (-943.384) * (-940.352) (-944.096) [-943.041] (-948.618) -- 0:01:09
      28500 -- [-948.994] (-950.758) (-940.453) (-941.106) * [-941.350] (-944.476) (-942.720) (-950.381) -- 0:01:08
      29000 -- (-952.223) [-945.954] (-946.768) (-948.097) * [-942.617] (-944.073) (-943.904) (-947.733) -- 0:01:06
      29500 -- (-949.084) (-946.750) (-941.200) [-941.616] * (-940.878) (-942.591) [-941.169] (-944.062) -- 0:01:05
      30000 -- (-950.099) [-950.248] (-942.216) (-943.485) * (-942.667) (-941.118) (-943.700) [-943.409] -- 0:01:04

      Average standard deviation of split frequencies: 0.035868

      30500 -- (-953.148) (-952.429) (-941.962) [-942.723] * [-940.619] (-941.684) (-941.339) (-941.313) -- 0:01:03
      31000 -- [-951.521] (-954.678) (-941.662) (-942.463) * [-944.213] (-941.616) (-942.521) (-941.133) -- 0:01:02
      31500 -- (-948.348) (-955.223) (-941.066) [-945.327] * (-944.742) (-944.655) (-941.698) [-941.758] -- 0:01:01
      32000 -- (-948.940) (-945.130) (-948.644) [-940.882] * (-940.070) [-941.005] (-943.326) (-940.883) -- 0:01:00
      32500 -- [-954.743] (-949.473) (-942.340) (-941.044) * (-941.065) [-943.397] (-940.768) (-945.214) -- 0:00:59
      33000 -- (-953.739) [-950.607] (-943.690) (-945.909) * (-940.625) (-941.204) (-941.219) [-942.129] -- 0:00:58
      33500 -- (-955.941) [-946.869] (-941.836) (-942.364) * (-944.947) (-943.405) [-940.706] (-941.725) -- 0:00:57
      34000 -- [-946.459] (-956.371) (-941.644) (-942.718) * (-941.700) (-942.428) [-944.659] (-942.988) -- 0:00:56
      34500 -- (-950.624) (-957.962) (-940.281) [-945.002] * (-941.501) [-942.841] (-943.075) (-947.546) -- 0:00:55
      35000 -- (-955.477) (-945.335) (-940.369) [-945.672] * [-941.293] (-941.434) (-942.093) (-947.208) -- 0:00:55

      Average standard deviation of split frequencies: 0.021606

      35500 -- [-944.524] (-944.438) (-940.875) (-947.625) * [-941.051] (-941.689) (-942.398) (-946.017) -- 0:00:54
      36000 -- (-951.333) (-941.262) [-941.571] (-947.388) * (-943.099) (-944.110) (-940.950) [-941.353] -- 0:00:53
      36500 -- (-958.247) (-940.784) (-941.757) [-944.039] * [-943.902] (-944.972) (-941.307) (-944.395) -- 0:00:52
      37000 -- (-953.858) [-943.639] (-943.391) (-944.100) * (-944.329) (-942.801) [-942.027] (-942.439) -- 0:00:52
      37500 -- (-950.852) [-942.771] (-941.857) (-944.703) * [-940.608] (-943.846) (-941.867) (-943.888) -- 0:00:51
      38000 -- (-950.232) (-941.181) [-941.273] (-943.876) * [-941.025] (-941.090) (-941.234) (-951.804) -- 0:00:50
      38500 -- (-951.894) (-941.579) (-941.209) [-944.280] * [-943.344] (-941.906) (-942.223) (-941.138) -- 0:00:49
      39000 -- (-952.790) [-946.647] (-943.497) (-942.392) * (-941.563) (-945.085) (-942.486) [-942.853] -- 0:00:49
      39500 -- (-951.239) (-941.481) (-943.686) [-945.186] * (-941.938) (-945.148) (-941.738) [-944.795] -- 0:00:48
      40000 -- (-953.121) (-940.610) [-942.367] (-943.884) * (-941.378) (-941.888) (-941.911) [-941.514] -- 0:00:48

      Average standard deviation of split frequencies: 0.025014

      40500 -- (-951.679) [-942.916] (-941.670) (-941.861) * [-942.225] (-941.410) (-943.052) (-941.942) -- 0:01:11
      41000 -- (-953.848) [-943.973] (-940.233) (-941.987) * (-941.132) (-944.004) [-942.379] (-940.617) -- 0:01:10
      41500 -- (-949.113) [-942.077] (-941.872) (-941.010) * [-941.167] (-944.578) (-942.708) (-942.221) -- 0:01:09
      42000 -- (-958.072) [-940.108] (-941.115) (-943.600) * (-940.887) (-951.779) [-940.161] (-943.497) -- 0:01:08
      42500 -- (-949.726) (-944.590) [-942.073] (-941.430) * (-940.798) (-945.080) (-940.746) [-941.468] -- 0:01:07
      43000 -- (-965.177) [-941.918] (-941.804) (-943.872) * (-945.534) (-944.850) [-941.710] (-942.870) -- 0:01:06
      43500 -- [-956.305] (-940.246) (-942.968) (-944.026) * [-943.048] (-946.708) (-941.503) (-942.180) -- 0:01:05
      44000 -- (-949.685) [-941.145] (-942.063) (-947.228) * [-940.514] (-943.195) (-943.674) (-941.433) -- 0:01:05
      44500 -- (-949.394) (-943.362) (-942.393) [-944.729] * (-941.036) (-941.079) (-943.239) [-943.094] -- 0:01:04
      45000 -- (-960.036) [-944.366] (-942.334) (-945.063) * [-941.401] (-941.844) (-942.566) (-941.855) -- 0:01:03

      Average standard deviation of split frequencies: 0.029768

      45500 -- (-951.601) [-940.231] (-947.792) (-941.018) * (-942.215) [-943.377] (-944.408) (-942.387) -- 0:01:02
      46000 -- (-954.361) (-940.334) [-940.944] (-940.964) * (-942.394) [-943.460] (-945.008) (-942.359) -- 0:01:02
      46500 -- (-965.603) [-940.314] (-941.290) (-942.016) * (-942.175) [-942.253] (-944.195) (-940.561) -- 0:01:01
      47000 -- (-941.074) (-941.190) [-940.983] (-945.235) * [-941.001] (-942.656) (-949.485) (-943.312) -- 0:01:00
      47500 -- (-944.069) (-941.628) (-940.511) [-942.999] * (-940.939) (-942.420) (-946.467) [-943.953] -- 0:01:00
      48000 -- [-940.687] (-943.997) (-940.002) (-942.700) * [-940.553] (-940.938) (-943.282) (-943.638) -- 0:00:59
      48500 -- (-940.491) (-942.120) [-940.295] (-944.273) * [-941.495] (-940.327) (-942.137) (-941.631) -- 0:00:58
      49000 -- (-941.551) (-942.887) [-941.222] (-941.825) * (-949.648) (-941.453) [-941.436] (-942.123) -- 0:00:58
      49500 -- [-942.247] (-942.585) (-942.423) (-942.122) * (-941.271) (-940.353) [-946.089] (-941.797) -- 0:00:57
      50000 -- (-942.688) (-947.482) [-941.904] (-941.631) * [-942.191] (-940.459) (-944.150) (-944.875) -- 0:00:57

      Average standard deviation of split frequencies: 0.028355

      50500 -- (-946.898) (-940.809) [-943.503] (-942.660) * (-942.734) [-940.739] (-949.348) (-942.281) -- 0:00:56
      51000 -- (-944.657) (-943.478) (-944.511) [-943.210] * (-941.808) (-940.739) (-947.063) [-943.520] -- 0:00:55
      51500 -- (-941.740) (-944.396) (-945.395) [-941.550] * [-941.242] (-943.098) (-944.489) (-942.069) -- 0:00:55
      52000 -- (-943.260) [-945.456] (-943.652) (-940.987) * (-944.927) (-943.289) (-942.072) [-943.671] -- 0:00:54
      52500 -- (-943.277) (-944.318) (-942.451) [-940.919] * (-946.006) [-940.687] (-942.316) (-942.362) -- 0:00:54
      53000 -- [-945.939] (-942.624) (-942.550) (-941.658) * (-941.453) [-940.687] (-942.821) (-942.100) -- 0:00:53
      53500 -- (-943.657) (-943.636) [-941.904] (-941.667) * (-942.286) (-942.676) (-941.317) [-942.575] -- 0:00:53
      54000 -- (-944.102) (-943.561) (-945.241) [-941.682] * [-943.866] (-944.232) (-942.536) (-946.628) -- 0:00:52
      54500 -- (-943.366) [-943.905] (-947.143) (-940.971) * (-943.015) (-944.404) [-941.067] (-945.191) -- 0:00:52
      55000 -- (-946.336) (-943.155) (-942.782) [-941.374] * (-942.361) [-942.872] (-941.620) (-941.629) -- 0:01:08

      Average standard deviation of split frequencies: 0.026517

      55500 -- (-944.289) (-943.163) (-940.854) [-941.790] * (-941.000) [-944.382] (-941.681) (-942.194) -- 0:01:08
      56000 -- (-941.871) (-944.773) (-942.201) [-940.814] * (-941.627) [-942.523] (-942.310) (-943.182) -- 0:01:07
      56500 -- (-943.483) (-950.007) [-942.354] (-942.753) * [-940.060] (-943.578) (-942.026) (-941.950) -- 0:01:06
      57000 -- (-943.250) (-944.680) (-941.270) [-942.064] * [-940.806] (-941.330) (-944.591) (-941.722) -- 0:01:06
      57500 -- (-943.873) (-941.896) [-941.754] (-944.094) * [-940.258] (-943.574) (-947.623) (-941.462) -- 0:01:05
      58000 -- [-940.434] (-943.405) (-943.469) (-942.618) * (-942.533) (-945.820) [-940.654] (-942.014) -- 0:01:04
      58500 -- (-940.721) (-942.227) (-943.689) [-946.657] * (-946.618) (-941.036) (-946.354) [-941.013] -- 0:01:04
      59000 -- (-942.379) (-942.325) [-941.245] (-942.086) * (-942.574) (-946.390) (-942.920) [-942.890] -- 0:01:03
      59500 -- (-944.581) [-942.253] (-941.582) (-942.035) * (-941.572) (-950.747) (-942.408) [-941.380] -- 0:01:03
      60000 -- (-942.461) (-942.132) (-945.291) [-941.502] * (-942.648) [-941.839] (-945.038) (-944.369) -- 0:01:02

      Average standard deviation of split frequencies: 0.028750

      60500 -- (-942.157) [-941.303] (-941.499) (-943.572) * [-942.328] (-942.093) (-943.183) (-943.289) -- 0:01:02
      61000 -- (-943.361) [-941.372] (-940.878) (-942.837) * (-944.284) [-942.786] (-941.852) (-944.689) -- 0:01:01
      61500 -- (-946.948) [-942.365] (-942.055) (-941.595) * (-940.743) (-946.207) [-940.810] (-941.330) -- 0:01:01
      62000 -- (-943.761) (-948.971) (-942.891) [-942.395] * (-940.972) (-945.495) (-943.495) [-941.881] -- 0:01:00
      62500 -- [-942.698] (-946.326) (-941.276) (-944.053) * [-942.297] (-944.615) (-943.190) (-941.267) -- 0:01:00
      63000 -- (-944.948) (-943.119) [-941.379] (-941.487) * (-942.685) [-941.935] (-949.038) (-940.791) -- 0:00:59
      63500 -- (-941.723) [-940.413] (-941.230) (-942.088) * (-942.791) (-940.629) [-941.739] (-943.076) -- 0:00:58
      64000 -- (-941.532) (-942.459) (-940.735) [-941.381] * [-941.839] (-940.406) (-943.021) (-943.378) -- 0:00:58
      64500 -- [-942.394] (-940.870) (-942.915) (-940.669) * (-941.171) (-944.222) (-940.690) [-940.795] -- 0:00:58
      65000 -- [-940.813] (-940.302) (-943.705) (-950.565) * (-943.167) (-948.253) [-942.563] (-945.299) -- 0:00:57

      Average standard deviation of split frequencies: 0.024999

      65500 -- (-941.170) (-941.794) (-942.582) [-948.186] * [-944.476] (-942.535) (-941.735) (-942.008) -- 0:00:57
      66000 -- (-949.811) (-947.542) [-942.938] (-947.564) * (-941.134) [-940.944] (-943.219) (-943.769) -- 0:00:56
      66500 -- [-942.750] (-941.926) (-942.181) (-944.384) * (-944.014) [-941.783] (-941.118) (-941.449) -- 0:00:56
      67000 -- (-942.978) (-940.169) [-942.661] (-944.783) * (-943.266) (-942.061) (-941.082) [-941.174] -- 0:00:55
      67500 -- (-943.489) (-941.133) (-943.359) [-942.248] * (-944.962) (-941.578) (-940.708) [-941.094] -- 0:00:55
      68000 -- [-942.403] (-942.120) (-943.524) (-943.107) * (-943.325) [-940.076] (-942.869) (-942.993) -- 0:00:54
      68500 -- [-942.227] (-945.810) (-945.293) (-942.350) * (-945.528) (-944.602) (-942.883) [-941.624] -- 0:00:54
      69000 -- (-940.864) (-944.410) [-940.705] (-940.997) * (-943.648) (-943.934) (-941.145) [-940.899] -- 0:00:53
      69500 -- [-940.665] (-941.950) (-941.794) (-942.620) * [-941.273] (-940.825) (-941.866) (-941.356) -- 0:01:06
      70000 -- [-940.626] (-943.567) (-946.053) (-945.073) * (-941.064) (-940.255) [-940.630] (-941.173) -- 0:01:06

      Average standard deviation of split frequencies: 0.027054

      70500 -- [-940.869] (-941.849) (-943.016) (-942.136) * (-941.027) (-941.818) [-942.409] (-946.981) -- 0:01:05
      71000 -- [-941.769] (-942.331) (-941.738) (-943.166) * (-943.213) [-943.739] (-942.953) (-949.159) -- 0:01:05
      71500 -- (-945.818) (-943.138) [-942.335] (-942.229) * (-940.695) (-945.095) [-941.813] (-940.995) -- 0:01:04
      72000 -- (-940.209) (-946.774) (-941.662) [-940.734] * (-941.770) (-944.580) (-942.578) [-941.752] -- 0:01:04
      72500 -- (-940.209) (-941.381) [-943.499] (-941.108) * (-947.133) [-941.124] (-943.681) (-941.099) -- 0:01:03
      73000 -- (-942.476) [-941.747] (-941.379) (-942.701) * (-942.177) (-940.652) (-942.799) [-940.993] -- 0:01:03
      73500 -- (-940.926) [-941.947] (-941.542) (-943.445) * [-941.744] (-940.297) (-943.073) (-940.969) -- 0:01:03
      74000 -- (-940.651) (-941.561) [-942.044] (-942.846) * [-940.424] (-941.730) (-942.686) (-942.208) -- 0:01:02
      74500 -- (-943.558) (-941.024) (-941.875) [-943.330] * (-944.491) (-941.078) [-941.788] (-945.915) -- 0:01:02
      75000 -- (-941.155) [-941.001] (-942.247) (-942.088) * (-943.081) (-941.036) [-942.434] (-944.388) -- 0:01:01

      Average standard deviation of split frequencies: 0.029381

      75500 -- (-940.350) [-941.066] (-942.492) (-946.842) * (-943.418) (-941.981) [-943.329] (-942.024) -- 0:01:01
      76000 -- (-941.134) [-943.139] (-942.322) (-942.365) * (-942.658) (-941.458) (-941.772) [-941.851] -- 0:01:00
      76500 -- [-940.607] (-944.498) (-942.151) (-942.191) * (-946.444) (-942.647) [-941.630] (-941.561) -- 0:01:00
      77000 -- [-943.554] (-948.453) (-941.477) (-943.654) * (-945.918) (-942.808) [-942.869] (-940.438) -- 0:00:59
      77500 -- [-941.988] (-941.304) (-942.340) (-942.615) * (-943.250) [-943.803] (-945.279) (-943.499) -- 0:00:59
      78000 -- (-941.830) [-943.218] (-943.114) (-943.572) * (-940.747) [-944.702] (-944.145) (-942.513) -- 0:00:59
      78500 -- (-942.343) [-943.161] (-941.349) (-941.811) * (-943.881) (-942.163) [-942.169] (-940.457) -- 0:00:58
      79000 -- (-941.473) (-945.338) (-942.354) [-941.613] * (-941.669) (-946.703) (-943.996) [-941.346] -- 0:00:58
      79500 -- [-941.842] (-943.753) (-941.427) (-943.962) * [-941.339] (-941.641) (-946.941) (-940.176) -- 0:00:57
      80000 -- [-943.555] (-944.116) (-941.656) (-942.037) * (-946.186) (-943.748) (-941.136) [-941.542] -- 0:00:57

      Average standard deviation of split frequencies: 0.027758

      80500 -- (-941.396) [-942.512] (-947.171) (-942.018) * (-945.373) (-942.938) (-942.761) [-941.766] -- 0:00:57
      81000 -- (-942.495) (-944.338) [-943.676] (-942.296) * (-943.529) (-941.180) (-943.397) [-940.889] -- 0:00:56
      81500 -- [-942.281] (-942.133) (-941.023) (-940.976) * (-942.329) (-946.331) [-941.735] (-942.504) -- 0:00:56
      82000 -- (-942.293) [-942.093] (-940.100) (-941.353) * [-946.101] (-940.886) (-942.392) (-943.830) -- 0:00:55
      82500 -- (-941.956) (-942.338) (-942.545) [-942.354] * (-943.533) (-940.276) (-943.094) [-941.757] -- 0:00:55
      83000 -- (-942.863) [-942.484] (-941.530) (-941.525) * [-941.773] (-940.513) (-943.716) (-943.579) -- 0:00:55
      83500 -- (-943.667) [-943.950] (-941.269) (-942.849) * (-941.092) [-941.367] (-941.564) (-942.331) -- 0:00:54
      84000 -- (-945.446) (-941.667) [-941.870] (-944.254) * [-940.943] (-942.487) (-940.980) (-941.118) -- 0:00:54
      84500 -- (-942.047) (-941.144) [-942.976] (-943.685) * [-942.332] (-941.241) (-942.419) (-942.925) -- 0:01:05
      85000 -- [-942.283] (-940.583) (-944.009) (-944.697) * (-942.170) (-944.380) (-940.717) [-942.177] -- 0:01:04

      Average standard deviation of split frequencies: 0.025319

      85500 -- (-944.439) (-942.135) (-942.159) [-942.067] * (-945.586) (-943.688) [-944.235] (-941.486) -- 0:01:04
      86000 -- [-941.564] (-942.409) (-943.051) (-942.735) * (-941.479) (-946.326) (-941.563) [-942.610] -- 0:01:03
      86500 -- (-941.413) (-942.312) [-943.139] (-944.613) * (-942.233) (-943.556) (-942.578) [-940.810] -- 0:01:03
      87000 -- (-944.054) (-940.739) [-940.903] (-942.186) * [-944.927] (-945.512) (-946.340) (-942.629) -- 0:01:02
      87500 -- (-943.266) [-947.375] (-945.563) (-941.271) * (-948.089) (-940.407) [-944.811] (-945.114) -- 0:01:02
      88000 -- [-941.939] (-946.395) (-944.354) (-940.952) * (-942.634) (-940.240) [-942.309] (-943.114) -- 0:01:02
      88500 -- [-940.562] (-940.983) (-942.233) (-943.443) * (-945.546) [-942.212] (-940.949) (-943.098) -- 0:01:01
      89000 -- (-944.336) [-944.263] (-941.779) (-943.385) * [-945.618] (-942.328) (-941.896) (-950.485) -- 0:01:01
      89500 -- (-941.963) (-940.542) [-945.789] (-942.856) * (-942.848) (-942.551) [-943.254] (-943.250) -- 0:01:01
      90000 -- (-941.847) (-940.977) (-941.239) [-940.840] * (-943.973) (-941.962) (-942.591) [-941.838] -- 0:01:00

      Average standard deviation of split frequencies: 0.020797

      90500 -- (-941.684) (-944.250) (-942.544) [-944.851] * [-941.519] (-942.107) (-945.026) (-942.953) -- 0:01:00
      91000 -- (-941.516) (-942.021) (-941.910) [-940.405] * (-941.416) (-944.306) (-941.920) [-941.910] -- 0:00:59
      91500 -- (-942.624) (-941.071) [-944.349] (-941.352) * [-944.447] (-943.773) (-941.713) (-941.904) -- 0:00:59
      92000 -- [-940.885] (-941.244) (-944.167) (-942.404) * [-941.872] (-943.847) (-942.104) (-944.740) -- 0:00:59
      92500 -- (-941.319) [-941.598] (-942.026) (-941.300) * [-942.244] (-941.541) (-940.963) (-943.173) -- 0:00:58
      93000 -- (-940.981) (-943.406) [-940.481] (-942.654) * (-941.718) (-942.834) [-941.794] (-940.355) -- 0:00:58
      93500 -- (-941.287) [-942.828] (-942.942) (-941.990) * (-941.087) [-941.547] (-942.321) (-941.738) -- 0:00:58
      94000 -- (-942.989) (-944.195) [-943.879] (-945.843) * (-943.160) [-940.798] (-943.919) (-942.776) -- 0:00:57
      94500 -- (-946.560) (-942.543) (-944.429) [-946.938] * [-942.583] (-943.709) (-941.670) (-942.940) -- 0:00:57
      95000 -- (-946.412) (-941.138) (-941.403) [-942.575] * (-941.537) (-942.860) (-940.829) [-942.598] -- 0:00:57

      Average standard deviation of split frequencies: 0.021193

      95500 -- (-940.757) [-941.037] (-941.516) (-940.696) * (-942.709) (-943.225) (-943.595) [-943.346] -- 0:00:56
      96000 -- (-942.659) [-941.462] (-941.223) (-943.208) * (-946.489) (-941.437) (-943.863) [-941.016] -- 0:00:56
      96500 -- (-943.892) [-942.047] (-945.543) (-941.936) * (-943.051) (-946.619) [-943.186] (-941.022) -- 0:00:56
      97000 -- (-946.743) [-942.181] (-942.746) (-941.221) * (-943.984) (-943.749) (-942.925) [-943.062] -- 0:00:55
      97500 -- (-944.606) (-944.178) (-943.091) [-946.232] * (-942.635) (-944.012) [-941.930] (-943.144) -- 0:00:55
      98000 -- (-942.873) [-943.807] (-943.750) (-945.385) * (-941.986) [-940.089] (-946.602) (-942.873) -- 0:00:55
      98500 -- (-942.786) (-946.300) (-942.832) [-942.025] * (-943.629) [-940.491] (-942.161) (-940.977) -- 0:00:54
      99000 -- (-942.169) (-946.293) (-942.084) [-942.047] * (-941.314) [-940.421] (-943.803) (-940.906) -- 0:00:54
      99500 -- [-942.056] (-946.625) (-941.968) (-943.519) * (-942.285) [-940.748] (-943.627) (-940.661) -- 0:01:03
      100000 -- (-941.027) (-946.319) [-942.001] (-940.556) * [-944.694] (-941.077) (-943.075) (-941.318) -- 0:01:02

      Average standard deviation of split frequencies: 0.020604

      100500 -- (-940.793) (-941.815) (-948.066) [-941.113] * (-941.341) (-940.175) (-942.985) [-942.219] -- 0:01:02
      101000 -- (-941.040) [-940.951] (-945.688) (-941.652) * [-942.288] (-940.602) (-943.631) (-942.167) -- 0:01:02
      101500 -- [-941.550] (-944.570) (-942.372) (-942.776) * (-940.371) (-941.190) [-947.666] (-941.837) -- 0:01:01
      102000 -- (-941.087) [-941.059] (-941.129) (-941.792) * [-943.355] (-945.351) (-943.896) (-941.495) -- 0:01:01
      102500 -- (-941.793) (-940.106) (-941.059) [-942.006] * (-940.767) [-943.565] (-941.979) (-944.201) -- 0:01:01
      103000 -- [-940.727] (-943.080) (-944.418) (-945.427) * (-943.327) (-940.954) (-947.693) [-942.094] -- 0:01:00
      103500 -- (-942.437) [-941.300] (-944.228) (-940.701) * (-944.763) (-942.448) [-943.463] (-940.713) -- 0:01:00
      104000 -- (-940.379) (-941.269) (-943.698) [-941.261] * (-941.118) [-940.910] (-942.584) (-942.259) -- 0:01:00
      104500 -- (-941.415) (-945.006) (-943.058) [-944.261] * (-941.443) [-941.406] (-942.037) (-945.315) -- 0:00:59
      105000 -- (-942.432) (-946.436) (-947.069) [-942.562] * [-940.755] (-940.712) (-943.083) (-947.349) -- 0:00:59

      Average standard deviation of split frequencies: 0.021791

      105500 -- (-942.981) (-941.722) [-944.309] (-942.738) * (-940.747) [-940.798] (-942.047) (-946.674) -- 0:00:59
      106000 -- (-942.633) [-947.260] (-942.481) (-942.296) * (-941.748) (-949.282) (-943.562) [-943.277] -- 0:00:59
      106500 -- [-941.241] (-942.693) (-940.552) (-945.147) * (-944.835) [-944.129] (-943.051) (-942.024) -- 0:00:58
      107000 -- [-942.108] (-941.115) (-940.236) (-945.788) * (-942.545) (-943.866) (-942.418) [-941.310] -- 0:00:58
      107500 -- (-941.901) (-944.116) [-941.138] (-942.773) * (-941.324) [-943.591] (-942.166) (-941.825) -- 0:00:58
      108000 -- (-942.518) [-941.913] (-941.222) (-945.913) * (-940.776) (-942.141) (-946.332) [-941.614] -- 0:00:57
      108500 -- (-941.844) [-941.819] (-945.947) (-941.506) * (-940.446) [-941.133] (-945.928) (-941.654) -- 0:00:57
      109000 -- (-942.206) (-941.015) [-940.850] (-945.965) * (-943.021) [-941.036] (-943.963) (-941.420) -- 0:00:57
      109500 -- [-943.580] (-942.597) (-942.442) (-943.445) * [-942.318] (-943.975) (-941.652) (-942.117) -- 0:00:56
      110000 -- (-944.581) (-943.811) [-949.111] (-941.207) * (-943.618) (-944.819) (-941.144) [-940.714] -- 0:00:56

      Average standard deviation of split frequencies: 0.022789

      110500 -- (-942.385) [-941.670] (-941.154) (-941.576) * (-945.598) (-940.422) [-941.246] (-941.182) -- 0:00:56
      111000 -- (-941.958) (-942.279) (-943.192) [-942.980] * (-944.873) [-940.382] (-944.589) (-942.496) -- 0:00:56
      111500 -- (-942.770) (-942.170) (-942.377) [-941.357] * (-942.944) [-941.939] (-942.483) (-942.424) -- 0:00:55
      112000 -- (-943.531) (-941.591) [-941.801] (-940.779) * [-941.880] (-942.742) (-944.669) (-943.054) -- 0:00:55
      112500 -- (-944.458) (-941.390) [-940.796] (-941.022) * (-944.063) (-943.138) [-942.992] (-944.695) -- 0:00:55
      113000 -- (-942.323) (-942.284) [-941.451] (-943.259) * (-944.666) (-942.851) (-942.920) [-942.457] -- 0:00:54
      113500 -- (-943.175) (-941.143) [-940.703] (-945.457) * (-944.583) (-944.866) [-943.255] (-940.909) -- 0:01:02
      114000 -- [-942.182] (-940.978) (-941.049) (-943.802) * [-943.954] (-942.977) (-943.492) (-943.239) -- 0:01:02
      114500 -- (-941.038) (-940.991) [-942.736] (-941.518) * [-941.526] (-941.555) (-941.005) (-941.245) -- 0:01:01
      115000 -- (-942.343) (-941.419) [-942.301] (-944.986) * (-941.263) [-943.932] (-940.456) (-941.309) -- 0:01:01

      Average standard deviation of split frequencies: 0.022886

      115500 -- [-941.363] (-940.235) (-942.621) (-944.293) * [-942.748] (-941.194) (-944.725) (-940.386) -- 0:01:01
      116000 -- [-941.527] (-947.893) (-942.380) (-941.429) * (-941.829) [-943.261] (-944.485) (-940.406) -- 0:01:00
      116500 -- (-940.404) [-940.987] (-943.328) (-941.561) * (-945.002) (-942.885) (-942.896) [-941.998] -- 0:01:00
      117000 -- [-943.471] (-941.138) (-941.970) (-944.930) * (-944.551) [-941.627] (-947.355) (-942.348) -- 0:01:00
      117500 -- (-943.052) (-941.224) [-941.953] (-941.359) * (-943.200) (-948.473) [-944.254] (-940.371) -- 0:01:00
      118000 -- (-944.089) (-941.007) [-943.143] (-941.799) * (-943.399) (-941.691) [-941.488] (-944.087) -- 0:00:59
      118500 -- (-940.972) (-942.302) (-942.964) [-942.536] * [-942.804] (-940.227) (-941.467) (-942.644) -- 0:00:59
      119000 -- (-940.884) (-944.299) [-943.121] (-942.132) * (-943.392) (-940.865) [-943.628] (-941.327) -- 0:00:59
      119500 -- [-942.833] (-942.042) (-942.594) (-941.908) * (-941.800) [-943.436] (-943.401) (-940.452) -- 0:00:58
      120000 -- (-941.982) (-943.693) (-942.072) [-940.800] * (-940.953) [-944.435] (-944.056) (-940.145) -- 0:00:58

      Average standard deviation of split frequencies: 0.021589

      120500 -- [-942.020] (-942.295) (-940.884) (-941.268) * (-941.528) (-942.528) (-941.916) [-940.865] -- 0:00:58
      121000 -- [-940.526] (-941.727) (-942.663) (-942.140) * (-943.013) (-943.195) (-940.243) [-941.690] -- 0:00:58
      121500 -- (-941.649) (-941.691) [-940.832] (-943.332) * (-945.452) (-942.613) [-940.515] (-940.147) -- 0:00:57
      122000 -- [-942.040] (-941.622) (-943.531) (-943.069) * (-944.540) (-942.495) [-940.848] (-942.290) -- 0:00:57
      122500 -- [-941.917] (-945.374) (-941.905) (-943.126) * (-943.459) [-945.255] (-943.213) (-941.382) -- 0:00:57
      123000 -- [-946.148] (-944.505) (-941.371) (-943.818) * (-943.190) (-947.241) (-943.461) [-943.205] -- 0:00:57
      123500 -- (-945.484) (-944.977) [-940.239] (-942.994) * (-941.989) (-946.579) (-943.250) [-944.107] -- 0:00:56
      124000 -- (-942.282) (-945.508) (-940.279) [-942.439] * [-942.297] (-942.298) (-950.786) (-943.883) -- 0:00:56
      124500 -- [-942.135] (-945.386) (-941.371) (-942.227) * (-942.359) (-940.889) (-948.618) [-941.716] -- 0:00:56
      125000 -- [-941.568] (-944.471) (-940.676) (-942.194) * [-941.693] (-948.233) (-943.729) (-942.436) -- 0:00:56

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-941.067) (-944.681) (-943.411) [-942.572] * (-941.615) [-940.607] (-942.361) (-944.109) -- 0:00:55
      126000 -- [-941.109] (-943.308) (-942.749) (-944.456) * [-945.022] (-941.567) (-944.143) (-944.523) -- 0:00:55
      126500 -- (-941.518) (-944.677) (-943.705) [-942.179] * (-943.292) [-940.357] (-943.722) (-944.172) -- 0:00:55
      127000 -- (-941.488) (-941.987) [-941.195] (-942.312) * (-941.664) [-941.127] (-941.698) (-941.202) -- 0:00:54
      127500 -- (-944.434) (-943.065) [-943.737] (-940.839) * [-941.858] (-944.659) (-941.594) (-941.275) -- 0:00:54
      128000 -- (-944.051) (-943.429) (-941.911) [-942.974] * [-941.787] (-941.429) (-947.864) (-942.451) -- 0:00:54
      128500 -- [-945.308] (-943.930) (-943.967) (-942.289) * (-943.214) [-943.197] (-943.914) (-945.732) -- 0:01:01
      129000 -- (-940.982) (-941.433) (-942.733) [-941.734] * (-942.634) (-943.567) (-944.487) [-941.723] -- 0:01:00
      129500 -- (-941.387) (-940.782) [-945.387] (-943.250) * (-941.326) (-941.440) (-941.549) [-943.237] -- 0:01:00
      130000 -- (-943.619) (-945.937) [-942.474] (-943.889) * [-941.320] (-941.440) (-942.803) (-941.309) -- 0:01:00

      Average standard deviation of split frequencies: 0.024684

      130500 -- [-946.951] (-943.700) (-941.316) (-941.467) * (-942.015) (-943.852) (-947.494) [-942.610] -- 0:00:59
      131000 -- (-942.535) (-942.251) (-941.638) [-942.500] * [-942.239] (-943.615) (-946.914) (-947.238) -- 0:00:59
      131500 -- (-941.517) (-944.135) [-943.675] (-941.931) * (-942.593) [-940.808] (-941.759) (-943.356) -- 0:00:59
      132000 -- (-942.148) (-941.651) (-942.087) [-941.553] * (-941.566) (-941.463) [-943.753] (-946.190) -- 0:00:59
      132500 -- (-948.250) (-943.058) [-944.913] (-943.170) * [-944.118] (-941.855) (-941.220) (-943.250) -- 0:00:58
      133000 -- (-945.004) [-941.843] (-947.307) (-941.925) * (-942.431) [-942.672] (-942.486) (-942.183) -- 0:00:58
      133500 -- [-949.900] (-941.124) (-946.825) (-940.592) * [-942.126] (-942.475) (-942.757) (-942.458) -- 0:00:58
      134000 -- (-945.960) (-943.615) [-940.009] (-945.400) * (-947.733) [-942.138] (-940.737) (-940.817) -- 0:00:58
      134500 -- (-954.038) (-946.943) [-943.458] (-943.275) * (-944.139) (-941.297) (-941.600) [-941.607] -- 0:00:57
      135000 -- (-946.302) (-943.462) (-941.722) [-943.421] * [-942.749] (-945.696) (-940.554) (-941.420) -- 0:00:57

      Average standard deviation of split frequencies: 0.023108

      135500 -- (-942.415) (-942.924) [-940.582] (-945.902) * (-941.688) (-943.561) (-940.763) [-940.659] -- 0:00:57
      136000 -- (-945.023) (-945.116) [-944.771] (-945.493) * (-945.633) (-942.958) (-940.374) [-942.285] -- 0:00:57
      136500 -- (-942.532) (-941.886) (-941.276) [-945.358] * (-940.652) [-942.511] (-941.743) (-941.505) -- 0:00:56
      137000 -- (-940.905) (-944.782) [-942.363] (-942.594) * (-942.981) (-944.073) [-940.666] (-941.564) -- 0:00:56
      137500 -- (-941.215) [-944.807] (-942.585) (-941.671) * (-943.031) [-940.881] (-941.061) (-941.809) -- 0:00:56
      138000 -- [-944.779] (-944.495) (-941.904) (-941.056) * [-941.074] (-942.828) (-942.381) (-943.801) -- 0:00:56
      138500 -- (-943.509) [-942.127] (-940.907) (-942.610) * (-941.246) [-943.598] (-941.779) (-940.790) -- 0:00:55
      139000 -- (-942.414) (-943.466) [-940.680] (-942.219) * (-940.124) (-941.326) (-940.658) [-940.261] -- 0:00:55
      139500 -- [-941.083] (-941.276) (-941.563) (-941.935) * [-940.116] (-942.650) (-941.137) (-941.990) -- 0:00:55
      140000 -- [-942.585] (-945.113) (-943.474) (-943.662) * (-942.646) [-942.047] (-943.407) (-942.149) -- 0:00:55

      Average standard deviation of split frequencies: 0.022900

      140500 -- (-941.555) [-942.450] (-942.545) (-945.864) * (-942.016) [-943.150] (-951.726) (-942.170) -- 0:00:55
      141000 -- (-947.626) [-941.410] (-941.932) (-942.822) * (-943.987) (-941.504) (-945.722) [-943.259] -- 0:00:54
      141500 -- (-944.673) [-942.048] (-940.932) (-940.729) * [-941.694] (-945.110) (-943.492) (-941.274) -- 0:00:54
      142000 -- [-943.256] (-941.104) (-942.703) (-941.277) * [-943.372] (-941.247) (-941.461) (-942.096) -- 0:00:54
      142500 -- (-945.215) (-942.564) (-940.649) [-940.613] * (-944.103) (-942.762) (-943.892) [-941.621] -- 0:00:54
      143000 -- (-942.839) [-941.069] (-942.522) (-941.241) * (-942.578) (-945.129) (-941.887) [-942.927] -- 0:00:53
      143500 -- (-947.448) [-940.662] (-945.302) (-940.949) * [-943.089] (-941.034) (-943.310) (-943.445) -- 0:00:53
      144000 -- (-944.838) (-941.092) (-944.077) [-940.631] * (-941.897) [-942.041] (-945.813) (-943.691) -- 0:00:59
      144500 -- (-942.897) (-944.902) (-943.022) [-941.432] * (-940.862) (-940.432) [-944.695] (-941.374) -- 0:00:59
      145000 -- (-945.950) (-944.529) (-947.097) [-941.318] * (-942.255) (-943.959) [-943.299] (-941.201) -- 0:00:58

      Average standard deviation of split frequencies: 0.022602

      145500 -- (-944.542) (-942.495) (-942.950) [-941.352] * (-940.694) (-944.795) [-942.041] (-941.886) -- 0:00:58
      146000 -- [-943.241] (-943.703) (-943.554) (-942.352) * [-940.779] (-940.442) (-940.858) (-943.122) -- 0:00:58
      146500 -- (-940.664) (-943.804) [-940.812] (-944.031) * [-941.479] (-940.664) (-940.388) (-946.281) -- 0:00:58
      147000 -- (-943.105) (-944.713) (-941.020) [-943.047] * [-942.086] (-940.645) (-941.288) (-942.587) -- 0:00:58
      147500 -- (-942.545) (-941.942) (-944.355) [-942.002] * (-941.900) [-944.986] (-941.392) (-944.513) -- 0:00:57
      148000 -- (-943.081) [-943.025] (-942.500) (-941.931) * [-944.078] (-945.036) (-940.544) (-950.499) -- 0:00:57
      148500 -- [-943.635] (-941.433) (-943.037) (-944.042) * (-940.823) [-941.478] (-940.840) (-946.191) -- 0:00:57
      149000 -- (-945.274) (-942.467) (-940.535) [-942.927] * (-941.137) [-941.999] (-940.662) (-940.879) -- 0:00:57
      149500 -- [-944.988] (-942.362) (-942.168) (-945.531) * (-945.214) (-943.867) [-943.244] (-943.139) -- 0:00:56
      150000 -- [-948.481] (-943.708) (-940.618) (-941.308) * (-943.051) (-941.732) [-942.053] (-940.132) -- 0:00:56

      Average standard deviation of split frequencies: 0.022560

      150500 -- [-944.494] (-941.944) (-940.936) (-941.635) * (-946.390) [-941.569] (-944.368) (-941.852) -- 0:00:56
      151000 -- [-944.076] (-942.764) (-941.953) (-941.959) * [-942.587] (-943.012) (-944.487) (-946.969) -- 0:00:56
      151500 -- (-942.442) (-943.287) [-945.039] (-943.060) * (-942.926) (-943.005) (-943.014) [-943.775] -- 0:00:56
      152000 -- (-943.677) [-943.444] (-942.722) (-941.452) * [-942.823] (-941.220) (-941.105) (-943.733) -- 0:00:55
      152500 -- (-944.098) (-942.431) (-944.474) [-941.772] * (-943.185) [-941.610] (-940.891) (-944.395) -- 0:00:55
      153000 -- (-944.255) (-942.813) (-944.547) [-941.798] * (-943.938) (-941.219) [-941.895] (-941.891) -- 0:00:55
      153500 -- [-943.357] (-946.012) (-943.026) (-941.401) * (-944.452) [-940.976] (-940.089) (-942.441) -- 0:00:55
      154000 -- (-943.179) [-942.763] (-944.860) (-943.833) * (-946.248) (-950.393) [-943.223] (-946.805) -- 0:00:54
      154500 -- (-942.827) (-940.913) (-944.506) [-941.589] * [-945.704] (-942.281) (-942.409) (-942.945) -- 0:00:54
      155000 -- [-941.031] (-942.019) (-941.256) (-943.521) * (-942.503) [-942.147] (-942.053) (-945.637) -- 0:00:54

      Average standard deviation of split frequencies: 0.021321

      155500 -- (-941.051) (-941.828) (-942.578) [-940.477] * (-942.027) (-941.704) [-941.812] (-946.310) -- 0:00:54
      156000 -- [-940.986] (-946.859) (-941.283) (-940.994) * (-944.133) [-942.265] (-943.408) (-943.895) -- 0:00:54
      156500 -- (-942.683) [-940.284] (-943.350) (-944.730) * (-942.895) (-944.270) [-943.993] (-942.109) -- 0:00:53
      157000 -- (-941.176) [-941.678] (-940.568) (-942.384) * (-945.380) [-944.957] (-940.540) (-942.042) -- 0:00:53
      157500 -- [-943.938] (-941.899) (-941.618) (-942.735) * [-944.625] (-945.895) (-943.528) (-941.702) -- 0:00:53
      158000 -- (-943.824) (-942.864) [-942.475] (-942.583) * (-943.660) (-941.592) [-942.382] (-943.409) -- 0:00:58
      158500 -- (-943.109) (-941.970) [-941.503] (-941.574) * (-943.741) (-943.622) [-943.511] (-941.349) -- 0:00:58
      159000 -- (-942.669) (-943.990) (-943.419) [-940.930] * (-949.185) (-941.782) [-948.507] (-944.424) -- 0:00:58
      159500 -- (-943.878) (-941.893) (-941.735) [-944.205] * (-944.019) (-942.221) [-941.967] (-941.051) -- 0:00:57
      160000 -- [-943.556] (-940.401) (-944.735) (-947.236) * [-944.471] (-941.326) (-945.290) (-941.467) -- 0:00:57

      Average standard deviation of split frequencies: 0.018122

      160500 -- (-945.515) [-940.997] (-944.483) (-942.099) * [-946.699] (-940.552) (-940.356) (-941.541) -- 0:00:57
      161000 -- (-944.440) (-940.268) [-943.594] (-945.436) * (-945.763) (-943.624) [-942.913] (-942.423) -- 0:00:57
      161500 -- (-944.560) (-940.551) (-945.392) [-942.836] * (-945.897) [-941.911] (-945.202) (-941.838) -- 0:00:57
      162000 -- (-941.880) [-943.210] (-941.751) (-940.786) * (-942.982) (-945.034) [-941.898] (-942.615) -- 0:00:56
      162500 -- [-944.281] (-941.768) (-942.925) (-942.872) * (-940.703) (-945.264) (-944.355) [-941.822] -- 0:00:56
      163000 -- (-941.664) [-945.525] (-942.749) (-943.220) * (-943.404) [-946.925] (-945.662) (-942.825) -- 0:00:56
      163500 -- (-942.884) (-940.632) [-942.347] (-947.697) * (-940.876) (-945.657) (-945.194) [-941.756] -- 0:00:56
      164000 -- (-944.043) (-941.376) (-945.052) [-942.310] * (-941.607) [-943.267] (-942.638) (-943.657) -- 0:00:56
      164500 -- (-944.994) (-940.688) [-943.691] (-941.683) * [-942.098] (-940.978) (-942.476) (-940.823) -- 0:00:55
      165000 -- (-940.979) (-941.849) [-942.163] (-941.677) * (-942.211) (-940.740) [-941.819] (-940.974) -- 0:00:55

      Average standard deviation of split frequencies: 0.019043

      165500 -- [-945.570] (-942.123) (-943.865) (-942.621) * (-942.569) [-940.618] (-941.508) (-940.584) -- 0:00:55
      166000 -- (-942.050) (-945.185) (-945.441) [-942.625] * (-942.661) (-941.487) (-946.131) [-940.011] -- 0:00:55
      166500 -- (-940.599) (-941.636) (-945.819) [-944.755] * (-942.941) (-942.412) (-941.030) [-941.554] -- 0:00:55
      167000 -- [-944.922] (-942.020) (-944.127) (-942.454) * (-944.076) (-943.389) (-941.753) [-940.726] -- 0:00:54
      167500 -- [-946.294] (-943.342) (-942.907) (-942.157) * (-941.436) [-940.938] (-943.738) (-941.356) -- 0:00:54
      168000 -- (-943.864) (-940.899) [-942.373] (-943.186) * (-942.207) [-940.938] (-944.258) (-944.065) -- 0:00:54
      168500 -- (-943.236) [-940.948] (-943.729) (-942.843) * (-943.764) [-944.712] (-943.368) (-944.404) -- 0:00:54
      169000 -- (-944.695) [-941.071] (-946.844) (-941.226) * (-945.321) (-943.825) [-944.048] (-942.443) -- 0:00:54
      169500 -- [-942.716] (-943.028) (-943.207) (-941.885) * (-941.811) (-942.515) [-940.919] (-942.962) -- 0:00:53
      170000 -- [-946.294] (-945.817) (-944.332) (-943.375) * (-940.538) (-941.103) (-941.476) [-946.354] -- 0:00:53

      Average standard deviation of split frequencies: 0.018414

      170500 -- (-944.281) [-941.233] (-946.068) (-941.277) * (-940.403) (-942.045) (-942.983) [-944.417] -- 0:00:53
      171000 -- (-941.158) (-943.369) (-941.558) [-942.721] * (-940.685) (-944.081) [-942.134] (-942.461) -- 0:00:58
      171500 -- (-942.172) (-940.541) [-941.759] (-942.261) * (-947.991) [-943.770] (-942.542) (-941.299) -- 0:00:57
      172000 -- (-942.284) [-942.663] (-942.788) (-942.891) * [-942.883] (-943.731) (-943.094) (-940.768) -- 0:00:57
      172500 -- (-941.204) (-942.748) [-944.559] (-941.902) * (-943.906) [-942.651] (-941.999) (-940.736) -- 0:00:57
      173000 -- (-942.849) [-941.075] (-943.413) (-944.812) * (-942.329) (-941.409) (-940.689) [-941.609] -- 0:00:57
      173500 -- (-946.494) [-940.879] (-940.288) (-944.491) * (-942.305) (-942.748) (-942.412) [-940.777] -- 0:00:57
      174000 -- (-942.693) [-943.570] (-940.676) (-940.304) * (-941.094) (-940.187) [-940.535] (-945.997) -- 0:00:56
      174500 -- [-944.752] (-940.088) (-940.999) (-943.619) * [-942.715] (-943.708) (-941.664) (-943.068) -- 0:00:56
      175000 -- (-945.300) [-943.873] (-941.013) (-941.051) * (-941.778) [-943.176] (-941.962) (-944.181) -- 0:00:56

      Average standard deviation of split frequencies: 0.018749

      175500 -- (-941.662) (-946.013) [-940.995] (-941.302) * (-941.171) (-944.388) [-941.743] (-942.536) -- 0:00:56
      176000 -- (-943.452) (-942.476) [-943.673] (-941.659) * [-942.588] (-940.737) (-942.139) (-941.333) -- 0:00:56
      176500 -- [-941.009] (-941.069) (-942.146) (-945.376) * (-940.300) (-941.909) (-942.086) [-940.715] -- 0:00:55
      177000 -- (-941.627) (-941.165) [-945.222] (-943.442) * (-940.504) (-942.448) [-943.425] (-945.623) -- 0:00:55
      177500 -- (-940.943) (-941.685) (-942.019) [-941.382] * (-947.730) [-939.992] (-943.744) (-942.659) -- 0:00:55
      178000 -- (-943.438) [-945.214] (-941.790) (-941.245) * (-946.215) (-948.159) (-944.344) [-943.278] -- 0:00:55
      178500 -- (-943.946) (-944.606) (-945.814) [-943.002] * [-944.838] (-944.329) (-944.031) (-941.698) -- 0:00:55
      179000 -- [-943.071] (-947.138) (-943.530) (-942.583) * (-943.750) (-943.259) [-941.495] (-942.865) -- 0:00:55
      179500 -- (-942.760) (-943.743) (-941.506) [-944.376] * [-941.778] (-946.300) (-944.236) (-943.416) -- 0:00:54
      180000 -- (-942.262) (-942.973) (-941.854) [-940.405] * (-942.712) (-941.615) (-945.117) [-941.147] -- 0:00:54

      Average standard deviation of split frequencies: 0.018120

      180500 -- (-941.962) (-940.857) [-940.731] (-940.893) * (-942.015) (-942.874) [-946.179] (-942.929) -- 0:00:54
      181000 -- (-943.848) (-940.960) (-942.902) [-944.420] * (-942.727) (-940.945) (-947.260) [-941.163] -- 0:00:54
      181500 -- (-942.008) (-941.484) (-944.019) [-941.273] * [-944.554] (-941.737) (-945.389) (-941.050) -- 0:00:54
      182000 -- (-943.117) [-941.562] (-941.543) (-941.259) * (-952.317) (-942.490) [-942.876] (-940.758) -- 0:00:53
      182500 -- (-944.135) (-941.596) (-948.721) [-941.308] * [-942.433] (-942.488) (-942.356) (-944.509) -- 0:00:53
      183000 -- (-945.557) [-941.695] (-941.029) (-942.047) * [-941.135] (-941.518) (-942.553) (-943.267) -- 0:00:53
      183500 -- (-947.702) [-947.723] (-942.187) (-947.006) * (-941.117) [-945.234] (-942.385) (-943.034) -- 0:00:53
      184000 -- (-942.669) [-940.723] (-941.366) (-940.516) * (-942.588) [-944.667] (-941.401) (-947.312) -- 0:00:53
      184500 -- (-946.980) [-948.392] (-941.374) (-940.299) * (-943.400) (-940.365) (-949.992) [-941.597] -- 0:00:53
      185000 -- [-943.137] (-942.889) (-945.182) (-943.915) * [-940.602] (-940.365) (-945.337) (-948.161) -- 0:00:52

      Average standard deviation of split frequencies: 0.019769

      185500 -- (-943.828) [-943.064] (-943.687) (-940.211) * [-942.408] (-940.365) (-940.306) (-944.637) -- 0:00:52
      186000 -- (-944.901) (-944.265) [-942.781] (-940.155) * [-945.661] (-941.347) (-943.234) (-943.052) -- 0:00:52
      186500 -- [-942.743] (-945.648) (-943.258) (-940.083) * [-945.853] (-942.551) (-943.299) (-942.584) -- 0:00:56
      187000 -- (-942.276) [-944.380] (-945.521) (-941.290) * [-942.268] (-942.075) (-941.946) (-941.562) -- 0:00:56
      187500 -- (-941.138) (-945.014) [-940.447] (-943.346) * (-941.021) [-942.697] (-944.135) (-944.026) -- 0:00:56
      188000 -- (-943.658) (-943.969) (-941.227) [-942.525] * (-941.839) (-940.380) (-944.276) [-941.559] -- 0:00:56
      188500 -- (-944.589) [-942.828] (-941.805) (-940.750) * (-943.646) [-940.379] (-942.002) (-940.374) -- 0:00:55
      189000 -- (-942.396) (-940.980) (-942.036) [-942.832] * (-945.649) (-946.917) (-943.055) [-941.145] -- 0:00:55
      189500 -- (-941.172) (-942.793) [-945.817] (-940.701) * (-941.710) (-943.778) (-944.324) [-943.480] -- 0:00:55
      190000 -- (-942.609) (-944.220) (-940.749) [-940.763] * (-942.447) (-946.257) (-944.237) [-940.747] -- 0:00:55

      Average standard deviation of split frequencies: 0.018738

      190500 -- (-944.317) [-942.180] (-941.721) (-942.632) * (-945.886) (-943.041) [-942.222] (-940.472) -- 0:00:55
      191000 -- [-943.369] (-940.959) (-941.681) (-949.044) * (-940.957) [-942.861] (-943.347) (-941.677) -- 0:00:55
      191500 -- (-941.897) (-941.400) [-940.671] (-947.148) * [-943.953] (-941.321) (-949.531) (-941.002) -- 0:00:54
      192000 -- (-940.293) (-940.715) [-940.618] (-941.224) * [-942.354] (-943.863) (-943.611) (-943.069) -- 0:00:54
      192500 -- (-941.640) (-942.094) (-941.423) [-941.112] * (-950.287) (-942.880) (-940.691) [-947.110] -- 0:00:54
      193000 -- (-944.016) (-942.908) (-942.196) [-943.059] * (-946.006) [-941.005] (-942.015) (-944.755) -- 0:00:54
      193500 -- (-941.273) [-941.388] (-942.022) (-942.184) * (-943.377) (-942.123) [-942.775] (-941.570) -- 0:00:54
      194000 -- (-941.646) (-941.889) (-942.202) [-940.961] * (-940.523) [-940.552] (-941.667) (-947.280) -- 0:00:54
      194500 -- (-941.100) (-941.556) (-942.261) [-941.316] * [-941.428] (-942.370) (-941.967) (-945.064) -- 0:00:53
      195000 -- (-941.838) [-941.564] (-942.884) (-945.449) * (-947.028) (-942.116) [-941.966] (-944.226) -- 0:00:53

      Average standard deviation of split frequencies: 0.017402

      195500 -- (-942.424) (-945.971) [-943.176] (-942.645) * (-945.975) [-945.688] (-945.116) (-943.764) -- 0:00:53
      196000 -- (-941.498) (-941.755) [-943.201] (-942.531) * (-950.758) [-942.982] (-942.117) (-945.519) -- 0:00:53
      196500 -- (-942.458) (-942.609) (-948.635) [-940.265] * [-941.378] (-945.406) (-941.936) (-944.166) -- 0:00:53
      197000 -- (-942.994) (-945.323) (-947.888) [-945.407] * (-941.865) (-942.242) (-941.566) [-943.180] -- 0:00:52
      197500 -- (-942.768) [-942.783] (-943.134) (-941.073) * (-943.993) (-942.587) [-947.204] (-943.221) -- 0:00:52
      198000 -- (-942.483) (-942.051) (-942.088) [-941.073] * (-941.845) (-943.607) (-944.831) [-941.847] -- 0:00:52
      198500 -- (-943.389) [-941.703] (-942.119) (-941.475) * (-941.940) (-943.323) [-947.640] (-941.586) -- 0:00:52
      199000 -- (-943.838) [-940.760] (-942.634) (-940.379) * (-942.401) (-943.908) [-942.047] (-941.600) -- 0:00:52
      199500 -- (-944.815) [-942.983] (-942.865) (-940.400) * (-941.972) (-942.368) [-947.015] (-940.984) -- 0:00:52
      200000 -- (-946.866) (-942.251) (-945.630) [-943.721] * (-941.590) [-940.399] (-944.456) (-941.034) -- 0:00:51

      Average standard deviation of split frequencies: 0.015477

      200500 -- (-942.754) (-943.957) [-944.957] (-942.233) * (-940.951) [-942.087] (-942.018) (-941.044) -- 0:00:55
      201000 -- (-945.326) (-943.657) [-941.050] (-940.466) * (-940.930) (-943.517) [-942.448] (-941.407) -- 0:00:55
      201500 -- [-941.413] (-943.701) (-941.131) (-941.755) * (-941.044) [-943.664] (-941.253) (-940.273) -- 0:00:55
      202000 -- (-942.134) (-941.967) (-943.922) [-941.793] * (-941.972) (-946.070) (-943.444) [-940.280] -- 0:00:55
      202500 -- (-941.766) (-942.440) [-943.242] (-942.508) * [-940.441] (-944.024) (-941.591) (-940.337) -- 0:00:55
      203000 -- (-945.664) (-945.663) (-941.004) [-940.606] * [-940.768] (-942.831) (-942.333) (-941.498) -- 0:00:54
      203500 -- (-942.586) (-942.320) (-941.092) [-941.820] * (-946.341) [-941.307] (-943.338) (-945.358) -- 0:00:54
      204000 -- [-943.358] (-942.433) (-945.731) (-946.730) * (-942.215) [-941.564] (-943.133) (-941.065) -- 0:00:54
      204500 -- (-942.116) [-941.284] (-944.344) (-943.464) * [-940.906] (-942.040) (-943.254) (-944.137) -- 0:00:54
      205000 -- (-940.897) (-940.655) (-945.989) [-943.006] * (-940.928) [-942.580] (-940.875) (-941.711) -- 0:00:54

      Average standard deviation of split frequencies: 0.017095

      205500 -- (-941.468) (-943.001) [-942.280] (-944.462) * (-941.177) (-943.718) (-940.800) [-942.564] -- 0:00:54
      206000 -- (-943.567) [-941.416] (-941.951) (-946.005) * (-941.448) (-940.634) (-942.563) [-941.036] -- 0:00:53
      206500 -- (-946.640) (-941.595) [-942.773] (-942.508) * (-940.420) (-945.869) (-940.918) [-941.369] -- 0:00:53
      207000 -- (-946.674) (-944.649) [-943.824] (-943.409) * [-942.503] (-942.962) (-941.292) (-950.532) -- 0:00:53
      207500 -- (-943.304) (-944.898) [-946.971] (-943.174) * [-942.032] (-944.476) (-942.416) (-941.088) -- 0:00:53
      208000 -- [-942.583] (-941.499) (-944.157) (-945.580) * [-942.881] (-950.912) (-941.317) (-943.452) -- 0:00:53
      208500 -- (-940.731) [-944.274] (-942.103) (-941.761) * (-944.003) (-949.917) (-945.054) [-943.715] -- 0:00:53
      209000 -- (-940.604) [-941.777] (-941.500) (-942.421) * [-940.942] (-944.169) (-943.270) (-942.965) -- 0:00:52
      209500 -- (-943.477) (-943.799) (-941.749) [-943.287] * (-940.822) (-945.119) [-941.640] (-945.624) -- 0:00:52
      210000 -- [-942.924] (-942.606) (-942.570) (-943.370) * (-941.094) (-944.812) (-941.386) [-941.633] -- 0:00:52

      Average standard deviation of split frequencies: 0.016585

      210500 -- (-941.169) (-944.717) (-941.452) [-945.597] * [-941.036] (-947.246) (-941.756) (-942.893) -- 0:00:52
      211000 -- (-944.601) (-942.604) [-941.064] (-941.615) * (-940.930) (-947.966) [-941.137] (-940.219) -- 0:00:52
      211500 -- (-942.877) (-943.432) [-942.285] (-943.677) * [-941.667] (-941.678) (-943.767) (-941.793) -- 0:00:52
      212000 -- (-942.507) [-941.548] (-940.918) (-943.683) * [-943.861] (-941.471) (-944.874) (-944.541) -- 0:00:52
      212500 -- (-941.362) [-940.800] (-940.552) (-940.755) * [-943.044] (-944.918) (-942.413) (-945.459) -- 0:00:51
      213000 -- (-942.215) (-943.545) [-942.557] (-941.767) * (-943.197) [-942.806] (-943.195) (-943.249) -- 0:00:51
      213500 -- [-940.953] (-941.819) (-942.326) (-943.727) * [-941.070] (-941.434) (-943.284) (-942.968) -- 0:00:51
      214000 -- (-941.623) [-941.602] (-940.328) (-943.979) * [-942.871] (-941.654) (-944.229) (-942.962) -- 0:00:51
      214500 -- [-941.379] (-942.405) (-944.111) (-940.647) * (-943.009) (-941.482) (-943.061) [-943.169] -- 0:00:51
      215000 -- (-941.972) (-946.385) (-944.845) [-941.976] * (-942.622) [-941.364] (-942.864) (-942.030) -- 0:00:51

      Average standard deviation of split frequencies: 0.016304

      215500 -- (-942.001) [-943.338] (-941.991) (-943.839) * (-941.044) (-942.854) [-942.899] (-942.507) -- 0:00:54
      216000 -- [-941.778] (-943.745) (-941.329) (-949.549) * (-942.172) [-942.729] (-948.205) (-943.449) -- 0:00:54
      216500 -- (-942.136) [-943.140] (-939.993) (-945.702) * [-940.762] (-940.090) (-940.975) (-942.991) -- 0:00:54
      217000 -- (-943.560) [-943.046] (-943.019) (-944.539) * (-945.534) [-941.162] (-941.651) (-943.121) -- 0:00:54
      217500 -- (-943.223) [-942.402] (-943.351) (-942.906) * (-942.027) (-943.705) [-942.491] (-942.595) -- 0:00:53
      218000 -- (-943.992) [-943.944] (-944.677) (-944.861) * (-940.951) (-941.131) (-941.391) [-941.981] -- 0:00:53
      218500 -- (-944.113) (-945.002) (-945.794) [-945.522] * [-943.169] (-940.861) (-943.154) (-942.375) -- 0:00:53
      219000 -- (-945.144) (-944.549) [-945.693] (-941.501) * [-943.631] (-943.068) (-945.621) (-944.374) -- 0:00:53
      219500 -- [-941.519] (-940.834) (-943.301) (-940.359) * (-945.837) (-942.034) [-941.676] (-942.651) -- 0:00:53
      220000 -- (-944.366) (-941.465) [-942.215] (-942.074) * (-941.494) [-943.186] (-940.799) (-943.316) -- 0:00:53

      Average standard deviation of split frequencies: 0.015582

      220500 -- (-941.060) (-940.444) [-940.539] (-941.230) * [-940.667] (-942.823) (-940.136) (-943.316) -- 0:00:53
      221000 -- (-941.349) [-942.175] (-940.208) (-944.184) * [-941.426] (-942.068) (-940.350) (-942.096) -- 0:00:52
      221500 -- (-942.590) (-944.252) [-942.825] (-943.511) * (-941.288) (-940.710) [-943.434] (-942.373) -- 0:00:52
      222000 -- (-944.449) (-941.610) (-944.259) [-942.767] * (-942.567) (-942.175) (-943.448) [-940.618] -- 0:00:52
      222500 -- [-944.845] (-943.283) (-940.894) (-943.666) * (-940.880) (-942.352) [-940.668] (-941.360) -- 0:00:52
      223000 -- (-941.001) (-941.913) [-942.001] (-943.865) * (-940.065) (-946.225) [-940.720] (-942.143) -- 0:00:52
      223500 -- [-942.456] (-941.791) (-941.796) (-943.832) * [-940.098] (-944.301) (-943.004) (-942.879) -- 0:00:52
      224000 -- (-943.343) (-944.117) [-940.696] (-943.417) * (-943.662) (-942.780) (-941.157) [-942.209] -- 0:00:51
      224500 -- (-943.562) [-940.824] (-940.186) (-942.913) * (-941.025) [-942.944] (-941.754) (-940.870) -- 0:00:51
      225000 -- [-944.401] (-941.993) (-942.486) (-945.826) * (-941.021) [-941.782] (-941.473) (-941.137) -- 0:00:51

      Average standard deviation of split frequencies: 0.015828

      225500 -- [-945.625] (-941.725) (-945.051) (-942.736) * (-944.297) (-941.639) (-942.398) [-941.259] -- 0:00:51
      226000 -- [-941.799] (-943.450) (-941.829) (-941.851) * (-946.146) [-940.815] (-945.777) (-941.311) -- 0:00:51
      226500 -- [-942.072] (-944.150) (-943.286) (-940.081) * (-947.017) (-941.982) [-942.147] (-941.355) -- 0:00:51
      227000 -- (-942.321) (-940.807) [-943.562] (-940.496) * (-944.244) (-942.442) [-941.604] (-942.919) -- 0:00:51
      227500 -- (-942.736) [-943.440] (-942.767) (-940.455) * [-942.423] (-947.998) (-941.901) (-941.278) -- 0:00:50
      228000 -- (-941.427) (-944.163) (-941.820) [-944.194] * (-940.869) (-943.107) (-941.999) [-939.950] -- 0:00:50
      228500 -- [-943.027] (-942.845) (-942.349) (-942.545) * [-940.971] (-942.321) (-945.811) (-940.876) -- 0:00:50
      229000 -- (-942.409) (-940.564) (-943.074) [-942.449] * [-940.861] (-943.024) (-941.050) (-939.995) -- 0:00:50
      229500 -- (-945.201) [-940.743] (-945.653) (-943.349) * (-942.746) (-947.039) (-942.299) [-940.428] -- 0:00:50
      230000 -- [-943.817] (-941.316) (-946.455) (-941.048) * (-941.794) (-945.407) (-942.382) [-940.437] -- 0:00:50

      Average standard deviation of split frequencies: 0.016236

      230500 -- (-941.515) (-944.488) (-944.378) [-941.413] * (-945.693) [-949.498] (-942.842) (-940.824) -- 0:00:50
      231000 -- (-942.343) (-941.408) (-942.323) [-940.485] * (-943.258) [-942.580] (-940.959) (-942.313) -- 0:00:49
      231500 -- [-941.435] (-943.373) (-942.686) (-941.831) * [-942.277] (-943.190) (-942.050) (-940.975) -- 0:00:53
      232000 -- (-941.795) (-945.635) (-941.258) [-941.066] * (-942.533) [-943.039] (-944.465) (-945.305) -- 0:00:52
      232500 -- (-940.222) (-942.998) [-940.818] (-943.923) * (-940.573) (-944.784) (-947.942) [-941.048] -- 0:00:52
      233000 -- (-943.212) (-943.655) (-942.979) [-948.427] * [-942.388] (-942.553) (-944.384) (-942.196) -- 0:00:52
      233500 -- (-943.440) (-940.757) [-942.144] (-944.507) * [-940.938] (-941.552) (-943.500) (-941.607) -- 0:00:52
      234000 -- (-942.261) (-945.715) (-942.321) [-947.797] * (-941.068) [-942.134] (-944.478) (-941.785) -- 0:00:52
      234500 -- (-944.308) [-941.902] (-946.163) (-941.460) * (-941.720) (-940.469) [-940.948] (-942.540) -- 0:00:52
      235000 -- (-942.524) [-941.563] (-941.207) (-941.919) * (-940.914) (-940.530) [-942.045] (-942.302) -- 0:00:52

      Average standard deviation of split frequencies: 0.017037

      235500 -- (-943.003) (-940.948) [-940.540] (-946.719) * [-941.012] (-945.570) (-945.252) (-942.291) -- 0:00:51
      236000 -- (-941.583) (-940.833) (-943.582) [-943.644] * (-941.849) (-941.228) (-944.712) [-941.300] -- 0:00:51
      236500 -- (-943.900) (-942.677) (-949.073) [-940.916] * (-941.659) [-941.757] (-944.153) (-940.591) -- 0:00:51
      237000 -- (-942.589) (-943.920) (-942.256) [-940.985] * (-941.656) (-944.817) [-942.789] (-940.498) -- 0:00:51
      237500 -- [-941.168] (-942.913) (-941.400) (-944.609) * [-946.293] (-943.400) (-943.766) (-943.837) -- 0:00:51
      238000 -- (-941.860) [-945.277] (-941.518) (-944.128) * (-940.593) (-941.758) [-945.362] (-943.285) -- 0:00:51
      238500 -- (-942.775) (-945.576) (-941.643) [-942.000] * (-942.268) [-942.170] (-942.307) (-942.962) -- 0:00:51
      239000 -- (-941.868) [-942.186] (-946.609) (-941.862) * (-941.167) (-943.620) (-941.300) [-942.873] -- 0:00:50
      239500 -- [-941.282] (-943.287) (-943.121) (-945.499) * (-942.030) (-942.329) [-943.043] (-943.447) -- 0:00:50
      240000 -- [-945.425] (-941.631) (-942.273) (-947.084) * [-941.592] (-941.429) (-941.623) (-943.163) -- 0:00:50

      Average standard deviation of split frequencies: 0.015440

      240500 -- (-942.853) (-944.928) [-943.403] (-944.750) * (-943.052) (-945.114) (-941.630) [-940.574] -- 0:00:50
      241000 -- (-942.687) [-940.957] (-942.640) (-942.738) * [-943.451] (-945.220) (-941.609) (-942.040) -- 0:00:50
      241500 -- [-942.555] (-942.708) (-941.911) (-943.317) * [-941.395] (-941.488) (-942.317) (-943.383) -- 0:00:50
      242000 -- (-940.145) [-941.174] (-946.636) (-944.334) * (-941.325) [-943.317] (-944.998) (-944.442) -- 0:00:50
      242500 -- (-941.446) (-940.982) [-942.898] (-940.793) * [-940.883] (-943.025) (-942.646) (-945.552) -- 0:00:49
      243000 -- (-940.564) [-942.311] (-943.271) (-942.269) * (-941.737) (-943.324) [-942.550] (-943.305) -- 0:00:49
      243500 -- [-942.560] (-940.745) (-944.071) (-942.302) * (-943.229) (-941.405) [-941.213] (-942.995) -- 0:00:49
      244000 -- (-942.596) (-942.916) (-946.584) [-942.209] * (-945.845) (-940.610) [-941.377] (-943.689) -- 0:00:52
      244500 -- [-941.881] (-942.937) (-942.377) (-941.793) * (-942.331) (-941.462) [-941.261] (-940.989) -- 0:00:52
      245000 -- (-942.051) (-943.902) [-941.029] (-942.274) * [-945.027] (-941.867) (-943.201) (-941.427) -- 0:00:52

      Average standard deviation of split frequencies: 0.013527

      245500 -- (-941.493) [-942.449] (-940.842) (-940.394) * (-948.204) (-942.110) [-947.686] (-940.763) -- 0:00:52
      246000 -- [-942.794] (-946.473) (-942.029) (-940.109) * [-941.269] (-945.399) (-941.714) (-947.890) -- 0:00:52
      246500 -- [-941.542] (-941.265) (-942.888) (-940.865) * (-942.366) [-941.830] (-940.276) (-947.347) -- 0:00:51
      247000 -- (-942.481) (-943.869) [-942.801] (-940.477) * (-944.342) (-941.394) (-941.055) [-944.805] -- 0:00:51
      247500 -- (-941.562) (-941.576) (-941.929) [-941.420] * (-945.000) (-944.756) (-946.233) [-942.614] -- 0:00:51
      248000 -- (-940.014) (-941.394) (-942.313) [-941.077] * (-945.553) (-941.452) (-944.824) [-942.457] -- 0:00:51
      248500 -- (-943.391) (-942.707) [-942.614] (-941.112) * (-946.295) (-943.223) [-940.740] (-944.403) -- 0:00:51
      249000 -- (-940.430) (-942.257) [-941.817] (-945.382) * (-941.557) (-942.350) (-941.913) [-942.470] -- 0:00:51
      249500 -- (-943.631) (-942.613) (-946.069) [-940.692] * [-943.910] (-942.887) (-941.017) (-942.325) -- 0:00:51
      250000 -- (-941.051) (-942.375) [-943.567] (-944.479) * (-943.659) [-941.378] (-943.717) (-941.341) -- 0:00:51

      Average standard deviation of split frequencies: 0.013517

      250500 -- [-943.742] (-944.068) (-941.392) (-940.830) * (-950.070) [-943.342] (-941.871) (-946.685) -- 0:00:50
      251000 -- (-943.216) (-942.882) (-942.810) [-940.827] * (-945.007) [-945.191] (-950.886) (-943.755) -- 0:00:50
      251500 -- (-944.316) [-941.312] (-942.963) (-940.705) * [-941.195] (-945.271) (-950.661) (-940.582) -- 0:00:50
      252000 -- [-944.017] (-941.648) (-941.054) (-941.932) * (-941.965) (-944.343) [-940.198] (-943.563) -- 0:00:50
      252500 -- (-948.618) [-942.547] (-943.082) (-942.597) * (-941.478) (-942.443) [-942.172] (-945.571) -- 0:00:50
      253000 -- (-942.759) [-942.331] (-941.433) (-945.651) * (-947.396) [-940.157] (-942.522) (-942.807) -- 0:00:50
      253500 -- [-945.620] (-941.568) (-944.907) (-943.302) * [-941.812] (-943.836) (-945.864) (-942.329) -- 0:00:50
      254000 -- [-941.410] (-943.229) (-953.035) (-940.948) * (-943.896) (-940.260) (-940.142) [-941.149] -- 0:00:49
      254500 -- (-941.458) (-942.395) (-942.475) [-941.593] * (-940.898) (-942.881) (-942.233) [-941.243] -- 0:00:49
      255000 -- (-940.755) [-944.769] (-942.599) (-941.299) * [-941.920] (-944.422) (-940.666) (-943.010) -- 0:00:49

      Average standard deviation of split frequencies: 0.012084

      255500 -- (-940.347) (-941.503) [-941.787] (-942.657) * (-942.059) (-944.875) [-940.428] (-941.127) -- 0:00:49
      256000 -- (-941.343) (-951.473) [-941.145] (-941.233) * [-942.074] (-944.976) (-940.233) (-940.653) -- 0:00:49
      256500 -- (-940.915) (-948.874) (-946.575) [-941.560] * (-948.088) (-943.355) (-943.876) [-940.642] -- 0:00:52
      257000 -- [-942.397] (-944.277) (-941.574) (-941.650) * [-941.495] (-942.268) (-942.034) (-941.949) -- 0:00:52
      257500 -- (-941.651) (-943.322) (-942.977) [-940.520] * [-941.931] (-942.135) (-943.043) (-942.061) -- 0:00:51
      258000 -- (-941.613) [-941.498] (-944.483) (-943.201) * [-941.032] (-941.370) (-946.733) (-941.920) -- 0:00:51
      258500 -- [-942.052] (-941.515) (-941.733) (-940.886) * [-943.712] (-941.527) (-942.670) (-941.138) -- 0:00:51
      259000 -- (-941.010) (-941.300) [-941.572] (-950.214) * [-943.482] (-942.879) (-946.842) (-942.508) -- 0:00:51
      259500 -- (-940.432) [-941.440] (-941.298) (-949.045) * [-941.614] (-941.334) (-943.849) (-942.717) -- 0:00:51
      260000 -- (-941.114) (-942.271) [-941.313] (-945.328) * [-940.954] (-944.591) (-943.004) (-945.561) -- 0:00:51

      Average standard deviation of split frequencies: 0.011981

      260500 -- [-944.841] (-940.780) (-940.810) (-944.552) * (-942.735) (-941.988) (-941.529) [-941.230] -- 0:00:51
      261000 -- (-946.387) (-941.402) [-941.614] (-941.406) * (-944.629) (-940.558) (-941.890) [-940.667] -- 0:00:50
      261500 -- (-943.689) (-943.413) (-942.488) [-943.661] * (-945.174) (-940.504) [-941.779] (-940.844) -- 0:00:50
      262000 -- (-941.700) (-943.247) (-941.716) [-942.871] * [-943.954] (-943.186) (-941.625) (-940.953) -- 0:00:50
      262500 -- (-943.254) (-943.381) (-940.367) [-944.020] * (-948.767) (-948.598) [-943.449] (-941.835) -- 0:00:50
      263000 -- (-942.565) [-940.772] (-946.261) (-940.244) * (-945.048) (-941.090) [-941.350] (-940.704) -- 0:00:50
      263500 -- (-945.862) (-943.372) [-945.798] (-939.850) * (-944.797) (-942.367) [-942.369] (-942.624) -- 0:00:50
      264000 -- (-944.141) (-943.625) (-941.363) [-941.325] * [-943.039] (-940.945) (-941.685) (-945.003) -- 0:00:50
      264500 -- (-941.985) (-942.661) (-941.625) [-940.982] * [-943.394] (-941.045) (-941.099) (-946.077) -- 0:00:50
      265000 -- (-942.792) (-942.992) [-941.932] (-943.064) * [-942.552] (-943.243) (-942.460) (-940.891) -- 0:00:49

      Average standard deviation of split frequencies: 0.012093

      265500 -- (-944.223) (-944.276) [-942.166] (-942.010) * (-941.492) [-944.665] (-942.647) (-941.988) -- 0:00:49
      266000 -- (-942.592) (-941.428) (-941.837) [-941.191] * (-939.961) (-944.364) [-942.085] (-942.914) -- 0:00:49
      266500 -- (-942.051) (-942.218) (-941.211) [-944.813] * (-943.130) (-946.465) (-943.214) [-942.856] -- 0:00:49
      267000 -- (-942.867) [-942.411] (-940.940) (-946.346) * (-944.398) (-943.261) (-940.657) [-940.432] -- 0:00:49
      267500 -- (-940.886) (-940.954) (-946.966) [-943.557] * (-943.341) (-942.510) [-940.355] (-941.110) -- 0:00:49
      268000 -- (-945.476) (-941.941) (-942.266) [-944.074] * [-941.521] (-941.296) (-940.857) (-944.931) -- 0:00:49
      268500 -- (-942.099) (-944.484) (-942.562) [-940.636] * (-943.161) (-943.832) (-944.010) [-944.721] -- 0:00:49
      269000 -- (-943.597) [-941.021] (-941.599) (-941.199) * (-942.658) [-944.220] (-942.362) (-941.586) -- 0:00:48
      269500 -- (-941.168) [-947.185] (-942.953) (-941.804) * (-941.826) (-943.191) (-945.016) [-943.527] -- 0:00:51
      270000 -- (-941.612) [-942.443] (-944.205) (-942.038) * (-940.526) (-942.764) (-944.022) [-943.876] -- 0:00:51

      Average standard deviation of split frequencies: 0.011987

      270500 -- (-945.951) [-941.149] (-947.098) (-942.038) * (-942.438) (-940.532) (-944.227) [-941.889] -- 0:00:51
      271000 -- (-942.616) (-941.140) (-943.771) [-941.506] * (-943.490) (-940.443) [-941.913] (-943.053) -- 0:00:51
      271500 -- [-942.360] (-942.798) (-941.417) (-944.273) * (-943.102) [-944.761] (-942.594) (-942.406) -- 0:00:50
      272000 -- (-941.944) [-944.400] (-940.905) (-948.221) * (-942.713) (-942.208) [-943.582] (-943.971) -- 0:00:50
      272500 -- (-941.880) [-943.900] (-942.157) (-943.763) * (-941.419) [-943.660] (-940.756) (-941.876) -- 0:00:50
      273000 -- (-942.715) [-942.042] (-941.321) (-946.757) * (-942.042) (-944.365) (-940.886) [-942.361] -- 0:00:50
      273500 -- (-942.847) (-944.428) [-944.924] (-944.685) * (-943.158) (-946.285) [-942.004] (-941.732) -- 0:00:50
      274000 -- (-943.189) (-942.448) [-942.556] (-945.134) * (-945.822) [-942.353] (-942.618) (-945.684) -- 0:00:50
      274500 -- (-940.736) (-942.315) [-941.626] (-944.390) * [-942.055] (-945.104) (-942.027) (-941.524) -- 0:00:50
      275000 -- (-944.076) (-944.591) [-941.587] (-945.415) * (-942.358) (-941.819) (-942.157) [-941.094] -- 0:00:50

      Average standard deviation of split frequencies: 0.012358

      275500 -- (-940.611) (-942.496) [-942.200] (-942.675) * [-944.541] (-944.879) (-942.228) (-941.635) -- 0:00:49
      276000 -- (-944.135) (-943.028) [-942.431] (-942.167) * [-940.194] (-945.845) (-942.998) (-943.851) -- 0:00:49
      276500 -- (-940.903) [-943.026] (-942.618) (-942.570) * (-942.491) (-944.417) (-946.111) [-940.939] -- 0:00:49
      277000 -- (-945.044) [-941.750] (-942.456) (-942.913) * (-942.721) [-944.509] (-942.243) (-941.192) -- 0:00:49
      277500 -- [-942.537] (-941.928) (-942.822) (-943.416) * (-943.084) (-944.049) (-943.354) [-941.162] -- 0:00:49
      278000 -- (-942.549) [-939.994] (-949.262) (-941.999) * [-946.144] (-941.111) (-943.469) (-941.960) -- 0:00:49
      278500 -- (-948.172) (-939.991) (-946.961) [-944.620] * (-943.293) (-949.861) (-946.570) [-941.737] -- 0:00:49
      279000 -- [-947.785] (-943.871) (-943.904) (-941.696) * (-941.957) (-949.032) [-942.397] (-941.087) -- 0:00:49
      279500 -- (-941.323) (-941.937) (-946.299) [-941.158] * (-941.509) (-947.798) (-944.558) [-940.419] -- 0:00:48
      280000 -- (-941.044) (-941.356) (-942.079) [-941.260] * (-942.952) (-942.207) [-941.839] (-943.693) -- 0:00:48

      Average standard deviation of split frequencies: 0.012251

      280500 -- (-942.950) [-940.684] (-941.779) (-942.047) * [-940.951] (-943.257) (-941.610) (-941.954) -- 0:00:48
      281000 -- (-943.901) (-944.017) [-940.415] (-942.162) * (-942.044) (-942.848) (-940.782) [-944.144] -- 0:00:48
      281500 -- (-941.451) [-943.044] (-942.469) (-941.663) * (-944.544) (-942.529) [-940.899] (-941.860) -- 0:00:48
      282000 -- (-943.885) (-943.009) (-941.898) [-941.321] * (-940.406) (-941.652) [-941.561] (-941.548) -- 0:00:48
      282500 -- (-941.237) (-940.114) [-940.741] (-942.270) * (-943.325) (-940.744) [-942.395] (-941.983) -- 0:00:48
      283000 -- (-943.257) (-941.318) [-944.928] (-947.182) * (-942.116) (-940.941) (-940.855) [-941.912] -- 0:00:48
      283500 -- (-941.989) (-944.436) [-943.519] (-942.141) * (-940.797) (-942.016) (-942.735) [-942.366] -- 0:00:48
      284000 -- [-941.956] (-941.385) (-946.551) (-943.403) * (-940.173) (-940.922) (-941.507) [-943.414] -- 0:00:47
      284500 -- (-941.641) [-940.982] (-945.646) (-941.580) * (-941.669) (-941.438) [-940.337] (-944.351) -- 0:00:47
      285000 -- (-941.150) (-942.825) (-943.040) [-941.248] * [-941.443] (-942.302) (-941.060) (-940.384) -- 0:00:47

      Average standard deviation of split frequencies: 0.011629

      285500 -- (-942.534) (-943.814) [-944.084] (-940.730) * (-941.481) (-945.653) (-941.656) [-939.994] -- 0:00:50
      286000 -- (-942.937) [-942.392] (-945.359) (-941.144) * (-943.140) (-950.140) (-943.875) [-940.211] -- 0:00:49
      286500 -- (-945.023) (-942.184) [-946.972] (-941.647) * (-941.184) [-945.168] (-951.492) (-940.124) -- 0:00:49
      287000 -- (-944.860) (-942.425) (-946.390) [-940.416] * [-941.629] (-944.571) (-943.049) (-947.394) -- 0:00:49
      287500 -- [-943.267] (-942.691) (-943.463) (-941.145) * (-941.448) (-941.357) (-941.797) [-941.438] -- 0:00:49
      288000 -- (-945.846) (-942.691) [-944.000] (-942.441) * (-941.952) (-941.166) (-944.532) [-942.466] -- 0:00:49
      288500 -- (-945.224) (-942.477) [-943.266] (-941.008) * (-942.759) (-943.370) [-943.205] (-942.712) -- 0:00:49
      289000 -- (-946.289) (-944.312) [-943.159] (-945.077) * (-941.227) (-944.638) (-943.017) [-942.845] -- 0:00:49
      289500 -- (-941.745) (-942.595) [-942.954] (-943.807) * (-943.690) (-942.526) (-945.673) [-940.678] -- 0:00:49
      290000 -- (-941.123) (-944.969) (-947.408) [-940.641] * (-945.500) (-941.505) [-940.780] (-942.227) -- 0:00:48

      Average standard deviation of split frequencies: 0.011713

      290500 -- (-942.956) [-943.665] (-944.885) (-941.766) * (-945.533) [-941.665] (-944.550) (-941.465) -- 0:00:48
      291000 -- (-941.306) (-944.893) [-940.171] (-945.122) * (-947.022) (-944.910) [-941.445] (-941.465) -- 0:00:48
      291500 -- (-941.499) [-946.244] (-941.676) (-944.523) * (-943.509) [-941.382] (-940.707) (-941.870) -- 0:00:48
      292000 -- [-940.458] (-948.231) (-940.956) (-945.415) * (-944.261) [-942.250] (-941.856) (-945.472) -- 0:00:48
      292500 -- (-941.309) (-949.852) (-940.302) [-946.564] * (-940.991) [-941.488] (-942.610) (-941.409) -- 0:00:48
      293000 -- (-941.268) (-943.092) [-940.403] (-948.107) * (-940.209) (-946.473) [-940.123] (-942.169) -- 0:00:48
      293500 -- (-941.771) (-942.497) [-941.779] (-945.895) * (-940.929) [-940.612] (-940.861) (-943.522) -- 0:00:48
      294000 -- (-941.015) [-941.060] (-942.414) (-944.184) * [-941.631] (-941.496) (-940.627) (-941.734) -- 0:00:48
      294500 -- (-940.885) (-941.880) (-944.778) [-943.313] * (-942.067) (-949.213) [-942.884] (-941.290) -- 0:00:47
      295000 -- (-943.695) (-941.233) (-942.057) [-941.349] * (-941.329) (-942.214) [-944.410] (-941.988) -- 0:00:47

      Average standard deviation of split frequencies: 0.012179

      295500 -- [-943.852] (-946.593) (-942.258) (-940.934) * [-941.277] (-942.083) (-946.569) (-942.262) -- 0:00:47
      296000 -- [-943.825] (-944.004) (-944.788) (-941.325) * (-943.750) [-940.556] (-944.059) (-940.652) -- 0:00:47
      296500 -- (-944.868) [-943.376] (-944.630) (-943.334) * (-945.391) (-942.533) (-947.563) [-941.885] -- 0:00:47
      297000 -- (-944.809) (-944.089) [-946.082] (-941.406) * (-946.542) (-943.135) (-944.167) [-940.995] -- 0:00:47
      297500 -- (-944.049) (-941.970) (-944.202) [-943.959] * [-942.365] (-946.504) (-945.241) (-942.120) -- 0:00:47
      298000 -- (-945.221) (-948.168) [-943.377] (-945.861) * [-941.070] (-946.350) (-940.998) (-940.911) -- 0:00:47
      298500 -- (-943.638) (-941.782) (-942.085) [-944.477] * (-941.029) [-941.126] (-940.838) (-941.332) -- 0:00:47
      299000 -- [-942.865] (-941.488) (-941.171) (-940.922) * (-946.570) (-944.469) [-942.208] (-941.858) -- 0:00:46
      299500 -- (-941.984) (-942.209) (-942.721) [-941.657] * (-946.570) (-948.221) (-943.074) [-940.963] -- 0:00:46
      300000 -- (-945.268) (-945.197) (-942.197) [-941.514] * (-944.629) (-944.407) (-946.222) [-942.486] -- 0:00:46

      Average standard deviation of split frequencies: 0.011563

      300500 -- [-943.812] (-941.377) (-943.671) (-942.901) * (-940.002) (-944.598) [-941.200] (-941.661) -- 0:00:46
      301000 -- (-942.180) (-942.489) (-944.252) [-940.767] * (-942.816) [-943.917] (-946.370) (-942.797) -- 0:00:48
      301500 -- (-940.860) (-942.763) (-940.643) [-944.552] * (-941.332) (-942.103) (-946.742) [-943.819] -- 0:00:48
      302000 -- (-943.932) [-941.739] (-941.174) (-943.961) * [-943.127] (-945.477) (-944.363) (-941.630) -- 0:00:48
      302500 -- (-942.072) (-943.422) (-941.707) [-945.038] * (-944.664) [-942.189] (-941.066) (-942.077) -- 0:00:48
      303000 -- (-940.421) (-948.620) (-940.788) [-943.049] * (-944.337) (-947.003) (-940.886) [-942.620] -- 0:00:48
      303500 -- (-943.033) [-941.329] (-940.839) (-942.396) * (-943.311) (-943.798) (-944.610) [-941.600] -- 0:00:48
      304000 -- [-942.234] (-942.601) (-946.008) (-943.047) * (-946.429) [-941.851] (-947.805) (-942.244) -- 0:00:48
      304500 -- [-941.020] (-942.607) (-940.983) (-947.013) * (-943.452) (-941.197) [-941.778] (-941.634) -- 0:00:47
      305000 -- (-943.276) [-942.607] (-945.496) (-943.694) * (-944.128) (-942.071) [-942.835] (-942.564) -- 0:00:47

      Average standard deviation of split frequencies: 0.010099

      305500 -- (-941.552) [-941.078] (-946.009) (-941.351) * (-944.042) [-941.118] (-946.380) (-941.424) -- 0:00:47
      306000 -- (-941.456) [-942.421] (-942.479) (-943.019) * (-941.729) (-943.791) [-942.379] (-941.479) -- 0:00:47
      306500 -- (-943.503) [-945.940] (-943.110) (-942.239) * (-942.849) (-942.332) [-943.754] (-940.607) -- 0:00:47
      307000 -- [-943.191] (-943.882) (-945.412) (-945.044) * (-943.514) (-940.689) (-942.324) [-942.620] -- 0:00:47
      307500 -- (-944.853) (-944.536) (-944.379) [-940.714] * (-946.452) (-941.110) (-940.886) [-942.784] -- 0:00:47
      308000 -- (-943.459) (-944.957) [-942.610] (-941.391) * (-942.898) [-940.431] (-942.190) (-943.900) -- 0:00:47
      308500 -- (-942.579) [-944.957] (-944.976) (-940.471) * [-943.270] (-939.964) (-940.648) (-940.834) -- 0:00:47
      309000 -- [-943.031] (-943.105) (-949.909) (-941.129) * (-941.331) (-940.888) (-942.216) [-940.425] -- 0:00:46
      309500 -- (-942.092) (-941.448) (-943.816) [-941.992] * (-940.852) [-940.774] (-944.146) (-940.502) -- 0:00:46
      310000 -- (-945.410) [-941.177] (-943.378) (-943.716) * (-945.337) [-939.910] (-941.473) (-940.455) -- 0:00:46

      Average standard deviation of split frequencies: 0.010032

      310500 -- (-945.997) (-941.047) (-942.595) [-941.590] * (-943.291) (-941.075) (-942.948) [-942.376] -- 0:00:46
      311000 -- (-943.142) [-940.535] (-940.089) (-941.675) * (-942.646) (-941.892) (-943.751) [-941.244] -- 0:00:46
      311500 -- (-944.765) (-940.496) [-940.408] (-941.412) * (-950.007) (-941.146) [-940.312] (-941.079) -- 0:00:46
      312000 -- (-942.968) (-940.345) (-940.921) [-940.584] * (-949.127) (-942.957) (-945.908) [-941.141] -- 0:00:46
      312500 -- (-943.663) (-940.443) [-940.605] (-941.233) * [-944.867] (-941.712) (-945.756) (-941.984) -- 0:00:46
      313000 -- (-944.437) [-941.196] (-940.829) (-940.688) * [-943.912] (-944.460) (-941.799) (-943.348) -- 0:00:46
      313500 -- (-942.330) (-946.129) (-941.321) [-942.406] * (-942.497) (-942.678) [-943.385] (-942.795) -- 0:00:45
      314000 -- (-941.526) (-944.120) (-942.239) [-941.059] * (-941.748) (-942.817) (-940.639) [-942.340] -- 0:00:45
      314500 -- (-940.225) (-946.564) (-942.400) [-941.980] * (-947.115) (-945.421) (-940.233) [-941.506] -- 0:00:45
      315000 -- (-943.486) (-943.036) [-942.078] (-941.682) * (-941.228) [-941.817] (-940.706) (-943.461) -- 0:00:45

      Average standard deviation of split frequencies: 0.010443

      315500 -- [-942.093] (-942.450) (-941.943) (-941.438) * [-944.577] (-950.606) (-942.191) (-944.680) -- 0:00:45
      316000 -- (-943.824) [-942.869] (-942.396) (-943.392) * (-941.590) (-944.715) [-940.373] (-945.502) -- 0:00:45
      316500 -- (-943.343) (-940.486) [-941.600] (-943.183) * [-942.662] (-940.836) (-941.459) (-942.906) -- 0:00:45
      317000 -- (-946.601) (-940.331) [-946.507] (-941.998) * (-942.398) [-940.967] (-942.344) (-944.270) -- 0:00:45
      317500 -- (-942.976) [-942.171] (-943.723) (-942.071) * (-940.287) (-942.070) (-945.772) [-943.463] -- 0:00:47
      318000 -- (-940.763) (-945.264) (-944.035) [-942.183] * (-940.893) (-941.880) (-943.257) [-942.368] -- 0:00:47
      318500 -- (-942.923) [-941.287] (-942.681) (-943.551) * (-942.122) (-945.669) [-940.723] (-941.973) -- 0:00:47
      319000 -- (-942.602) [-941.887] (-943.590) (-943.636) * (-942.065) (-943.984) [-940.607] (-943.954) -- 0:00:46
      319500 -- (-940.945) [-941.157] (-942.352) (-941.902) * [-943.266] (-943.980) (-943.735) (-940.470) -- 0:00:46
      320000 -- (-944.244) [-942.557] (-940.216) (-946.052) * [-943.517] (-942.254) (-941.756) (-943.227) -- 0:00:46

      Average standard deviation of split frequencies: 0.009253

      320500 -- [-943.914] (-943.467) (-942.445) (-942.226) * (-943.395) (-941.648) [-942.362] (-941.669) -- 0:00:46
      321000 -- [-941.287] (-947.295) (-940.630) (-941.153) * (-944.656) [-940.367] (-942.058) (-943.361) -- 0:00:46
      321500 -- (-943.267) [-944.117] (-941.039) (-940.955) * (-943.013) (-942.899) [-944.632] (-940.698) -- 0:00:46
      322000 -- (-944.397) (-946.419) [-940.829] (-940.668) * (-942.553) (-942.592) (-941.504) [-945.618] -- 0:00:46
      322500 -- (-940.190) (-941.745) (-941.008) [-940.523] * (-944.308) [-944.642] (-941.405) (-943.548) -- 0:00:46
      323000 -- (-941.857) (-945.282) [-942.492] (-940.156) * (-944.332) [-940.747] (-941.883) (-943.470) -- 0:00:46
      323500 -- (-946.820) (-942.458) [-942.720] (-944.087) * (-941.288) (-941.522) [-940.478] (-948.045) -- 0:00:46
      324000 -- (-941.312) (-944.675) (-947.784) [-943.023] * (-943.890) (-942.011) (-942.020) [-944.392] -- 0:00:45
      324500 -- [-945.889] (-945.488) (-940.969) (-943.805) * (-943.463) (-943.340) (-940.919) [-940.129] -- 0:00:45
      325000 -- (-942.794) [-941.037] (-940.779) (-944.258) * (-947.980) (-943.123) [-942.193] (-940.959) -- 0:00:45

      Average standard deviation of split frequencies: 0.009187

      325500 -- (-943.402) [-941.202] (-940.857) (-941.246) * (-943.948) [-940.476] (-943.641) (-941.489) -- 0:00:45
      326000 -- (-949.986) [-941.285] (-940.336) (-940.647) * [-942.770] (-941.393) (-943.268) (-944.779) -- 0:00:45
      326500 -- (-941.628) [-940.162] (-943.062) (-941.064) * (-940.821) (-940.619) (-940.329) [-946.062] -- 0:00:45
      327000 -- (-943.221) [-943.925] (-947.274) (-940.644) * [-941.584] (-942.517) (-942.571) (-943.974) -- 0:00:45
      327500 -- (-941.355) (-942.816) [-941.724] (-942.592) * (-943.473) (-942.152) (-945.723) [-941.572] -- 0:00:45
      328000 -- [-941.979] (-942.776) (-941.828) (-943.201) * (-942.851) (-940.349) (-944.444) [-941.562] -- 0:00:45
      328500 -- (-942.003) (-943.155) [-942.198] (-941.815) * (-941.076) (-941.250) [-946.469] (-946.410) -- 0:00:44
      329000 -- (-942.808) (-946.006) [-940.509] (-942.616) * [-944.368] (-945.547) (-942.502) (-943.708) -- 0:00:44
      329500 -- (-943.618) [-940.495] (-946.310) (-942.099) * (-944.932) (-942.127) [-945.011] (-942.036) -- 0:00:44
      330000 -- (-943.061) [-941.606] (-940.922) (-947.178) * [-942.297] (-940.754) (-941.286) (-941.382) -- 0:00:44

      Average standard deviation of split frequencies: 0.009712

      330500 -- [-940.423] (-948.238) (-942.755) (-945.661) * (-943.360) (-942.189) (-940.839) [-942.834] -- 0:00:44
      331000 -- (-942.149) (-943.070) [-943.487] (-944.680) * (-942.689) (-941.396) [-941.436] (-943.564) -- 0:00:44
      331500 -- [-944.227] (-943.168) (-942.276) (-943.160) * [-944.660] (-944.641) (-941.357) (-947.044) -- 0:00:44
      332000 -- (-943.052) (-942.222) (-943.317) [-941.958] * [-942.119] (-943.591) (-943.654) (-942.133) -- 0:00:44
      332500 -- (-944.172) (-943.891) [-940.484] (-940.647) * [-944.259] (-942.308) (-940.685) (-942.169) -- 0:00:44
      333000 -- [-942.059] (-948.225) (-942.553) (-941.219) * (-941.373) [-941.376] (-941.627) (-946.816) -- 0:00:44
      333500 -- [-941.130] (-945.625) (-940.874) (-946.179) * (-941.725) [-943.052] (-942.364) (-944.947) -- 0:00:45
      334000 -- (-942.631) (-942.332) (-944.077) [-945.258] * (-942.740) (-940.842) [-943.557] (-941.076) -- 0:00:45
      334500 -- [-941.752] (-943.275) (-944.653) (-946.283) * [-943.998] (-945.130) (-942.295) (-942.781) -- 0:00:45
      335000 -- (-946.920) (-942.227) (-940.865) [-945.115] * (-945.500) (-942.008) (-941.771) [-941.944] -- 0:00:45

      Average standard deviation of split frequencies: 0.009119

      335500 -- (-948.151) (-942.046) (-942.023) [-946.329] * (-942.310) (-940.772) [-942.894] (-945.289) -- 0:00:45
      336000 -- (-943.815) (-941.729) (-941.947) [-947.854] * (-941.277) [-941.004] (-942.909) (-943.928) -- 0:00:45
      336500 -- (-942.613) [-943.299] (-941.525) (-944.957) * (-943.518) (-944.036) [-941.693] (-943.070) -- 0:00:45
      337000 -- (-941.302) [-942.390] (-942.727) (-942.765) * [-940.393] (-943.087) (-940.062) (-942.049) -- 0:00:45
      337500 -- (-947.813) (-942.601) [-943.617] (-940.955) * (-943.968) (-942.765) (-943.026) [-945.047] -- 0:00:45
      338000 -- (-951.323) (-941.963) [-942.613] (-940.641) * (-942.337) (-942.777) (-942.626) [-942.345] -- 0:00:45
      338500 -- (-944.110) [-940.837] (-943.992) (-947.122) * (-942.730) [-942.328] (-945.559) (-942.562) -- 0:00:44
      339000 -- (-942.129) [-941.221] (-946.225) (-943.399) * (-943.319) [-942.196] (-941.105) (-940.868) -- 0:00:44
      339500 -- (-942.878) [-946.548] (-941.291) (-943.696) * (-940.869) (-941.420) [-941.388] (-942.218) -- 0:00:44
      340000 -- (-945.133) (-951.070) [-941.296] (-941.692) * (-941.081) (-940.585) (-943.357) [-941.473] -- 0:00:44

      Average standard deviation of split frequencies: 0.009427

      340500 -- (-941.534) (-944.479) (-942.108) [-941.031] * (-941.665) [-945.786] (-941.404) (-947.779) -- 0:00:44
      341000 -- (-944.925) [-943.068] (-940.665) (-943.952) * [-942.371] (-941.876) (-942.285) (-944.323) -- 0:00:44
      341500 -- [-943.457] (-944.172) (-942.284) (-944.277) * (-940.420) [-942.664] (-942.434) (-943.157) -- 0:00:44
      342000 -- [-942.403] (-944.800) (-944.893) (-944.839) * [-943.474] (-941.870) (-942.721) (-941.197) -- 0:00:44
      342500 -- [-943.262] (-943.197) (-942.945) (-950.323) * (-940.139) (-943.082) [-943.169] (-944.634) -- 0:00:44
      343000 -- [-940.595] (-943.663) (-943.255) (-946.983) * (-941.512) (-946.329) (-945.608) [-944.023] -- 0:00:44
      343500 -- [-942.506] (-942.581) (-943.310) (-941.031) * [-941.028] (-942.627) (-943.126) (-941.471) -- 0:00:43
      344000 -- (-942.951) (-947.409) (-942.101) [-942.263] * [-941.032] (-947.266) (-943.388) (-942.354) -- 0:00:43
      344500 -- (-941.561) (-943.216) (-943.084) [-942.569] * (-943.560) [-941.731] (-943.442) (-941.844) -- 0:00:43
      345000 -- (-943.559) (-940.569) [-942.711] (-942.040) * (-941.682) (-941.455) (-941.970) [-945.083] -- 0:00:43

      Average standard deviation of split frequencies: 0.008656

      345500 -- [-942.283] (-943.152) (-941.095) (-942.979) * (-944.493) (-941.496) [-944.275] (-941.508) -- 0:00:43
      346000 -- (-942.459) (-943.925) [-940.817] (-941.757) * (-942.488) [-940.403] (-941.593) (-942.415) -- 0:00:43
      346500 -- (-944.244) (-942.637) [-942.791] (-940.560) * (-944.164) (-942.593) [-940.920] (-943.273) -- 0:00:43
      347000 -- [-941.659] (-945.496) (-943.672) (-941.941) * (-943.118) (-946.796) [-942.865] (-940.961) -- 0:00:43
      347500 -- (-941.525) (-947.784) (-946.429) [-943.034] * [-942.390] (-945.194) (-941.510) (-941.613) -- 0:00:43
      348000 -- (-945.442) (-942.390) (-946.209) [-943.074] * [-943.469] (-942.214) (-940.315) (-941.600) -- 0:00:43
      348500 -- [-941.515] (-942.728) (-946.380) (-942.393) * [-942.466] (-941.720) (-942.099) (-940.831) -- 0:00:42
      349000 -- (-942.622) (-945.077) (-942.837) [-941.538] * [-942.388] (-943.034) (-942.669) (-941.905) -- 0:00:42
      349500 -- (-941.584) (-940.607) [-945.428] (-942.315) * (-944.100) (-941.909) [-941.281] (-942.422) -- 0:00:44
      350000 -- (-942.522) [-942.776] (-941.778) (-946.606) * (-942.982) (-943.342) (-942.555) [-942.533] -- 0:00:44

      Average standard deviation of split frequencies: 0.009494

      350500 -- (-943.700) (-940.092) (-942.460) [-943.274] * (-945.509) [-940.164] (-945.206) (-943.403) -- 0:00:44
      351000 -- [-945.891] (-940.820) (-946.821) (-941.386) * (-942.108) (-941.147) (-944.632) [-941.449] -- 0:00:44
      351500 -- (-944.422) (-941.786) [-940.771] (-942.661) * (-945.529) (-943.922) (-945.233) [-942.355] -- 0:00:44
      352000 -- (-943.153) [-943.588] (-941.035) (-941.741) * (-943.421) (-941.432) [-944.158] (-942.034) -- 0:00:44
      352500 -- (-942.759) (-945.812) [-944.111] (-944.404) * [-940.707] (-945.899) (-941.231) (-940.902) -- 0:00:44
      353000 -- [-942.228] (-942.602) (-942.252) (-944.045) * (-942.848) (-941.782) [-940.289] (-941.128) -- 0:00:43
      353500 -- (-943.061) (-943.084) (-942.224) [-942.981] * [-941.857] (-943.143) (-950.226) (-942.600) -- 0:00:43
      354000 -- [-941.503] (-941.174) (-942.164) (-945.478) * (-942.445) (-945.021) [-944.354] (-941.114) -- 0:00:43
      354500 -- (-947.796) (-942.000) [-942.965] (-946.817) * (-941.720) (-943.345) [-943.855] (-941.058) -- 0:00:43
      355000 -- (-943.426) [-942.505] (-941.595) (-945.191) * (-942.956) (-943.263) [-944.559] (-940.711) -- 0:00:43

      Average standard deviation of split frequencies: 0.009186

      355500 -- [-942.400] (-943.086) (-940.178) (-944.364) * [-941.612] (-944.567) (-943.873) (-944.181) -- 0:00:43
      356000 -- (-944.255) (-943.688) (-942.241) [-941.932] * [-940.967] (-941.589) (-948.157) (-942.162) -- 0:00:43
      356500 -- [-941.821] (-944.799) (-943.166) (-945.302) * (-944.668) [-942.616] (-941.183) (-942.550) -- 0:00:43
      357000 -- (-942.179) (-946.378) (-946.830) [-940.406] * (-942.379) (-944.797) (-944.323) [-942.870] -- 0:00:43
      357500 -- (-941.810) [-945.669] (-949.169) (-943.547) * (-942.790) (-941.387) [-946.204] (-941.130) -- 0:00:43
      358000 -- (-942.610) (-940.723) [-943.561] (-941.714) * (-940.620) (-941.148) [-941.155] (-945.563) -- 0:00:43
      358500 -- (-943.508) [-944.424] (-940.967) (-944.153) * (-940.668) [-942.198] (-943.580) (-941.696) -- 0:00:42
      359000 -- (-942.273) (-941.958) [-940.476] (-942.143) * (-943.381) (-940.790) (-943.226) [-945.486] -- 0:00:42
      359500 -- (-943.978) (-942.431) [-940.964] (-942.909) * (-942.750) (-944.822) [-943.117] (-942.669) -- 0:00:42
      360000 -- (-944.514) (-943.851) [-940.900] (-944.694) * (-942.903) (-942.967) (-942.486) [-943.228] -- 0:00:42

      Average standard deviation of split frequencies: 0.008801

      360500 -- (-946.591) (-944.379) [-940.516] (-942.744) * (-942.007) (-944.039) (-942.354) [-943.143] -- 0:00:42
      361000 -- [-942.703] (-944.700) (-940.598) (-940.810) * (-945.691) (-945.204) [-942.793] (-943.210) -- 0:00:42
      361500 -- [-944.653] (-945.044) (-941.771) (-941.570) * [-943.757] (-947.096) (-943.946) (-941.349) -- 0:00:42
      362000 -- (-945.687) (-941.401) (-941.818) [-945.724] * (-943.755) [-941.367] (-942.382) (-944.483) -- 0:00:42
      362500 -- (-943.271) (-941.612) (-942.552) [-942.792] * [-942.041] (-942.515) (-943.584) (-941.494) -- 0:00:42
      363000 -- (-941.770) [-944.822] (-942.883) (-941.049) * [-942.332] (-943.802) (-940.333) (-946.885) -- 0:00:42
      363500 -- [-941.799] (-945.067) (-943.311) (-941.267) * (-942.950) [-943.201] (-940.674) (-942.062) -- 0:00:42
      364000 -- (-943.526) (-942.411) [-944.475] (-941.154) * [-942.563] (-944.002) (-943.946) (-942.194) -- 0:00:41
      364500 -- (-940.360) (-943.183) [-941.485] (-941.634) * (-943.582) (-943.554) (-942.448) [-942.822] -- 0:00:41
      365000 -- (-942.828) [-940.384] (-942.913) (-945.363) * (-943.700) (-943.481) (-941.636) [-942.237] -- 0:00:41

      Average standard deviation of split frequencies: 0.008211

      365500 -- [-942.886] (-942.159) (-941.857) (-941.675) * [-940.709] (-942.733) (-945.457) (-941.504) -- 0:00:43
      366000 -- (-940.677) [-940.664] (-941.690) (-942.961) * [-941.742] (-947.579) (-942.550) (-941.423) -- 0:00:43
      366500 -- (-947.044) (-943.903) (-941.355) [-940.620] * (-940.764) [-942.981] (-941.583) (-943.400) -- 0:00:43
      367000 -- (-944.154) [-941.649] (-941.796) (-941.639) * [-941.032] (-941.975) (-940.610) (-941.571) -- 0:00:43
      367500 -- [-941.667] (-946.297) (-943.531) (-940.644) * [-943.872] (-940.200) (-940.390) (-942.438) -- 0:00:43
      368000 -- (-942.128) [-942.693] (-944.057) (-942.582) * (-942.695) (-942.437) [-940.602] (-941.322) -- 0:00:42
      368500 -- (-941.829) (-942.262) (-941.767) [-943.510] * (-942.447) [-942.248] (-940.602) (-942.360) -- 0:00:42
      369000 -- [-941.784] (-943.161) (-945.612) (-944.649) * (-941.852) [-942.185] (-942.543) (-944.535) -- 0:00:42
      369500 -- (-941.705) (-940.749) (-941.550) [-940.960] * [-940.767] (-943.306) (-941.853) (-941.606) -- 0:00:42
      370000 -- (-944.867) [-941.295] (-941.226) (-941.255) * (-941.325) [-941.680] (-943.604) (-944.146) -- 0:00:42

      Average standard deviation of split frequencies: 0.008028

      370500 -- (-942.894) (-944.931) (-942.064) [-943.223] * (-943.094) [-940.951] (-943.732) (-944.178) -- 0:00:42
      371000 -- (-943.704) [-943.775] (-942.522) (-946.867) * (-945.125) (-941.132) [-941.568] (-943.781) -- 0:00:42
      371500 -- (-942.805) (-943.194) (-943.881) [-941.976] * (-941.403) [-942.866] (-943.175) (-942.942) -- 0:00:42
      372000 -- [-944.042] (-940.930) (-941.349) (-942.145) * (-947.918) [-942.533] (-944.478) (-943.846) -- 0:00:42
      372500 -- (-941.585) (-942.019) [-941.405] (-942.355) * (-941.128) [-940.356] (-943.201) (-942.044) -- 0:00:42
      373000 -- (-941.554) (-943.228) [-940.338] (-943.800) * [-941.028] (-942.032) (-940.989) (-943.118) -- 0:00:42
      373500 -- (-945.471) [-940.778] (-940.390) (-942.134) * (-941.597) (-943.580) [-941.348] (-943.983) -- 0:00:41
      374000 -- (-942.939) (-942.812) (-946.672) [-943.769] * (-943.928) [-942.114] (-942.650) (-948.997) -- 0:00:41
      374500 -- (-945.228) [-943.779] (-942.130) (-943.769) * (-943.047) [-942.860] (-944.642) (-941.227) -- 0:00:41
      375000 -- (-941.055) [-943.190] (-941.506) (-942.115) * (-942.502) [-945.240] (-944.729) (-940.849) -- 0:00:41

      Average standard deviation of split frequencies: 0.008463

      375500 -- (-946.754) [-943.424] (-942.523) (-943.919) * (-941.482) (-941.555) (-941.510) [-942.480] -- 0:00:41
      376000 -- (-944.561) (-943.740) (-940.384) [-943.361] * (-941.837) (-941.606) (-942.495) [-940.339] -- 0:00:41
      376500 -- [-943.676] (-940.889) (-941.113) (-946.649) * (-942.310) [-942.433] (-943.960) (-941.677) -- 0:00:41
      377000 -- [-943.478] (-942.961) (-941.083) (-943.381) * (-944.292) [-942.434] (-945.811) (-941.744) -- 0:00:41
      377500 -- (-940.951) (-941.941) [-943.263] (-942.237) * (-947.455) [-942.450] (-945.016) (-942.570) -- 0:00:41
      378000 -- (-939.983) (-943.152) (-944.876) [-941.091] * [-939.925] (-944.753) (-944.675) (-942.363) -- 0:00:41
      378500 -- (-939.983) (-942.744) (-945.021) [-944.616] * [-940.985] (-943.216) (-945.331) (-941.965) -- 0:00:41
      379000 -- (-940.334) [-943.310] (-941.312) (-944.730) * (-941.871) (-942.177) (-941.724) [-940.832] -- 0:00:40
      379500 -- (-940.352) (-943.408) (-940.741) [-940.082] * [-941.503] (-946.973) (-944.232) (-940.377) -- 0:00:40
      380000 -- (-939.864) [-940.893] (-940.839) (-941.818) * (-942.929) (-944.449) (-944.384) [-942.449] -- 0:00:40

      Average standard deviation of split frequencies: 0.007066

      380500 -- (-940.781) (-940.367) [-943.746] (-942.933) * [-940.994] (-943.021) (-945.380) (-945.592) -- 0:00:40
      381000 -- (-940.455) [-944.043] (-943.864) (-941.981) * (-942.030) (-942.549) [-940.924] (-944.676) -- 0:00:40
      381500 -- (-942.805) (-944.609) (-943.270) [-940.791] * [-943.423] (-942.852) (-940.161) (-945.325) -- 0:00:42
      382000 -- (-945.625) (-943.533) [-942.178] (-941.031) * (-944.202) [-942.957] (-940.568) (-941.457) -- 0:00:42
      382500 -- (-943.751) [-941.562] (-940.334) (-941.152) * [-943.370] (-942.797) (-940.785) (-941.840) -- 0:00:41
      383000 -- [-942.677] (-943.435) (-943.352) (-942.759) * (-943.705) (-942.031) (-940.785) [-942.112] -- 0:00:41
      383500 -- (-940.339) [-943.466] (-941.733) (-940.654) * (-945.030) [-945.561] (-941.918) (-942.456) -- 0:00:41
      384000 -- (-942.420) [-940.637] (-941.530) (-942.060) * (-942.999) (-941.703) (-942.001) [-943.146] -- 0:00:41
      384500 -- (-943.024) (-942.675) [-942.098] (-941.747) * (-940.698) (-940.516) [-940.935] (-941.239) -- 0:00:41
      385000 -- (-943.210) (-944.984) [-941.120] (-941.555) * [-942.089] (-942.877) (-942.940) (-946.291) -- 0:00:41

      Average standard deviation of split frequencies: 0.006753

      385500 -- (-941.716) (-941.676) [-941.534] (-942.119) * (-942.217) (-942.084) (-941.612) [-942.777] -- 0:00:41
      386000 -- (-944.329) [-942.614] (-941.089) (-942.106) * (-942.717) (-943.162) [-941.182] (-944.639) -- 0:00:41
      386500 -- (-943.813) (-944.090) [-941.143] (-942.603) * (-941.756) [-940.967] (-941.944) (-942.116) -- 0:00:41
      387000 -- (-942.434) (-943.333) [-941.731] (-941.604) * [-944.721] (-941.424) (-942.257) (-942.580) -- 0:00:41
      387500 -- (-942.142) [-943.071] (-941.497) (-942.989) * (-944.933) [-942.991] (-942.400) (-942.918) -- 0:00:41
      388000 -- (-944.713) [-940.230] (-941.003) (-940.612) * (-942.725) (-941.023) [-943.123] (-942.535) -- 0:00:41
      388500 -- (-950.210) (-940.532) [-942.016] (-943.851) * (-949.342) (-942.250) (-942.415) [-944.556] -- 0:00:40
      389000 -- [-948.058] (-941.189) (-942.273) (-942.244) * (-941.382) (-941.871) [-941.856] (-943.665) -- 0:00:40
      389500 -- (-941.948) (-941.189) [-945.521] (-943.045) * (-942.163) (-942.409) [-947.735] (-947.844) -- 0:00:40
      390000 -- (-941.201) [-940.618] (-942.364) (-942.504) * [-945.993] (-940.929) (-942.430) (-941.725) -- 0:00:40

      Average standard deviation of split frequencies: 0.006672

      390500 -- [-942.078] (-941.682) (-941.708) (-941.253) * (-942.654) (-943.234) (-946.005) [-941.228] -- 0:00:40
      391000 -- (-943.090) [-944.823] (-943.179) (-942.569) * (-941.035) (-944.805) (-940.866) [-940.845] -- 0:00:40
      391500 -- [-941.174] (-945.839) (-942.344) (-943.653) * [-941.706] (-942.228) (-941.910) (-943.965) -- 0:00:40
      392000 -- (-943.657) (-940.837) [-945.553] (-942.918) * (-941.922) (-941.045) (-941.651) [-942.044] -- 0:00:40
      392500 -- (-941.218) [-940.671] (-941.111) (-941.651) * (-943.995) (-942.567) [-943.557] (-943.210) -- 0:00:40
      393000 -- (-941.288) [-941.422] (-940.826) (-941.669) * (-942.051) (-946.793) (-943.835) [-940.380] -- 0:00:40
      393500 -- (-941.862) [-942.469] (-943.697) (-941.535) * (-943.238) [-940.672] (-940.897) (-940.368) -- 0:00:40
      394000 -- [-940.333] (-946.885) (-945.610) (-941.810) * (-942.550) [-940.574] (-945.881) (-940.691) -- 0:00:39
      394500 -- [-941.102] (-943.950) (-945.612) (-942.386) * (-941.190) (-942.100) [-943.729] (-942.596) -- 0:00:39
      395000 -- (-940.950) [-942.005] (-940.971) (-941.118) * (-941.215) (-942.097) [-942.820] (-940.697) -- 0:00:39

      Average standard deviation of split frequencies: 0.007703

      395500 -- [-940.533] (-940.922) (-940.283) (-941.248) * (-940.693) (-945.922) [-940.506] (-943.204) -- 0:00:39
      396000 -- [-942.606] (-940.231) (-944.626) (-944.002) * (-945.227) (-945.985) [-943.053] (-946.937) -- 0:00:39
      396500 -- (-943.624) (-944.152) [-942.844] (-942.768) * (-942.598) (-944.902) [-943.369] (-944.561) -- 0:00:39
      397000 -- (-943.172) (-941.630) (-940.683) [-941.791] * (-944.779) (-948.515) (-942.597) [-944.285] -- 0:00:39
      397500 -- (-943.476) (-942.704) (-940.674) [-941.730] * (-942.676) [-943.992] (-946.502) (-944.170) -- 0:00:40
      398000 -- (-941.041) (-941.438) (-940.521) [-941.168] * (-942.650) (-942.906) [-943.058] (-944.848) -- 0:00:40
      398500 -- (-941.517) [-940.598] (-943.352) (-941.640) * (-943.531) (-942.362) [-942.012] (-945.155) -- 0:00:40
      399000 -- (-944.928) (-941.940) (-941.833) [-943.062] * (-941.063) [-943.061] (-945.606) (-946.913) -- 0:00:40
      399500 -- (-944.728) [-943.203] (-942.567) (-940.981) * [-940.892] (-943.559) (-944.277) (-945.633) -- 0:00:40
      400000 -- [-944.119] (-942.694) (-942.881) (-940.596) * (-942.460) (-943.350) (-947.638) [-940.406] -- 0:00:40

      Average standard deviation of split frequencies: 0.007280

      400500 -- (-943.402) (-941.922) [-943.187] (-943.136) * [-941.891] (-946.036) (-947.889) (-942.037) -- 0:00:40
      401000 -- (-941.069) (-941.433) (-943.689) [-942.034] * (-941.908) (-941.555) (-951.928) [-944.940] -- 0:00:40
      401500 -- (-942.601) [-942.066] (-943.475) (-941.138) * [-942.135] (-948.593) (-948.363) (-943.293) -- 0:00:40
      402000 -- (-942.394) (-941.562) (-943.060) [-944.162] * (-945.871) (-941.525) (-942.521) [-942.617] -- 0:00:40
      402500 -- (-941.519) (-943.308) [-942.306] (-946.725) * (-940.838) (-941.835) (-941.037) [-943.660] -- 0:00:40
      403000 -- (-943.136) (-943.915) [-942.976] (-942.387) * (-941.926) (-942.973) [-941.460] (-942.801) -- 0:00:39
      403500 -- [-942.324] (-945.730) (-947.135) (-942.701) * [-943.439] (-946.015) (-941.672) (-941.321) -- 0:00:39
      404000 -- [-940.384] (-942.192) (-943.861) (-952.607) * [-944.940] (-942.213) (-942.784) (-940.696) -- 0:00:39
      404500 -- [-940.428] (-941.886) (-942.579) (-942.835) * [-942.715] (-942.232) (-941.931) (-941.179) -- 0:00:39
      405000 -- [-941.152] (-943.236) (-940.686) (-940.636) * (-947.703) (-943.365) [-941.298] (-941.214) -- 0:00:39

      Average standard deviation of split frequencies: 0.007620

      405500 -- (-944.417) [-947.986] (-944.084) (-941.608) * (-942.269) (-941.763) [-943.508] (-945.416) -- 0:00:39
      406000 -- (-944.001) (-942.348) (-943.409) [-942.171] * [-941.565] (-942.623) (-940.648) (-948.324) -- 0:00:39
      406500 -- [-941.117] (-942.102) (-942.959) (-945.513) * (-941.626) (-946.337) [-940.448] (-946.606) -- 0:00:39
      407000 -- [-940.619] (-941.766) (-944.683) (-943.540) * (-943.622) (-940.836) [-940.473] (-942.314) -- 0:00:39
      407500 -- (-945.058) [-941.562] (-941.920) (-943.485) * (-943.432) (-942.670) [-943.550] (-942.357) -- 0:00:39
      408000 -- (-940.326) [-943.429] (-943.031) (-944.418) * (-940.780) (-941.257) (-944.042) [-942.053] -- 0:00:39
      408500 -- (-941.447) (-940.679) [-941.334] (-942.496) * (-940.875) (-944.322) [-942.525] (-941.594) -- 0:00:39
      409000 -- (-943.202) (-945.124) [-943.199] (-945.140) * (-944.046) (-939.936) (-944.610) [-941.155] -- 0:00:39
      409500 -- (-944.031) [-941.075] (-942.865) (-945.192) * (-941.669) [-940.804] (-942.510) (-940.703) -- 0:00:38
      410000 -- [-942.465] (-941.091) (-941.043) (-942.985) * (-943.912) [-940.730] (-940.429) (-941.368) -- 0:00:38

      Average standard deviation of split frequencies: 0.007605

      410500 -- [-940.549] (-941.748) (-942.317) (-940.631) * (-942.884) (-943.277) [-940.682] (-946.801) -- 0:00:38
      411000 -- (-944.870) [-942.785] (-943.170) (-942.531) * (-940.528) [-945.173] (-940.413) (-944.399) -- 0:00:38
      411500 -- (-941.676) (-942.859) [-942.231] (-942.123) * (-942.086) (-943.363) (-946.059) [-943.603] -- 0:00:38
      412000 -- (-944.643) (-942.309) (-940.496) [-940.239] * [-941.370] (-945.193) (-944.669) (-941.021) -- 0:00:38
      412500 -- (-943.398) (-942.663) (-941.888) [-944.020] * (-944.296) (-944.504) [-943.558] (-940.839) -- 0:00:38
      413000 -- [-944.423] (-943.837) (-942.159) (-942.563) * (-942.208) (-945.016) [-941.451] (-945.298) -- 0:00:39
      413500 -- [-942.092] (-943.149) (-941.629) (-944.461) * (-942.973) [-941.329] (-942.854) (-942.005) -- 0:00:39
      414000 -- [-943.531] (-941.858) (-941.928) (-941.470) * (-941.595) (-943.359) (-943.247) [-946.778] -- 0:00:39
      414500 -- (-943.793) (-945.229) (-941.036) [-944.346] * [-942.660] (-945.432) (-944.144) (-946.417) -- 0:00:39
      415000 -- (-946.403) (-943.486) (-940.789) [-942.088] * (-941.540) (-940.733) (-943.474) [-946.807] -- 0:00:39

      Average standard deviation of split frequencies: 0.007666

      415500 -- [-944.203] (-943.305) (-940.255) (-942.068) * (-941.542) (-940.788) [-944.328] (-947.710) -- 0:00:39
      416000 -- (-943.057) (-941.960) [-941.716] (-946.537) * (-941.158) [-943.982] (-943.568) (-947.634) -- 0:00:39
      416500 -- (-942.184) [-940.849] (-942.562) (-944.997) * (-944.043) [-941.088] (-941.361) (-943.105) -- 0:00:39
      417000 -- (-944.568) [-942.861] (-941.001) (-943.597) * [-941.140] (-946.616) (-942.688) (-941.408) -- 0:00:39
      417500 -- (-943.325) (-944.852) (-943.156) [-941.915] * (-943.398) [-945.392] (-944.168) (-941.164) -- 0:00:39
      418000 -- [-943.286] (-949.591) (-942.519) (-945.799) * (-945.057) [-943.086] (-941.995) (-943.712) -- 0:00:38
      418500 -- (-940.902) [-941.199] (-941.318) (-942.704) * [-942.272] (-944.231) (-941.396) (-943.168) -- 0:00:38
      419000 -- (-943.291) [-944.684] (-940.975) (-940.984) * [-942.328] (-944.176) (-942.597) (-940.705) -- 0:00:38
      419500 -- (-942.128) (-942.868) (-947.574) [-940.897] * [-941.956] (-943.489) (-942.291) (-942.530) -- 0:00:38
      420000 -- [-945.512] (-945.282) (-941.049) (-941.179) * (-943.404) (-944.299) (-946.650) [-942.132] -- 0:00:38

      Average standard deviation of split frequencies: 0.007251

      420500 -- (-942.671) (-941.431) [-942.606] (-943.455) * (-941.700) (-941.863) (-943.918) [-941.962] -- 0:00:38
      421000 -- (-941.445) [-943.671] (-942.687) (-945.023) * [-940.968] (-943.406) (-942.485) (-942.649) -- 0:00:38
      421500 -- [-940.446] (-940.771) (-940.639) (-941.905) * [-942.827] (-940.953) (-943.773) (-942.641) -- 0:00:38
      422000 -- (-942.069) [-941.707] (-940.581) (-941.934) * [-943.719] (-943.340) (-945.927) (-947.880) -- 0:00:38
      422500 -- (-941.366) (-942.754) (-940.964) [-942.733] * (-943.707) [-941.586] (-942.351) (-942.386) -- 0:00:38
      423000 -- (-941.343) (-941.081) [-941.634] (-943.977) * [-942.205] (-942.248) (-941.027) (-941.503) -- 0:00:38
      423500 -- [-941.099] (-944.353) (-941.342) (-946.974) * [-944.763] (-941.257) (-943.672) (-943.239) -- 0:00:38
      424000 -- (-941.099) (-943.525) (-941.223) [-944.607] * (-941.164) (-940.538) [-940.512] (-943.024) -- 0:00:38
      424500 -- (-941.145) [-942.653] (-941.337) (-942.213) * (-943.173) (-940.612) [-943.360] (-941.420) -- 0:00:37
      425000 -- [-941.912] (-942.081) (-942.172) (-940.828) * (-943.088) (-940.609) (-941.854) [-943.087] -- 0:00:37

      Average standard deviation of split frequencies: 0.006965

      425500 -- (-941.065) (-942.450) (-942.428) [-940.965] * (-946.036) [-940.962] (-946.204) (-941.972) -- 0:00:37
      426000 -- (-941.026) (-942.939) (-941.702) [-941.447] * (-944.070) (-940.493) [-940.666] (-940.606) -- 0:00:37
      426500 -- [-941.006] (-942.635) (-944.563) (-942.274) * (-943.914) [-940.036] (-942.863) (-940.956) -- 0:00:37
      427000 -- [-942.457] (-941.227) (-940.507) (-943.343) * (-944.506) (-940.925) [-941.044] (-940.704) -- 0:00:37
      427500 -- (-944.114) [-940.777] (-940.238) (-945.810) * (-941.760) [-941.264] (-941.130) (-943.348) -- 0:00:37
      428000 -- (-942.564) [-940.852] (-944.707) (-941.310) * [-941.989] (-940.506) (-941.300) (-947.181) -- 0:00:37
      428500 -- (-943.963) (-942.659) (-941.419) [-940.892] * (-944.188) (-940.741) [-944.049] (-940.474) -- 0:00:37
      429000 -- (-945.514) (-945.295) [-941.208] (-943.808) * (-942.060) (-940.711) [-940.904] (-942.364) -- 0:00:37
      429500 -- (-942.837) [-942.918] (-942.306) (-943.250) * [-942.530] (-940.209) (-942.322) (-942.144) -- 0:00:38
      430000 -- (-944.603) [-943.481] (-941.690) (-943.691) * (-942.495) [-941.050] (-942.071) (-946.440) -- 0:00:38

      Average standard deviation of split frequencies: 0.007340

      430500 -- (-943.257) [-941.535] (-946.179) (-943.351) * (-942.430) [-941.640] (-941.556) (-944.866) -- 0:00:38
      431000 -- (-943.809) (-942.277) [-943.792] (-946.639) * [-941.161] (-942.733) (-940.596) (-942.248) -- 0:00:38
      431500 -- (-944.762) [-943.701] (-942.868) (-941.134) * (-943.838) [-942.126] (-942.615) (-941.912) -- 0:00:38
      432000 -- (-942.178) (-945.868) [-943.674] (-943.674) * (-943.975) (-942.635) (-942.739) [-942.038] -- 0:00:38
      432500 -- (-943.987) (-940.970) [-944.349] (-943.290) * (-941.225) (-942.564) [-944.213] (-943.125) -- 0:00:38
      433000 -- (-943.529) (-942.265) [-942.446] (-948.392) * [-941.385] (-941.963) (-942.591) (-944.529) -- 0:00:37
      433500 -- (-942.587) [-944.353] (-941.622) (-941.921) * (-940.939) (-941.329) (-946.486) [-942.731] -- 0:00:37
      434000 -- [-942.580] (-946.911) (-942.018) (-941.136) * (-941.070) (-942.894) [-940.280] (-941.102) -- 0:00:37
      434500 -- (-942.348) [-941.230] (-941.323) (-942.189) * (-940.167) (-941.290) (-940.299) [-941.221] -- 0:00:37
      435000 -- [-941.290] (-943.606) (-941.235) (-942.441) * [-941.275] (-942.704) (-940.118) (-943.958) -- 0:00:37

      Average standard deviation of split frequencies: 0.006893

      435500 -- (-940.563) (-942.766) [-945.550] (-940.676) * [-943.103] (-942.264) (-943.488) (-943.160) -- 0:00:37
      436000 -- [-941.522] (-943.039) (-945.097) (-940.497) * (-946.104) [-941.310] (-943.430) (-944.287) -- 0:00:37
      436500 -- [-942.515] (-952.528) (-946.832) (-940.314) * (-942.738) (-944.522) (-940.730) [-942.731] -- 0:00:37
      437000 -- (-941.029) [-941.183] (-941.229) (-940.928) * (-944.852) (-942.278) [-942.284] (-944.022) -- 0:00:37
      437500 -- (-943.899) (-940.375) (-940.720) [-940.909] * (-945.221) [-944.587] (-943.072) (-941.161) -- 0:00:37
      438000 -- (-942.748) [-943.835] (-941.966) (-943.280) * [-943.326] (-941.255) (-947.068) (-941.025) -- 0:00:37
      438500 -- (-945.082) (-942.420) [-942.276] (-943.266) * (-945.869) (-940.480) (-941.357) [-940.361] -- 0:00:37
      439000 -- [-942.374] (-941.640) (-945.910) (-941.323) * (-941.795) [-940.829] (-940.811) (-940.966) -- 0:00:37
      439500 -- [-941.302] (-941.110) (-946.173) (-941.591) * [-940.532] (-940.061) (-943.866) (-943.133) -- 0:00:36
      440000 -- (-941.365) [-941.749] (-944.244) (-941.510) * (-940.845) [-941.505] (-940.898) (-940.428) -- 0:00:36

      Average standard deviation of split frequencies: 0.007087

      440500 -- [-943.648] (-942.042) (-941.360) (-940.155) * (-941.790) [-940.544] (-943.840) (-940.257) -- 0:00:36
      441000 -- (-941.594) (-943.231) (-942.623) [-940.160] * (-941.381) [-940.519] (-941.792) (-941.039) -- 0:00:36
      441500 -- (-941.083) [-942.704] (-941.842) (-944.793) * [-943.649] (-943.788) (-941.119) (-940.803) -- 0:00:36
      442000 -- (-941.642) (-942.142) [-941.807] (-942.956) * [-941.748] (-941.265) (-940.956) (-940.437) -- 0:00:36
      442500 -- (-941.833) (-941.594) (-941.712) [-946.346] * (-942.987) (-942.182) (-943.414) [-943.389] -- 0:00:36
      443000 -- (-940.134) (-945.154) (-945.474) [-945.076] * (-941.791) (-942.152) (-943.490) [-942.402] -- 0:00:36
      443500 -- (-941.368) [-940.619] (-943.480) (-945.076) * (-944.175) (-940.699) (-941.818) [-941.621] -- 0:00:36
      444000 -- (-941.531) (-941.393) (-943.408) [-943.258] * (-943.106) [-940.346] (-940.759) (-946.004) -- 0:00:36
      444500 -- (-941.814) [-942.179] (-947.513) (-941.916) * (-943.540) [-942.159] (-942.637) (-943.682) -- 0:00:36
      445000 -- (-944.530) [-943.915] (-941.820) (-940.997) * (-944.561) (-943.007) [-942.442] (-943.263) -- 0:00:36

      Average standard deviation of split frequencies: 0.007465

      445500 -- (-943.900) (-943.219) (-942.323) [-942.028] * (-940.809) (-942.890) [-941.440] (-941.226) -- 0:00:37
      446000 -- (-943.904) [-941.883] (-941.298) (-942.719) * (-941.435) (-941.034) [-940.440] (-941.863) -- 0:00:37
      446500 -- (-941.503) [-941.675] (-940.831) (-941.814) * (-942.931) (-942.520) [-940.275] (-942.943) -- 0:00:37
      447000 -- (-941.847) (-943.639) [-941.211] (-940.879) * (-942.449) (-942.148) [-942.504] (-941.793) -- 0:00:37
      447500 -- (-942.479) (-942.651) [-941.213] (-940.995) * (-944.290) (-942.062) [-942.028] (-940.449) -- 0:00:37
      448000 -- (-941.677) (-941.694) [-945.735] (-941.568) * (-940.106) [-942.242] (-941.369) (-944.775) -- 0:00:36
      448500 -- (-940.415) [-941.580] (-942.013) (-941.303) * [-940.636] (-943.154) (-940.604) (-941.831) -- 0:00:36
      449000 -- (-944.870) [-941.411] (-942.031) (-943.820) * [-940.565] (-940.704) (-940.770) (-941.086) -- 0:00:36
      449500 -- [-942.919] (-941.568) (-942.319) (-941.495) * (-940.394) (-941.770) (-942.267) [-941.014] -- 0:00:36
      450000 -- [-944.775] (-944.578) (-942.494) (-942.281) * (-940.378) (-942.494) (-941.912) [-943.389] -- 0:00:36

      Average standard deviation of split frequencies: 0.006768

      450500 -- (-942.729) (-943.576) (-947.313) [-941.616] * [-942.027] (-945.663) (-944.705) (-942.195) -- 0:00:36
      451000 -- (-941.556) (-942.274) (-946.695) [-941.840] * [-946.494] (-941.078) (-943.733) (-941.710) -- 0:00:36
      451500 -- (-941.061) (-942.513) (-941.482) [-942.112] * (-943.174) (-940.349) [-942.629] (-943.589) -- 0:00:36
      452000 -- (-941.432) (-940.985) (-942.752) [-945.279] * (-942.353) [-943.916] (-941.451) (-941.007) -- 0:00:36
      452500 -- (-943.361) (-941.412) [-943.894] (-941.731) * (-940.870) (-943.286) [-941.904] (-943.940) -- 0:00:36
      453000 -- (-947.625) (-941.503) (-940.391) [-942.261] * (-941.096) (-943.624) (-940.942) [-949.809] -- 0:00:36
      453500 -- [-941.000] (-942.330) (-941.037) (-942.592) * (-945.439) [-941.655] (-941.142) (-941.021) -- 0:00:36
      454000 -- (-944.804) (-944.102) [-943.957] (-942.798) * (-946.998) (-943.023) (-943.002) [-943.119] -- 0:00:36
      454500 -- (-944.643) [-941.602] (-948.104) (-942.843) * (-941.533) (-946.011) [-943.058] (-945.158) -- 0:00:36
      455000 -- [-941.596] (-942.501) (-940.874) (-943.315) * [-941.816] (-946.126) (-942.265) (-945.928) -- 0:00:35

      Average standard deviation of split frequencies: 0.006138

      455500 -- (-940.385) (-943.623) (-941.657) [-943.774] * (-940.270) [-945.308] (-942.504) (-944.256) -- 0:00:35
      456000 -- (-942.050) (-944.128) [-942.739] (-943.111) * (-941.287) (-944.431) [-942.281] (-942.447) -- 0:00:35
      456500 -- (-949.477) [-943.964] (-941.572) (-942.169) * (-942.422) [-944.784] (-943.930) (-940.809) -- 0:00:35
      457000 -- (-942.602) [-944.708] (-941.503) (-944.625) * (-941.877) (-942.717) (-940.775) [-940.167] -- 0:00:35
      457500 -- (-941.821) (-941.213) (-945.018) [-944.645] * (-943.449) (-942.236) [-940.855] (-939.908) -- 0:00:35
      458000 -- [-941.207] (-940.817) (-941.994) (-942.121) * (-947.710) (-943.303) (-944.016) [-940.802] -- 0:00:35
      458500 -- (-945.093) (-940.588) (-941.900) [-940.333] * (-950.464) (-944.653) (-941.762) [-942.530] -- 0:00:35
      459000 -- (-943.463) (-941.481) [-940.173] (-940.609) * (-941.802) (-941.989) (-945.509) [-941.373] -- 0:00:35
      459500 -- [-941.865] (-942.618) (-944.055) (-948.086) * (-941.228) (-942.660) (-946.307) [-942.528] -- 0:00:35
      460000 -- (-941.129) (-942.093) [-943.636] (-941.587) * (-941.088) (-942.524) [-943.099] (-939.986) -- 0:00:35

      Average standard deviation of split frequencies: 0.006652

      460500 -- (-940.488) [-942.284] (-942.288) (-943.424) * (-940.694) (-943.184) [-940.156] (-941.663) -- 0:00:35
      461000 -- [-940.836] (-943.916) (-946.027) (-943.232) * (-941.694) (-950.192) (-941.510) [-941.207] -- 0:00:35
      461500 -- (-943.893) [-940.674] (-946.133) (-942.731) * [-942.811] (-942.480) (-940.984) (-942.263) -- 0:00:36
      462000 -- (-940.446) (-940.347) [-941.823] (-943.973) * (-943.987) (-942.132) [-944.451] (-942.314) -- 0:00:36
      462500 -- (-943.987) (-940.483) (-943.614) [-942.346] * (-942.187) (-943.856) (-942.389) [-941.516] -- 0:00:36
      463000 -- (-943.659) (-943.552) [-941.199] (-941.906) * [-943.111] (-942.775) (-941.225) (-947.737) -- 0:00:35
      463500 -- [-941.904] (-943.138) (-941.562) (-941.747) * (-942.327) (-942.613) [-941.372] (-944.098) -- 0:00:35
      464000 -- (-941.444) (-948.166) [-943.652] (-945.965) * (-940.694) [-940.913] (-942.905) (-941.721) -- 0:00:35
      464500 -- (-941.101) [-941.302] (-939.958) (-944.614) * (-941.079) (-947.273) [-940.777] (-945.559) -- 0:00:35
      465000 -- (-941.250) (-941.564) (-944.110) [-942.081] * (-942.508) (-944.392) (-941.861) [-941.127] -- 0:00:35

      Average standard deviation of split frequencies: 0.006512

      465500 -- (-940.199) (-940.933) (-940.238) [-942.058] * (-942.261) (-944.241) [-941.916] (-944.803) -- 0:00:35
      466000 -- (-940.975) (-941.654) (-942.811) [-942.201] * (-944.823) (-942.829) (-941.431) [-941.978] -- 0:00:35
      466500 -- (-940.462) [-941.650] (-942.299) (-944.489) * (-942.809) (-941.589) (-941.531) [-942.468] -- 0:00:35
      467000 -- (-943.758) (-944.693) [-941.250] (-942.964) * (-943.421) (-940.355) [-944.807] (-940.774) -- 0:00:35
      467500 -- (-941.928) (-947.985) [-943.241] (-942.922) * (-942.783) (-940.976) (-944.165) [-940.721] -- 0:00:35
      468000 -- (-945.056) (-942.319) (-942.517) [-941.446] * (-942.882) (-943.614) (-943.816) [-940.360] -- 0:00:35
      468500 -- (-946.287) [-941.064] (-942.497) (-940.743) * (-942.627) (-941.222) (-945.415) [-942.675] -- 0:00:35
      469000 -- (-946.903) (-942.980) (-941.972) [-940.738] * [-941.271] (-941.333) (-942.245) (-942.259) -- 0:00:35
      469500 -- [-942.440] (-943.421) (-943.607) (-941.954) * (-940.183) [-940.785] (-944.428) (-943.841) -- 0:00:35
      470000 -- (-942.960) (-945.694) (-942.823) [-940.656] * (-941.198) (-941.428) [-943.133] (-941.971) -- 0:00:34

      Average standard deviation of split frequencies: 0.006948

      470500 -- (-943.086) (-943.448) (-943.573) [-943.183] * (-946.502) (-940.687) (-943.648) [-940.882] -- 0:00:34
      471000 -- [-942.109] (-940.141) (-942.420) (-941.099) * (-944.339) (-940.858) [-942.336] (-945.226) -- 0:00:34
      471500 -- (-941.603) (-942.364) (-940.559) [-941.162] * (-942.037) (-940.855) [-942.147] (-942.826) -- 0:00:34
      472000 -- (-942.063) (-940.245) [-941.933] (-942.805) * (-943.702) (-941.817) [-942.813] (-942.103) -- 0:00:34
      472500 -- (-945.911) (-940.973) (-943.400) [-941.039] * (-943.736) [-943.463] (-941.280) (-940.319) -- 0:00:34
      473000 -- (-941.991) (-940.822) [-943.539] (-941.599) * (-943.618) (-948.099) (-941.430) [-941.088] -- 0:00:34
      473500 -- (-941.897) (-940.751) (-942.124) [-942.278] * [-943.541] (-943.686) (-942.156) (-945.752) -- 0:00:34
      474000 -- [-944.974] (-940.566) (-941.606) (-940.562) * (-941.983) [-943.246] (-941.682) (-941.199) -- 0:00:34
      474500 -- (-940.829) (-941.308) (-941.159) [-943.969] * (-941.808) [-942.074] (-940.604) (-943.844) -- 0:00:34
      475000 -- [-943.695] (-943.000) (-940.680) (-941.344) * (-948.665) (-943.899) [-940.346] (-941.104) -- 0:00:34

      Average standard deviation of split frequencies: 0.006809

      475500 -- (-944.707) (-944.387) [-943.463] (-941.097) * (-944.276) (-943.654) [-941.846] (-941.280) -- 0:00:34
      476000 -- (-945.158) (-941.750) [-940.925] (-941.170) * [-940.218] (-944.266) (-942.532) (-941.500) -- 0:00:34
      476500 -- (-942.056) (-941.120) [-942.829] (-940.288) * [-941.461] (-945.629) (-944.596) (-942.866) -- 0:00:34
      477000 -- [-942.237] (-941.730) (-940.336) (-940.815) * [-943.340] (-942.028) (-944.804) (-941.827) -- 0:00:33
      477500 -- (-946.198) [-943.273] (-941.438) (-943.946) * [-941.063] (-942.921) (-942.301) (-943.367) -- 0:00:35
      478000 -- (-941.433) (-942.080) (-942.742) [-940.425] * (-941.538) [-942.160] (-944.015) (-943.251) -- 0:00:34
      478500 -- (-943.698) [-941.203] (-943.617) (-942.766) * (-941.788) [-942.465] (-947.788) (-940.590) -- 0:00:34
      479000 -- [-943.243] (-943.541) (-943.485) (-942.521) * [-946.529] (-942.407) (-941.885) (-942.197) -- 0:00:34
      479500 -- [-941.489] (-943.609) (-947.148) (-943.754) * [-943.362] (-941.132) (-945.493) (-943.166) -- 0:00:34
      480000 -- (-940.477) (-946.585) [-943.538] (-941.339) * (-943.078) (-942.050) [-946.051] (-943.477) -- 0:00:34

      Average standard deviation of split frequencies: 0.007049

      480500 -- (-940.839) (-942.056) (-942.370) [-940.455] * (-942.286) (-942.911) [-944.620] (-943.546) -- 0:00:34
      481000 -- (-942.172) (-940.806) [-942.016] (-942.139) * [-942.543] (-942.131) (-942.180) (-946.021) -- 0:00:34
      481500 -- (-943.293) (-940.893) (-941.293) [-945.188] * (-942.380) (-943.589) (-942.430) [-943.300] -- 0:00:34
      482000 -- (-941.293) (-943.064) (-941.229) [-941.028] * (-940.378) (-941.401) [-944.151] (-943.559) -- 0:00:34
      482500 -- (-944.868) (-944.733) [-943.171] (-942.325) * (-941.173) (-941.570) (-941.908) [-943.352] -- 0:00:34
      483000 -- (-943.625) [-940.983] (-943.276) (-940.936) * (-940.991) [-943.314] (-941.563) (-941.283) -- 0:00:34
      483500 -- (-944.586) (-940.679) [-941.995] (-949.909) * (-940.841) [-942.543] (-951.822) (-943.962) -- 0:00:34
      484000 -- (-945.419) (-944.407) [-941.864] (-948.189) * (-943.027) (-941.893) [-940.454] (-947.498) -- 0:00:34
      484500 -- (-943.574) (-945.983) [-942.341] (-942.570) * (-943.283) (-942.775) (-942.452) [-947.739] -- 0:00:34
      485000 -- (-945.175) (-941.957) [-940.601] (-944.864) * (-941.068) [-945.822] (-942.690) (-940.785) -- 0:00:33

      Average standard deviation of split frequencies: 0.006850

      485500 -- (-941.837) [-940.715] (-940.419) (-942.821) * (-942.410) (-942.134) (-941.940) [-941.623] -- 0:00:33
      486000 -- [-943.038] (-940.183) (-939.964) (-941.202) * (-942.542) [-942.107] (-942.225) (-941.466) -- 0:00:33
      486500 -- [-943.591] (-940.217) (-940.039) (-943.175) * [-942.166] (-943.264) (-947.032) (-940.919) -- 0:00:33
      487000 -- (-943.073) (-940.707) [-939.994] (-944.154) * (-942.785) (-949.333) (-941.841) [-943.815] -- 0:00:33
      487500 -- (-940.913) [-942.550] (-940.651) (-943.237) * (-943.424) [-946.375] (-941.006) (-941.524) -- 0:00:33
      488000 -- [-940.557] (-940.943) (-942.102) (-945.045) * (-942.499) [-943.114] (-941.256) (-943.064) -- 0:00:33
      488500 -- [-940.708] (-941.609) (-944.492) (-945.828) * (-946.475) (-945.622) [-943.260] (-943.324) -- 0:00:33
      489000 -- (-941.654) (-941.408) (-940.113) [-941.384] * (-942.474) (-942.206) [-943.160] (-941.110) -- 0:00:33
      489500 -- (-944.005) (-941.020) [-939.917] (-941.524) * (-943.731) (-941.005) (-942.007) [-942.240] -- 0:00:33
      490000 -- (-940.896) [-941.685] (-942.835) (-942.484) * (-943.008) (-942.969) [-942.352] (-940.954) -- 0:00:33

      Average standard deviation of split frequencies: 0.006965

      490500 -- (-940.770) [-941.519] (-947.097) (-940.876) * (-942.998) [-944.300] (-942.718) (-943.207) -- 0:00:33
      491000 -- (-941.564) (-941.356) (-944.771) [-945.390] * (-943.794) (-941.492) [-943.037] (-945.445) -- 0:00:33
      491500 -- (-943.075) (-941.742) [-944.386] (-942.458) * [-942.984] (-942.313) (-942.323) (-941.647) -- 0:00:33
      492000 -- (-942.927) [-945.023] (-941.536) (-943.850) * [-940.488] (-942.211) (-941.181) (-940.481) -- 0:00:33
      492500 -- (-942.069) (-941.809) (-942.817) [-942.337] * [-944.946] (-942.232) (-941.990) (-944.673) -- 0:00:32
      493000 -- [-941.872] (-941.420) (-940.325) (-942.155) * (-942.703) (-945.303) (-944.102) [-943.590] -- 0:00:32
      493500 -- [-941.517] (-942.453) (-943.807) (-944.710) * (-942.943) (-941.943) [-941.950] (-944.868) -- 0:00:32
      494000 -- (-940.030) [-942.118] (-945.925) (-943.264) * (-942.648) (-946.029) (-943.843) [-943.006] -- 0:00:33
      494500 -- (-940.029) (-941.090) (-943.410) [-947.300] * (-943.622) [-941.450] (-941.407) (-943.444) -- 0:00:33
      495000 -- (-940.616) (-941.324) (-942.000) [-942.412] * (-940.154) (-940.517) (-942.396) [-940.985] -- 0:00:33

      Average standard deviation of split frequencies: 0.006950

      495500 -- (-942.080) [-945.098] (-942.306) (-942.124) * (-941.891) (-941.181) (-942.041) [-942.888] -- 0:00:33
      496000 -- (-941.883) (-945.938) (-941.680) [-942.116] * (-944.567) [-940.470] (-941.437) (-941.646) -- 0:00:33
      496500 -- [-943.883] (-943.712) (-943.587) (-942.054) * (-943.724) (-940.904) [-942.413] (-940.498) -- 0:00:33
      497000 -- [-943.997] (-943.368) (-943.235) (-941.302) * (-942.646) [-941.138] (-943.417) (-943.025) -- 0:00:33
      497500 -- (-943.742) [-940.551] (-941.218) (-941.222) * (-943.032) (-941.314) (-942.003) [-942.260] -- 0:00:33
      498000 -- (-940.809) [-941.716] (-941.842) (-942.666) * (-945.117) (-941.190) [-941.834] (-940.375) -- 0:00:33
      498500 -- (-944.856) (-941.721) [-940.246] (-941.574) * (-943.876) [-941.014] (-942.344) (-942.034) -- 0:00:33
      499000 -- (-940.425) (-944.411) [-942.089] (-943.346) * (-943.028) (-944.187) (-941.747) [-947.022] -- 0:00:33
      499500 -- (-940.395) (-942.073) (-945.618) [-943.022] * (-944.246) (-942.963) (-942.269) [-943.522] -- 0:00:33
      500000 -- (-944.245) (-945.909) (-946.131) [-945.313] * (-942.273) (-941.096) (-944.758) [-943.169] -- 0:00:33

      Average standard deviation of split frequencies: 0.007120

      500500 -- (-942.372) [-944.508] (-942.951) (-947.260) * [-941.741] (-942.291) (-943.885) (-941.223) -- 0:00:32
      501000 -- (-943.260) (-944.032) [-940.548] (-942.280) * (-942.136) [-940.315] (-943.466) (-941.631) -- 0:00:32
      501500 -- (-946.144) (-945.587) [-941.588] (-943.965) * (-941.283) (-941.106) (-943.886) [-941.141] -- 0:00:32
      502000 -- [-942.633] (-943.766) (-942.205) (-948.491) * (-941.181) (-941.410) (-944.599) [-943.749] -- 0:00:32
      502500 -- [-942.224] (-944.784) (-946.293) (-944.512) * (-941.071) [-940.551] (-942.576) (-943.410) -- 0:00:32
      503000 -- (-943.471) [-946.873] (-942.025) (-944.329) * (-942.763) [-940.612] (-942.819) (-942.819) -- 0:00:32
      503500 -- (-943.026) (-941.481) (-943.023) [-940.682] * [-941.231] (-941.897) (-946.456) (-945.746) -- 0:00:32
      504000 -- (-943.419) [-941.711] (-943.857) (-940.698) * (-942.184) (-944.019) (-947.017) [-946.356] -- 0:00:32
      504500 -- (-942.316) [-943.667] (-940.192) (-944.241) * (-941.463) (-940.106) [-942.459] (-942.868) -- 0:00:32
      505000 -- [-940.740] (-943.349) (-940.044) (-943.770) * (-943.492) (-941.186) (-946.823) [-940.394] -- 0:00:32

      Average standard deviation of split frequencies: 0.007220

      505500 -- [-942.627] (-944.344) (-942.861) (-942.710) * [-942.320] (-942.546) (-941.884) (-942.556) -- 0:00:32
      506000 -- (-941.546) (-944.831) (-941.630) [-942.154] * [-941.661] (-942.712) (-942.330) (-942.931) -- 0:00:32
      506500 -- (-940.066) [-941.427] (-941.378) (-942.121) * (-941.952) (-946.548) (-942.863) [-942.700] -- 0:00:32
      507000 -- [-941.426] (-941.869) (-940.881) (-943.323) * (-942.873) (-944.320) (-943.004) [-943.156] -- 0:00:32
      507500 -- (-946.051) (-942.415) (-942.444) [-945.036] * (-943.060) [-946.061] (-942.927) (-940.993) -- 0:00:32
      508000 -- [-941.820] (-945.153) (-941.284) (-943.844) * (-941.506) (-940.565) (-943.550) [-943.098] -- 0:00:31
      508500 -- (-941.954) (-947.709) (-941.509) [-942.541] * (-942.398) (-941.389) (-942.072) [-943.098] -- 0:00:31
      509000 -- (-940.687) (-941.268) [-943.514] (-940.743) * (-945.596) [-943.115] (-942.508) (-941.828) -- 0:00:31
      509500 -- (-944.500) [-940.517] (-946.315) (-941.957) * (-945.573) [-943.207] (-943.254) (-942.761) -- 0:00:31
      510000 -- (-943.879) (-940.940) (-946.205) [-944.037] * [-942.870] (-940.745) (-942.994) (-940.791) -- 0:00:32

      Average standard deviation of split frequencies: 0.007327

      510500 -- [-945.832] (-941.538) (-941.860) (-944.951) * [-943.058] (-946.818) (-942.769) (-941.356) -- 0:00:32
      511000 -- [-943.466] (-941.440) (-945.203) (-941.440) * (-943.447) [-941.537] (-941.418) (-943.077) -- 0:00:32
      511500 -- (-943.848) [-941.315] (-944.715) (-944.838) * (-941.084) (-941.412) (-944.971) [-941.903] -- 0:00:32
      512000 -- (-941.239) (-941.987) [-943.081] (-943.337) * [-940.305] (-942.409) (-941.933) (-945.708) -- 0:00:32
      512500 -- [-940.171] (-940.529) (-944.737) (-947.699) * (-940.498) [-942.931] (-943.168) (-950.638) -- 0:00:32
      513000 -- (-940.424) [-942.397] (-941.256) (-940.879) * (-944.878) [-943.199] (-944.586) (-943.161) -- 0:00:32
      513500 -- [-941.950] (-942.937) (-940.973) (-940.297) * [-940.570] (-940.521) (-946.244) (-945.052) -- 0:00:32
      514000 -- (-940.934) (-942.774) (-942.348) [-941.979] * [-940.126] (-941.041) (-945.018) (-951.092) -- 0:00:32
      514500 -- (-941.347) [-940.713] (-942.343) (-942.455) * (-940.423) (-941.658) (-944.582) [-941.942] -- 0:00:32
      515000 -- (-940.615) (-941.084) (-944.120) [-942.173] * (-940.639) (-940.518) [-940.336] (-940.009) -- 0:00:32

      Average standard deviation of split frequencies: 0.007765

      515500 -- (-944.194) (-941.002) (-940.337) [-940.898] * (-941.805) (-940.672) [-941.362] (-942.326) -- 0:00:31
      516000 -- (-942.542) (-941.732) (-941.667) [-941.204] * [-940.949] (-941.523) (-941.425) (-944.282) -- 0:00:31
      516500 -- [-941.512] (-942.976) (-942.178) (-942.696) * (-942.257) [-942.794] (-942.736) (-942.780) -- 0:00:31
      517000 -- (-941.526) (-944.089) (-940.890) [-941.693] * (-942.104) (-943.821) [-943.002] (-943.368) -- 0:00:31
      517500 -- (-941.121) [-942.534] (-940.906) (-941.748) * [-944.558] (-943.106) (-943.756) (-942.737) -- 0:00:31
      518000 -- (-941.036) (-943.818) [-941.562] (-941.712) * [-943.320] (-944.832) (-943.050) (-943.667) -- 0:00:31
      518500 -- (-940.648) (-942.706) (-943.146) [-942.954] * (-942.447) (-945.329) [-943.104] (-941.555) -- 0:00:31
      519000 -- [-941.438] (-944.206) (-943.026) (-942.073) * (-941.281) [-944.036] (-944.091) (-941.511) -- 0:00:31
      519500 -- (-942.089) (-943.765) [-945.014] (-941.305) * (-944.821) [-945.697] (-941.714) (-943.311) -- 0:00:31
      520000 -- [-947.071] (-942.166) (-940.255) (-940.947) * (-946.957) (-944.789) [-944.271] (-944.530) -- 0:00:31

      Average standard deviation of split frequencies: 0.007526

      520500 -- (-942.966) (-941.715) (-942.016) [-943.362] * (-944.308) (-942.903) [-942.743] (-947.601) -- 0:00:31
      521000 -- (-941.950) (-940.511) (-940.881) [-943.033] * [-943.192] (-943.633) (-941.935) (-945.316) -- 0:00:31
      521500 -- (-945.280) (-944.457) [-943.823] (-943.735) * [-948.187] (-943.074) (-941.754) (-945.967) -- 0:00:31
      522000 -- (-945.181) [-941.402] (-941.522) (-943.362) * (-944.419) (-941.637) (-942.733) [-941.445] -- 0:00:31
      522500 -- [-940.146] (-945.954) (-942.066) (-942.710) * [-945.204] (-942.301) (-942.560) (-940.020) -- 0:00:31
      523000 -- [-942.426] (-948.868) (-941.224) (-940.623) * (-944.482) (-940.833) (-940.354) [-942.060] -- 0:00:31
      523500 -- (-943.736) (-943.893) (-942.310) [-941.027] * (-941.497) (-940.833) [-943.192] (-943.030) -- 0:00:30
      524000 -- [-942.532] (-943.043) (-941.192) (-946.616) * (-941.324) (-940.751) [-942.390] (-945.936) -- 0:00:30
      524500 -- (-943.104) [-943.734] (-940.802) (-946.142) * (-944.833) (-943.273) [-941.676] (-944.541) -- 0:00:30
      525000 -- (-943.926) (-941.209) (-943.625) [-945.057] * [-940.752] (-941.792) (-943.745) (-947.025) -- 0:00:30

      Average standard deviation of split frequencies: 0.007562

      525500 -- (-947.107) [-941.098] (-943.425) (-943.458) * [-940.752] (-942.504) (-942.109) (-944.585) -- 0:00:30
      526000 -- (-941.225) [-940.761] (-941.867) (-941.516) * (-943.210) [-942.328] (-942.775) (-941.783) -- 0:00:30
      526500 -- [-943.584] (-940.494) (-942.948) (-940.515) * (-941.746) (-944.906) [-942.641] (-942.279) -- 0:00:31
      527000 -- (-940.491) [-940.964] (-943.190) (-940.441) * (-942.175) (-944.148) [-941.247] (-943.181) -- 0:00:31
      527500 -- [-940.902] (-943.390) (-941.376) (-940.559) * (-942.005) (-942.446) (-943.966) [-942.622] -- 0:00:31
      528000 -- [-940.936] (-944.188) (-941.969) (-942.330) * (-943.436) (-943.815) (-941.464) [-942.757] -- 0:00:31
      528500 -- (-941.504) [-942.880] (-947.124) (-941.295) * [-940.913] (-944.696) (-943.268) (-944.433) -- 0:00:31
      529000 -- [-942.427] (-943.469) (-940.566) (-943.324) * [-941.892] (-941.300) (-942.625) (-940.760) -- 0:00:31
      529500 -- [-941.748] (-940.787) (-941.717) (-943.352) * (-942.269) [-941.742] (-943.002) (-944.614) -- 0:00:31
      530000 -- [-941.083] (-943.355) (-940.553) (-942.593) * (-947.934) (-944.280) [-944.133] (-940.284) -- 0:00:31

      Average standard deviation of split frequencies: 0.008050

      530500 -- [-943.752] (-941.120) (-943.022) (-940.940) * (-947.145) [-942.879] (-943.502) (-942.316) -- 0:00:30
      531000 -- (-944.305) (-944.343) (-943.462) [-941.040] * (-943.104) [-950.656] (-943.266) (-941.482) -- 0:00:30
      531500 -- [-942.656] (-944.280) (-943.342) (-942.701) * (-941.123) (-940.890) (-942.378) [-941.088] -- 0:00:30
      532000 -- (-944.803) [-944.937] (-944.014) (-944.193) * (-941.847) (-941.640) (-944.548) [-941.217] -- 0:00:30
      532500 -- (-940.824) (-943.814) [-941.014] (-944.726) * [-944.623] (-941.348) (-940.951) (-942.523) -- 0:00:30
      533000 -- (-940.139) (-946.444) (-941.480) [-944.234] * (-942.432) (-941.411) [-942.736] (-944.983) -- 0:00:30
      533500 -- (-942.272) [-940.429] (-941.840) (-942.153) * (-944.607) [-942.197] (-941.127) (-943.159) -- 0:00:30
      534000 -- (-943.967) (-940.396) (-941.555) [-941.066] * (-941.134) [-940.665] (-940.617) (-942.666) -- 0:00:30
      534500 -- (-944.010) (-940.596) (-940.654) [-941.334] * [-941.073] (-940.893) (-941.792) (-941.042) -- 0:00:30
      535000 -- (-942.827) (-941.185) [-941.579] (-941.439) * (-941.174) (-941.689) (-944.598) [-944.140] -- 0:00:30

      Average standard deviation of split frequencies: 0.007915

      535500 -- (-942.198) [-940.383] (-944.112) (-940.882) * (-940.680) (-940.314) [-944.278] (-947.635) -- 0:00:30
      536000 -- (-947.725) (-941.291) [-943.591] (-946.429) * [-941.509] (-943.061) (-944.919) (-941.940) -- 0:00:30
      536500 -- [-943.260] (-945.112) (-942.316) (-940.750) * (-942.023) (-941.863) (-940.408) [-946.883] -- 0:00:30
      537000 -- (-944.426) (-944.374) (-942.450) [-942.266] * (-945.744) (-946.889) [-942.850] (-948.090) -- 0:00:30
      537500 -- (-941.051) [-941.104] (-941.206) (-949.202) * (-943.699) [-945.413] (-940.115) (-943.088) -- 0:00:30
      538000 -- (-940.759) (-944.591) [-940.643] (-943.401) * (-945.573) (-941.009) (-940.592) [-944.603] -- 0:00:30
      538500 -- (-940.968) [-940.648] (-940.772) (-942.900) * (-949.624) [-940.670] (-941.789) (-942.036) -- 0:00:29
      539000 -- (-941.660) (-941.966) (-942.010) [-942.499] * (-941.713) [-940.760] (-942.327) (-940.591) -- 0:00:29
      539500 -- (-941.431) (-943.613) (-940.628) [-942.984] * (-943.425) (-944.133) [-941.162] (-940.911) -- 0:00:29
      540000 -- [-940.814] (-942.192) (-944.866) (-942.722) * (-942.401) [-945.301] (-944.223) (-940.485) -- 0:00:29

      Average standard deviation of split frequencies: 0.008501

      540500 -- (-942.624) [-945.514] (-941.812) (-942.671) * [-941.608] (-944.798) (-940.967) (-941.525) -- 0:00:29
      541000 -- (-940.735) (-945.947) [-942.812] (-942.242) * [-940.575] (-941.222) (-941.742) (-941.972) -- 0:00:29
      541500 -- (-940.183) [-944.501] (-944.362) (-943.895) * (-944.480) (-943.694) [-940.608] (-941.543) -- 0:00:29
      542000 -- (-942.328) (-943.666) [-945.875] (-943.427) * (-940.208) (-941.772) [-941.323] (-942.231) -- 0:00:29
      542500 -- [-940.915] (-946.799) (-947.673) (-944.212) * (-943.412) [-941.472] (-944.687) (-942.068) -- 0:00:29
      543000 -- (-942.607) (-946.040) (-951.987) [-942.956] * (-943.486) (-941.656) [-942.889] (-943.530) -- 0:00:29
      543500 -- (-943.573) (-943.860) [-942.508] (-941.720) * [-944.766] (-940.237) (-944.679) (-940.543) -- 0:00:30
      544000 -- (-942.709) (-942.717) (-943.091) [-941.634] * (-945.055) (-942.368) (-944.118) [-943.294] -- 0:00:30
      544500 -- (-942.342) (-945.060) [-941.363] (-940.544) * (-943.437) (-942.509) (-942.123) [-945.922] -- 0:00:30
      545000 -- (-940.465) (-944.123) [-941.300] (-941.432) * (-947.454) [-945.067] (-943.757) (-946.592) -- 0:00:30

      Average standard deviation of split frequencies: 0.008742

      545500 -- [-941.871] (-940.829) (-942.989) (-941.192) * (-941.707) [-941.806] (-944.050) (-941.156) -- 0:00:29
      546000 -- (-941.828) (-940.444) (-943.016) [-941.075] * (-942.006) (-943.450) (-944.200) [-941.402] -- 0:00:29
      546500 -- (-944.378) (-943.010) (-943.221) [-940.527] * (-941.483) (-942.019) (-943.773) [-943.633] -- 0:00:29
      547000 -- [-944.447] (-940.877) (-945.065) (-940.585) * (-940.869) (-946.650) [-941.234] (-942.309) -- 0:00:29
      547500 -- (-942.668) (-941.770) (-941.304) [-941.758] * (-940.956) (-942.910) (-939.957) [-942.557] -- 0:00:29
      548000 -- (-942.419) (-945.030) [-942.265] (-940.247) * (-941.396) [-941.154] (-940.975) (-947.159) -- 0:00:29
      548500 -- (-940.609) (-941.831) (-942.097) [-943.094] * (-941.088) (-944.579) [-940.862] (-941.731) -- 0:00:29
      549000 -- (-943.509) [-944.233] (-944.547) (-941.857) * (-940.968) (-940.780) [-944.938] (-943.177) -- 0:00:29
      549500 -- [-942.386] (-943.561) (-942.800) (-940.697) * (-940.968) (-940.999) [-942.455] (-941.986) -- 0:00:29
      550000 -- [-943.916] (-943.205) (-940.730) (-943.688) * (-940.968) (-940.829) (-940.339) [-941.304] -- 0:00:29

      Average standard deviation of split frequencies: 0.008507

      550500 -- (-944.294) [-942.770] (-941.231) (-944.025) * (-940.856) (-941.015) (-941.969) [-941.984] -- 0:00:29
      551000 -- [-942.602] (-944.778) (-942.366) (-941.249) * (-943.231) (-945.122) (-941.135) [-942.030] -- 0:00:29
      551500 -- (-941.003) (-942.182) (-943.243) [-942.354] * (-943.040) (-949.505) [-942.856] (-941.563) -- 0:00:29
      552000 -- (-941.745) (-941.646) (-940.569) [-942.514] * (-941.300) (-941.396) (-943.935) [-942.600] -- 0:00:29
      552500 -- (-941.737) (-940.341) [-940.703] (-944.082) * (-943.345) [-941.555] (-941.820) (-943.174) -- 0:00:29
      553000 -- [-941.782] (-943.814) (-941.894) (-940.918) * (-943.053) (-942.795) [-941.300] (-944.697) -- 0:00:29
      553500 -- (-943.481) [-940.727] (-941.873) (-943.443) * [-945.267] (-946.508) (-943.354) (-943.161) -- 0:00:29
      554000 -- [-942.532] (-941.196) (-940.520) (-942.018) * [-943.035] (-943.005) (-946.091) (-942.245) -- 0:00:28
      554500 -- (-943.678) (-941.262) [-941.166] (-944.577) * [-941.165] (-943.965) (-949.616) (-942.472) -- 0:00:28
      555000 -- (-942.170) (-941.104) [-941.870] (-942.771) * (-940.964) [-944.948] (-952.509) (-943.475) -- 0:00:28

      Average standard deviation of split frequencies: 0.009167

      555500 -- [-941.526] (-942.962) (-946.205) (-943.304) * (-943.734) (-944.698) [-945.235] (-944.152) -- 0:00:28
      556000 -- (-940.873) [-943.681] (-942.358) (-942.145) * (-947.967) [-943.803] (-943.119) (-942.722) -- 0:00:28
      556500 -- [-941.088] (-942.609) (-941.956) (-944.818) * (-945.317) [-940.674] (-940.810) (-942.830) -- 0:00:28
      557000 -- [-940.479] (-942.957) (-941.439) (-942.067) * (-941.666) [-940.520] (-941.606) (-942.275) -- 0:00:28
      557500 -- [-943.738] (-941.475) (-942.257) (-942.484) * (-941.084) (-941.318) (-940.561) [-942.616] -- 0:00:28
      558000 -- (-941.223) [-940.559] (-940.569) (-941.710) * [-940.688] (-941.855) (-942.379) (-943.967) -- 0:00:28
      558500 -- (-947.305) (-944.818) (-942.277) [-941.755] * (-941.195) [-944.883] (-943.307) (-943.814) -- 0:00:28
      559000 -- (-945.197) [-944.037] (-940.393) (-943.571) * (-943.927) (-943.052) (-943.470) [-940.665] -- 0:00:28
      559500 -- (-941.519) [-940.786] (-943.206) (-942.137) * [-941.936] (-944.975) (-942.190) (-940.397) -- 0:00:29
      560000 -- (-945.255) [-942.352] (-944.444) (-943.680) * (-940.941) [-941.686] (-941.671) (-940.367) -- 0:00:29

      Average standard deviation of split frequencies: 0.009196

      560500 -- [-941.397] (-944.384) (-941.267) (-943.253) * (-941.098) (-941.531) (-942.298) [-942.759] -- 0:00:29
      561000 -- (-945.319) (-943.438) (-940.451) [-942.300] * (-944.874) [-942.584] (-941.720) (-942.765) -- 0:00:28
      561500 -- (-943.878) (-941.224) [-940.333] (-941.602) * (-943.803) (-942.995) (-942.459) [-944.907] -- 0:00:28
      562000 -- (-941.851) (-940.572) (-942.367) [-941.897] * (-941.878) (-942.269) [-941.694] (-944.942) -- 0:00:28
      562500 -- (-942.755) (-941.794) (-941.600) [-940.193] * [-942.689] (-942.461) (-942.333) (-940.240) -- 0:00:28
      563000 -- (-942.160) [-940.877] (-941.542) (-940.484) * [-941.589] (-942.055) (-940.341) (-939.985) -- 0:00:28
      563500 -- [-941.477] (-940.693) (-942.865) (-940.996) * [-940.091] (-944.696) (-941.597) (-942.136) -- 0:00:28
      564000 -- (-942.027) (-940.266) (-945.770) [-946.435] * (-942.504) (-943.705) (-943.724) [-940.332] -- 0:00:28
      564500 -- [-940.459] (-940.628) (-941.928) (-941.990) * (-942.669) (-941.347) (-941.663) [-941.167] -- 0:00:28
      565000 -- (-948.278) (-940.893) [-942.139] (-941.110) * [-941.457] (-941.445) (-944.248) (-942.667) -- 0:00:28

      Average standard deviation of split frequencies: 0.009370

      565500 -- [-947.997] (-945.642) (-942.325) (-941.894) * (-942.926) (-941.919) (-942.232) [-940.884] -- 0:00:28
      566000 -- [-948.058] (-940.943) (-944.794) (-940.640) * (-942.934) (-941.712) (-942.611) [-940.782] -- 0:00:28
      566500 -- (-941.589) (-940.791) [-940.724] (-943.613) * (-941.313) [-942.479] (-942.967) (-941.344) -- 0:00:28
      567000 -- (-941.395) (-941.579) (-943.170) [-942.740] * (-942.016) (-940.861) [-943.195] (-944.695) -- 0:00:28
      567500 -- (-942.326) (-941.174) (-943.641) [-943.654] * (-944.292) (-940.685) [-940.521] (-944.661) -- 0:00:28
      568000 -- (-946.100) (-941.374) [-940.113] (-941.218) * (-944.444) (-941.487) (-942.858) [-943.281] -- 0:00:28
      568500 -- (-941.067) [-942.441] (-941.758) (-942.451) * (-943.841) [-940.662] (-943.029) (-945.074) -- 0:00:28
      569000 -- (-941.982) [-941.124] (-941.434) (-941.891) * (-944.301) [-941.115] (-940.764) (-944.248) -- 0:00:28
      569500 -- [-943.215] (-941.164) (-941.887) (-942.398) * [-940.895] (-941.836) (-940.901) (-941.179) -- 0:00:27
      570000 -- (-947.533) [-941.025] (-945.430) (-942.169) * (-943.305) (-941.507) [-942.640] (-941.261) -- 0:00:27

      Average standard deviation of split frequencies: 0.009758

      570500 -- (-944.330) (-943.993) [-944.691] (-940.172) * (-943.926) (-941.715) [-942.199] (-944.992) -- 0:00:27
      571000 -- (-952.899) [-943.148] (-943.338) (-940.152) * [-941.316] (-940.169) (-941.828) (-944.920) -- 0:00:27
      571500 -- [-944.625] (-941.156) (-943.243) (-941.856) * [-942.878] (-942.778) (-943.548) (-941.801) -- 0:00:27
      572000 -- (-940.597) (-942.479) (-947.921) [-941.859] * (-942.030) [-940.106] (-945.904) (-944.758) -- 0:00:27
      572500 -- (-941.391) (-944.896) (-947.212) [-943.638] * (-944.596) (-940.895) (-944.553) [-943.318] -- 0:00:27
      573000 -- [-942.737] (-944.186) (-943.191) (-943.225) * (-945.616) (-947.865) (-945.793) [-941.164] -- 0:00:27
      573500 -- (-943.558) [-941.960] (-941.876) (-944.799) * (-943.230) (-941.916) (-941.109) [-940.322] -- 0:00:27
      574000 -- (-942.446) (-942.433) (-942.354) [-944.724] * (-943.944) (-942.051) (-941.065) [-940.503] -- 0:00:27
      574500 -- [-941.311] (-940.873) (-945.692) (-941.914) * (-944.244) (-940.543) (-941.177) [-942.586] -- 0:00:27
      575000 -- (-946.863) [-940.953] (-946.102) (-941.919) * [-940.291] (-943.733) (-942.052) (-942.239) -- 0:00:27

      Average standard deviation of split frequencies: 0.010384

      575500 -- [-942.919] (-941.543) (-942.187) (-941.670) * (-940.460) (-942.230) (-940.879) [-940.971] -- 0:00:27
      576000 -- (-946.373) [-943.885] (-942.053) (-944.945) * (-941.033) [-941.657] (-947.307) (-941.283) -- 0:00:27
      576500 -- (-943.681) (-942.047) [-941.383] (-948.571) * (-941.229) [-940.942] (-941.339) (-940.822) -- 0:00:27
      577000 -- (-941.415) (-942.041) [-942.291] (-943.474) * [-944.124] (-945.169) (-944.128) (-940.673) -- 0:00:27
      577500 -- (-942.735) (-947.452) [-941.566] (-940.765) * (-944.990) (-946.388) [-943.819] (-943.567) -- 0:00:27
      578000 -- [-941.946] (-943.187) (-942.950) (-940.689) * [-943.738] (-941.636) (-941.933) (-947.495) -- 0:00:27
      578500 -- [-943.647] (-942.821) (-945.499) (-941.898) * (-941.440) (-948.045) (-942.314) [-942.440] -- 0:00:27
      579000 -- [-942.535] (-941.263) (-941.318) (-946.178) * (-940.084) (-943.458) (-944.093) [-941.344] -- 0:00:27
      579500 -- [-941.871] (-941.158) (-941.477) (-944.660) * [-942.841] (-943.238) (-943.759) (-941.642) -- 0:00:27
      580000 -- (-943.549) (-942.827) [-940.810] (-942.183) * (-943.701) (-945.045) [-940.957] (-942.046) -- 0:00:27

      Average standard deviation of split frequencies: 0.010503

      580500 -- (-941.170) (-940.409) [-942.557] (-942.216) * (-941.929) (-945.934) (-941.336) [-942.156] -- 0:00:27
      581000 -- (-943.084) (-942.156) [-941.981] (-942.730) * (-940.965) (-944.295) [-940.325] (-946.137) -- 0:00:27
      581500 -- (-945.602) (-941.684) [-941.896] (-941.979) * (-944.251) (-946.197) (-940.677) [-940.955] -- 0:00:27
      582000 -- (-945.814) (-941.922) (-944.498) [-944.844] * (-943.341) (-940.800) (-940.809) [-940.900] -- 0:00:27
      582500 -- [-942.581] (-946.204) (-942.024) (-941.218) * (-940.906) (-943.989) [-941.078] (-945.543) -- 0:00:27
      583000 -- (-941.509) [-942.864] (-940.772) (-940.544) * (-944.316) (-941.454) [-942.475] (-945.505) -- 0:00:27
      583500 -- (-947.974) [-942.640] (-941.625) (-940.274) * (-944.451) [-940.530] (-943.373) (-943.480) -- 0:00:27
      584000 -- (-949.169) (-944.590) (-941.718) [-945.084] * [-940.626] (-940.643) (-943.257) (-943.939) -- 0:00:27
      584500 -- [-944.770] (-943.111) (-942.900) (-944.405) * (-946.941) [-944.429] (-941.666) (-942.372) -- 0:00:27
      585000 -- (-942.634) [-943.785] (-945.276) (-941.317) * (-946.667) (-943.140) [-941.046] (-943.736) -- 0:00:26

      Average standard deviation of split frequencies: 0.009955

      585500 -- (-944.193) [-942.202] (-943.737) (-941.309) * (-943.844) [-941.351] (-943.462) (-943.258) -- 0:00:26
      586000 -- (-942.343) [-943.325] (-953.261) (-946.930) * (-946.010) (-945.140) (-942.546) [-942.737] -- 0:00:26
      586500 -- (-946.180) (-942.015) (-950.213) [-942.805] * (-941.850) [-939.979] (-944.820) (-942.425) -- 0:00:26
      587000 -- (-943.335) [-941.633] (-941.212) (-943.423) * (-942.896) [-940.921] (-944.505) (-943.254) -- 0:00:26
      587500 -- (-941.497) (-942.194) [-943.885] (-945.062) * (-946.154) (-940.905) (-942.660) [-944.454] -- 0:00:26
      588000 -- (-947.412) (-942.175) (-944.888) [-942.061] * (-946.301) (-941.558) (-944.475) [-944.023] -- 0:00:26
      588500 -- [-941.618] (-943.437) (-941.672) (-941.462) * (-949.893) (-940.347) [-941.223] (-942.488) -- 0:00:26
      589000 -- (-942.523) (-943.411) [-944.616] (-940.176) * (-944.746) (-941.319) [-942.729] (-943.677) -- 0:00:26
      589500 -- (-942.801) (-943.576) [-941.623] (-940.544) * (-940.941) [-940.630] (-943.453) (-941.419) -- 0:00:26
      590000 -- (-943.720) [-945.092] (-944.009) (-942.154) * (-941.207) (-940.623) (-945.848) [-941.638] -- 0:00:26

      Average standard deviation of split frequencies: 0.009727

      590500 -- (-947.128) (-943.969) (-941.816) [-941.830] * (-949.869) (-942.108) (-942.514) [-941.466] -- 0:00:26
      591000 -- (-944.410) (-943.718) [-944.742] (-941.453) * (-942.061) [-942.412] (-942.767) (-940.603) -- 0:00:26
      591500 -- [-942.685] (-945.122) (-947.089) (-942.284) * (-942.595) (-941.136) [-941.554] (-941.961) -- 0:00:26
      592000 -- (-940.442) [-945.571] (-941.519) (-942.693) * (-941.219) [-942.622] (-942.818) (-942.511) -- 0:00:26
      592500 -- [-941.283] (-943.122) (-941.121) (-940.980) * (-942.259) (-941.201) [-940.618] (-944.715) -- 0:00:26
      593000 -- (-940.355) (-943.537) [-940.399] (-942.860) * (-943.569) [-940.982] (-943.889) (-942.517) -- 0:00:26
      593500 -- (-940.392) [-941.163] (-941.113) (-945.158) * (-943.995) [-941.246] (-943.561) (-941.283) -- 0:00:26
      594000 -- (-941.948) (-942.227) (-944.922) [-940.706] * (-940.705) (-942.719) [-942.430] (-942.348) -- 0:00:26
      594500 -- (-941.465) (-941.100) [-941.066] (-941.579) * (-943.014) [-942.432] (-941.913) (-945.527) -- 0:00:26
      595000 -- [-941.742] (-945.937) (-942.831) (-941.367) * (-940.418) (-942.595) [-942.898] (-942.695) -- 0:00:26

      Average standard deviation of split frequencies: 0.009837

      595500 -- [-947.054] (-945.411) (-941.496) (-942.789) * (-941.532) (-948.312) [-944.295] (-945.346) -- 0:00:26
      596000 -- (-942.607) (-941.211) (-942.708) [-944.757] * [-941.351] (-947.753) (-941.219) (-942.935) -- 0:00:26
      596500 -- (-941.372) [-940.977] (-945.213) (-950.886) * (-941.739) (-941.124) (-941.102) [-941.976] -- 0:00:26
      597000 -- (-942.407) (-941.058) [-940.500] (-944.636) * (-944.627) (-942.509) [-941.023] (-942.508) -- 0:00:26
      597500 -- (-941.494) (-941.321) [-941.857] (-944.964) * (-947.920) [-942.265] (-942.498) (-942.421) -- 0:00:26
      598000 -- (-942.373) (-946.871) [-943.543] (-941.999) * (-944.554) (-941.344) (-942.248) [-940.028] -- 0:00:26
      598500 -- (-941.332) (-949.252) [-942.154] (-940.573) * (-940.997) (-941.389) (-940.752) [-941.891] -- 0:00:26
      599000 -- [-941.336] (-940.491) (-946.355) (-940.580) * (-940.969) (-941.685) (-942.459) [-944.658] -- 0:00:26
      599500 -- [-943.118] (-943.437) (-944.901) (-941.843) * (-940.027) [-940.793] (-941.751) (-941.934) -- 0:00:26
      600000 -- (-941.998) (-942.787) [-944.145] (-946.459) * (-941.404) [-946.260] (-940.683) (-942.225) -- 0:00:25

      Average standard deviation of split frequencies: 0.010569

      600500 -- (-942.638) [-941.676] (-942.940) (-941.980) * [-941.590] (-940.123) (-940.241) (-940.886) -- 0:00:25
      601000 -- [-941.514] (-940.606) (-944.849) (-941.964) * [-942.019] (-943.250) (-942.708) (-942.557) -- 0:00:25
      601500 -- (-944.324) [-941.673] (-941.148) (-942.363) * [-941.536] (-943.280) (-940.430) (-947.352) -- 0:00:25
      602000 -- (-942.929) [-940.565] (-940.976) (-941.406) * [-942.010] (-940.757) (-942.664) (-944.764) -- 0:00:25
      602500 -- (-944.640) (-941.064) (-941.320) [-940.432] * (-944.166) [-942.207] (-940.841) (-941.913) -- 0:00:25
      603000 -- (-940.084) (-943.151) [-940.656] (-941.808) * (-942.125) [-942.735] (-941.655) (-941.611) -- 0:00:25
      603500 -- (-940.780) [-940.714] (-944.948) (-942.050) * (-942.466) (-940.330) [-940.622] (-945.876) -- 0:00:25
      604000 -- (-943.330) (-945.819) [-941.115] (-940.563) * (-943.364) (-940.349) (-941.270) [-941.236] -- 0:00:25
      604500 -- (-944.497) (-943.435) [-942.733] (-940.109) * (-941.020) (-945.599) (-941.654) [-941.053] -- 0:00:25
      605000 -- [-944.774] (-942.864) (-942.119) (-941.264) * (-940.695) (-948.064) (-943.519) [-946.993] -- 0:00:25

      Average standard deviation of split frequencies: 0.009853

      605500 -- [-942.022] (-944.893) (-942.210) (-941.406) * (-942.820) (-941.380) (-943.807) [-944.489] -- 0:00:25
      606000 -- [-941.475] (-943.207) (-945.996) (-940.697) * (-945.024) (-941.003) (-943.428) [-942.570] -- 0:00:25
      606500 -- (-943.446) [-941.984] (-944.083) (-947.004) * (-942.737) (-941.103) [-944.267] (-941.942) -- 0:00:25
      607000 -- (-947.241) (-941.436) (-945.437) [-944.416] * [-942.999] (-941.650) (-941.266) (-942.810) -- 0:00:25
      607500 -- (-941.514) (-939.909) [-941.947] (-942.824) * (-941.155) (-942.022) [-940.390] (-945.568) -- 0:00:25
      608000 -- (-944.139) [-941.961] (-942.089) (-943.097) * [-943.941] (-943.764) (-942.978) (-941.057) -- 0:00:25
      608500 -- (-942.890) [-941.329] (-940.544) (-940.801) * (-942.868) (-945.014) [-942.216] (-941.530) -- 0:00:25
      609000 -- [-940.954] (-943.538) (-940.522) (-940.617) * (-942.868) (-943.441) [-942.626] (-940.452) -- 0:00:25
      609500 -- (-941.990) (-941.295) (-942.730) [-942.589] * (-945.126) (-940.860) (-940.886) [-941.699] -- 0:00:25
      610000 -- [-941.990] (-945.815) (-946.470) (-941.838) * (-944.840) (-941.976) [-944.144] (-942.465) -- 0:00:25

      Average standard deviation of split frequencies: 0.010035

      610500 -- (-942.222) (-944.596) (-944.456) [-941.055] * (-943.784) [-943.424] (-940.372) (-944.024) -- 0:00:25
      611000 -- (-941.404) (-943.971) [-941.834] (-941.313) * (-944.148) (-940.299) (-941.326) [-940.817] -- 0:00:25
      611500 -- [-942.036] (-950.483) (-940.865) (-941.276) * (-940.785) (-940.259) [-941.832] (-941.451) -- 0:00:25
      612000 -- (-942.073) [-943.760] (-941.151) (-943.592) * (-946.441) (-940.698) [-943.359] (-943.633) -- 0:00:25
      612500 -- (-941.343) (-943.901) (-946.168) [-941.495] * (-941.524) (-940.675) (-942.282) [-940.930] -- 0:00:25
      613000 -- (-942.970) [-941.804] (-945.876) (-940.905) * (-942.592) (-944.735) (-941.553) [-942.374] -- 0:00:25
      613500 -- (-941.103) (-940.567) [-945.509] (-944.538) * (-940.352) (-943.169) [-941.383] (-942.091) -- 0:00:25
      614000 -- (-940.809) [-940.664] (-943.407) (-943.090) * (-940.390) (-944.741) (-941.690) [-944.741] -- 0:00:25
      614500 -- (-941.625) [-941.339] (-943.541) (-949.513) * (-940.192) (-944.231) (-942.583) [-940.457] -- 0:00:25
      615000 -- [-943.860] (-941.366) (-942.941) (-943.572) * (-942.692) (-944.192) (-942.981) [-941.298] -- 0:00:25

      Average standard deviation of split frequencies: 0.009999

      615500 -- (-943.598) (-940.665) (-942.548) [-943.800] * (-942.186) [-943.593] (-941.206) (-943.303) -- 0:00:24
      616000 -- (-941.965) (-942.580) (-946.896) [-944.067] * (-943.469) (-939.981) (-941.126) [-942.517] -- 0:00:24
      616500 -- (-943.478) (-945.604) (-945.247) [-943.472] * (-941.624) (-940.949) (-941.272) [-942.889] -- 0:00:24
      617000 -- (-941.751) [-946.237] (-942.052) (-942.109) * [-944.794] (-941.142) (-941.628) (-943.523) -- 0:00:24
      617500 -- [-940.255] (-944.732) (-947.159) (-939.977) * (-940.961) [-942.205] (-945.312) (-939.916) -- 0:00:24
      618000 -- (-942.041) (-946.467) (-940.709) [-941.469] * (-941.782) (-942.665) (-944.892) [-941.936] -- 0:00:24
      618500 -- [-940.392] (-945.297) (-941.130) (-941.559) * [-943.861] (-940.310) (-947.906) (-944.215) -- 0:00:24
      619000 -- (-942.628) (-943.557) (-941.436) [-943.733] * (-941.403) [-940.939] (-945.940) (-940.305) -- 0:00:24
      619500 -- (-946.037) (-942.206) (-941.141) [-941.357] * (-941.031) [-940.675] (-946.160) (-941.471) -- 0:00:24
      620000 -- (-945.824) (-942.603) [-942.547] (-942.200) * (-944.522) [-941.526] (-945.040) (-940.888) -- 0:00:24

      Average standard deviation of split frequencies: 0.009519

      620500 -- (-941.971) [-942.052] (-942.284) (-942.425) * (-940.682) [-942.705] (-942.625) (-942.241) -- 0:00:24
      621000 -- (-943.716) (-944.025) (-943.508) [-941.827] * (-945.315) (-946.656) [-940.422] (-941.205) -- 0:00:24
      621500 -- (-945.461) (-941.754) (-942.503) [-942.951] * [-941.120] (-942.941) (-941.393) (-941.700) -- 0:00:24
      622000 -- (-946.418) [-941.298] (-941.843) (-944.383) * (-942.193) [-940.702] (-942.865) (-943.658) -- 0:00:24
      622500 -- (-946.817) [-941.406] (-941.273) (-943.909) * (-942.364) [-940.871] (-941.622) (-945.166) -- 0:00:24
      623000 -- (-942.560) [-942.487] (-943.013) (-941.224) * (-947.437) (-941.232) [-944.281] (-940.836) -- 0:00:24
      623500 -- (-943.090) (-942.879) [-942.327] (-945.371) * (-942.183) (-942.066) [-943.772] (-940.700) -- 0:00:24
      624000 -- (-943.827) (-940.286) [-941.897] (-943.627) * (-941.639) (-948.076) [-940.399] (-942.581) -- 0:00:24
      624500 -- (-943.403) (-941.571) [-942.533] (-941.893) * [-941.628] (-943.879) (-946.213) (-942.901) -- 0:00:24
      625000 -- (-941.380) (-942.253) [-941.310] (-942.396) * [-940.604] (-944.454) (-947.883) (-942.994) -- 0:00:24

      Average standard deviation of split frequencies: 0.009539

      625500 -- [-941.901] (-944.544) (-942.023) (-945.951) * (-947.231) (-943.712) [-942.185] (-942.652) -- 0:00:24
      626000 -- (-941.207) (-943.229) [-940.651] (-942.573) * [-943.120] (-943.924) (-941.045) (-942.724) -- 0:00:24
      626500 -- (-941.663) [-941.352] (-940.862) (-940.118) * (-942.031) [-942.368] (-941.068) (-940.723) -- 0:00:24
      627000 -- (-942.282) [-940.385] (-940.335) (-943.953) * (-941.262) [-941.968] (-942.357) (-948.156) -- 0:00:24
      627500 -- (-944.380) (-941.729) (-940.668) [-943.510] * (-941.102) (-941.555) [-941.573] (-942.838) -- 0:00:24
      628000 -- (-940.518) [-940.525] (-942.860) (-943.277) * (-942.010) (-943.808) (-942.247) [-941.663] -- 0:00:24
      628500 -- [-941.544] (-942.494) (-941.233) (-943.258) * (-941.668) (-942.585) [-942.802] (-942.651) -- 0:00:24
      629000 -- [-943.184] (-944.912) (-942.026) (-942.309) * [-942.369] (-942.674) (-942.412) (-943.057) -- 0:00:24
      629500 -- (-947.420) (-945.859) (-943.122) [-945.311] * (-944.403) (-941.828) [-942.123] (-940.523) -- 0:00:24
      630000 -- (-946.668) (-941.899) [-942.143] (-942.135) * (-942.381) (-943.898) [-940.948] (-941.581) -- 0:00:24

      Average standard deviation of split frequencies: 0.010116

      630500 -- (-941.695) (-942.764) [-941.346] (-940.044) * (-941.576) (-945.095) [-943.701] (-944.109) -- 0:00:24
      631000 -- [-940.729] (-942.719) (-942.531) (-941.063) * (-943.425) [-942.394] (-943.118) (-946.820) -- 0:00:23
      631500 -- (-942.189) (-942.195) (-942.278) [-940.248] * (-941.029) (-941.293) [-940.815] (-942.248) -- 0:00:23
      632000 -- (-942.421) [-941.242] (-943.777) (-941.354) * (-942.995) (-945.349) (-944.682) [-942.302] -- 0:00:23
      632500 -- (-943.716) (-941.184) [-943.224] (-943.677) * (-944.540) [-941.427] (-942.716) (-941.747) -- 0:00:23
      633000 -- [-940.990] (-940.664) (-945.281) (-942.420) * (-942.161) (-946.294) [-942.618] (-941.043) -- 0:00:23
      633500 -- (-943.772) [-940.462] (-943.145) (-940.902) * [-944.014] (-952.693) (-945.040) (-942.195) -- 0:00:23
      634000 -- (-945.732) [-943.679] (-941.714) (-941.100) * (-943.062) (-940.776) (-940.894) [-943.513] -- 0:00:23
      634500 -- (-940.980) [-943.018] (-941.090) (-942.464) * (-940.391) (-942.636) (-943.690) [-943.308] -- 0:00:23
      635000 -- (-941.435) (-941.513) (-941.217) [-940.433] * [-943.089] (-941.090) (-942.786) (-942.509) -- 0:00:23

      Average standard deviation of split frequencies: 0.010772

      635500 -- (-941.055) [-940.105] (-942.091) (-940.271) * (-940.611) (-943.724) [-942.478] (-941.146) -- 0:00:23
      636000 -- (-944.473) (-940.423) [-945.379] (-940.256) * (-940.266) (-942.783) (-942.802) [-941.466] -- 0:00:23
      636500 -- (-943.596) (-940.552) [-941.306] (-943.752) * [-941.964] (-949.292) (-940.580) (-942.792) -- 0:00:23
      637000 -- (-943.546) [-941.898] (-942.009) (-943.461) * (-940.873) (-946.388) [-942.505] (-940.513) -- 0:00:23
      637500 -- [-941.986] (-942.603) (-942.835) (-942.022) * [-942.484] (-940.747) (-940.213) (-941.792) -- 0:00:23
      638000 -- [-940.668] (-941.965) (-944.293) (-940.767) * (-940.669) (-940.923) [-942.232] (-943.437) -- 0:00:23
      638500 -- (-942.259) [-942.398] (-943.294) (-945.169) * (-940.993) (-940.987) [-940.768] (-943.981) -- 0:00:23
      639000 -- (-943.266) [-943.414] (-942.471) (-941.303) * [-942.002] (-946.265) (-942.008) (-942.756) -- 0:00:23
      639500 -- (-945.583) [-942.902] (-941.761) (-945.512) * (-946.088) (-943.478) [-944.732] (-941.868) -- 0:00:23
      640000 -- (-941.178) (-944.588) [-940.520] (-945.149) * (-944.891) [-942.609] (-942.975) (-940.351) -- 0:00:23

      Average standard deviation of split frequencies: 0.011037

      640500 -- (-940.073) [-942.904] (-943.028) (-941.778) * [-942.498] (-943.696) (-943.626) (-942.288) -- 0:00:23
      641000 -- (-941.003) [-942.024] (-944.363) (-942.021) * [-941.999] (-944.665) (-942.734) (-943.986) -- 0:00:23
      641500 -- (-942.275) (-943.214) (-946.877) [-941.735] * (-943.066) [-944.064] (-944.108) (-941.086) -- 0:00:23
      642000 -- (-941.198) (-944.335) [-941.179] (-940.196) * (-943.330) (-943.383) (-947.473) [-942.849] -- 0:00:23
      642500 -- (-940.525) [-941.837] (-947.593) (-940.875) * [-942.453] (-940.292) (-940.300) (-940.350) -- 0:00:23
      643000 -- (-940.712) (-943.214) (-941.044) [-941.200] * (-942.230) [-941.128] (-941.101) (-943.560) -- 0:00:23
      643500 -- (-945.323) [-941.274] (-941.653) (-943.923) * [-940.020] (-941.539) (-943.479) (-943.490) -- 0:00:23
      644000 -- (-942.288) (-940.232) (-941.842) [-944.540] * (-941.393) [-941.160] (-941.860) (-942.533) -- 0:00:23
      644500 -- [-942.237] (-942.116) (-940.578) (-940.574) * (-942.419) (-943.022) [-942.705] (-943.859) -- 0:00:23
      645000 -- (-944.522) (-943.907) (-943.439) [-944.841] * [-940.925] (-942.389) (-940.750) (-943.476) -- 0:00:23

      Average standard deviation of split frequencies: 0.011174

      645500 -- (-941.130) [-943.124] (-941.117) (-945.116) * [-940.649] (-941.283) (-941.379) (-942.600) -- 0:00:23
      646000 -- (-941.065) (-941.537) (-942.815) [-941.980] * [-941.967] (-941.590) (-941.155) (-942.459) -- 0:00:23
      646500 -- (-941.231) (-943.263) (-944.348) [-944.827] * [-941.068] (-944.319) (-948.379) (-940.306) -- 0:00:22
      647000 -- (-941.264) (-941.716) (-941.660) [-940.910] * [-940.911] (-940.420) (-944.087) (-940.940) -- 0:00:22
      647500 -- (-943.008) (-943.576) [-942.272] (-944.519) * [-942.777] (-943.165) (-944.985) (-947.489) -- 0:00:22
      648000 -- (-942.764) (-940.893) (-942.780) [-941.389] * (-941.028) (-942.205) [-942.941] (-942.138) -- 0:00:22
      648500 -- (-942.772) [-942.351] (-949.406) (-941.263) * (-942.562) [-941.515] (-944.003) (-946.177) -- 0:00:22
      649000 -- (-943.521) [-941.788] (-944.352) (-943.477) * (-940.849) (-945.417) (-941.690) [-941.901] -- 0:00:22
      649500 -- (-944.564) (-943.902) [-941.471] (-941.736) * (-941.080) (-942.943) (-941.766) [-941.224] -- 0:00:22
      650000 -- (-940.967) (-944.614) [-942.348] (-942.988) * (-941.288) [-940.988] (-951.391) (-941.470) -- 0:00:22

      Average standard deviation of split frequencies: 0.011366

      650500 -- (-944.332) (-944.228) [-940.499] (-943.316) * [-942.021] (-941.727) (-947.521) (-940.504) -- 0:00:22
      651000 -- (-942.998) (-940.991) (-941.464) [-941.149] * (-942.167) (-943.006) (-943.270) [-942.743] -- 0:00:22
      651500 -- (-941.607) [-941.210] (-942.069) (-942.543) * [-942.051] (-946.824) (-941.734) (-948.503) -- 0:00:22
      652000 -- (-942.428) (-942.393) [-943.476] (-948.689) * (-941.731) (-943.861) (-942.743) [-945.640] -- 0:00:22
      652500 -- (-940.846) (-946.220) (-942.187) [-944.491] * [-940.774] (-943.934) (-942.134) (-942.621) -- 0:00:22
      653000 -- (-941.189) (-944.607) (-942.617) [-941.638] * (-943.625) (-941.437) (-940.178) [-942.908] -- 0:00:22
      653500 -- [-943.058] (-943.319) (-944.310) (-940.813) * (-944.345) [-940.556] (-941.934) (-940.644) -- 0:00:22
      654000 -- [-941.769] (-941.259) (-945.308) (-940.317) * (-945.977) (-941.266) (-941.599) [-941.924] -- 0:00:22
      654500 -- [-948.222] (-941.196) (-943.667) (-943.191) * (-942.451) [-940.436] (-942.218) (-941.227) -- 0:00:22
      655000 -- (-944.065) (-942.205) [-943.926] (-940.380) * (-944.780) (-943.583) (-944.543) [-940.358] -- 0:00:22

      Average standard deviation of split frequencies: 0.010875

      655500 -- [-941.253] (-941.403) (-941.985) (-946.262) * (-943.485) [-941.222] (-941.644) (-941.838) -- 0:00:22
      656000 -- (-940.338) [-946.213] (-941.856) (-941.602) * (-941.375) (-950.778) (-940.549) [-940.678] -- 0:00:22
      656500 -- (-943.141) [-945.248] (-943.801) (-941.211) * (-943.318) (-944.473) (-944.435) [-941.643] -- 0:00:22
      657000 -- (-946.204) (-941.563) (-943.092) [-944.388] * (-942.535) (-941.428) [-944.220] (-944.083) -- 0:00:22
      657500 -- (-945.747) [-941.822] (-941.630) (-945.745) * [-942.338] (-941.901) (-941.368) (-941.641) -- 0:00:22
      658000 -- (-942.204) (-944.113) (-940.420) [-945.057] * (-943.426) [-942.819] (-942.883) (-943.101) -- 0:00:22
      658500 -- [-941.611] (-941.992) (-940.683) (-943.685) * (-940.376) [-941.312] (-941.879) (-943.287) -- 0:00:22
      659000 -- (-941.995) (-942.250) (-942.324) [-945.106] * (-941.668) [-941.871] (-942.155) (-944.799) -- 0:00:22
      659500 -- [-941.511] (-943.542) (-944.120) (-944.206) * (-942.757) (-941.051) [-941.589] (-941.549) -- 0:00:22
      660000 -- (-942.667) (-942.670) [-946.791] (-946.021) * [-943.686] (-941.320) (-942.592) (-943.245) -- 0:00:22

      Average standard deviation of split frequencies: 0.010132

      660500 -- (-942.834) (-944.547) [-942.275] (-942.395) * (-945.600) [-940.519] (-942.973) (-943.287) -- 0:00:22
      661000 -- (-943.612) (-945.192) (-942.000) [-942.967] * (-941.003) (-944.956) (-945.998) [-942.677] -- 0:00:22
      661500 -- (-944.794) (-944.783) (-944.851) [-941.654] * (-940.336) (-943.631) (-943.542) [-942.423] -- 0:00:22
      662000 -- (-941.442) [-942.079] (-944.792) (-943.367) * (-940.781) (-940.798) [-941.109] (-944.615) -- 0:00:21
      662500 -- [-942.777] (-941.400) (-945.183) (-942.839) * (-946.843) (-941.233) (-941.664) [-942.530] -- 0:00:21
      663000 -- (-947.210) (-942.713) [-942.740] (-942.907) * (-943.387) (-941.703) [-941.531] (-943.405) -- 0:00:21
      663500 -- (-948.217) (-945.231) [-940.698] (-941.416) * (-941.830) (-940.961) [-940.975] (-942.633) -- 0:00:21
      664000 -- (-941.692) (-942.962) (-942.464) [-940.818] * (-943.959) [-941.897] (-943.465) (-943.127) -- 0:00:21
      664500 -- (-941.981) (-951.942) (-940.373) [-941.779] * (-943.947) (-940.750) [-942.335] (-942.508) -- 0:00:21
      665000 -- (-941.456) [-943.282] (-940.915) (-941.336) * (-942.241) (-941.166) (-942.664) [-942.480] -- 0:00:21

      Average standard deviation of split frequencies: 0.010883

      665500 -- (-942.826) (-944.334) [-940.850] (-942.001) * (-943.746) (-940.682) [-942.417] (-942.089) -- 0:00:21
      666000 -- (-943.141) (-940.923) [-943.814] (-943.123) * (-944.724) (-940.053) (-942.595) [-940.795] -- 0:00:21
      666500 -- (-942.892) [-940.515] (-941.369) (-944.911) * (-943.828) (-940.772) [-943.224] (-942.071) -- 0:00:21
      667000 -- (-943.667) (-940.370) (-940.343) [-941.441] * (-943.092) (-940.744) [-940.313] (-941.959) -- 0:00:21
      667500 -- (-940.425) [-941.846] (-941.995) (-944.771) * [-943.354] (-943.164) (-944.764) (-944.461) -- 0:00:21
      668000 -- (-940.743) [-941.393] (-943.220) (-941.894) * (-942.412) (-942.602) (-948.096) [-940.688] -- 0:00:21
      668500 -- (-940.662) (-940.660) (-945.432) [-942.084] * (-944.120) (-943.752) [-941.436] (-941.429) -- 0:00:21
      669000 -- (-942.790) (-946.750) [-942.559] (-942.271) * (-948.900) [-941.942] (-941.859) (-942.123) -- 0:00:21
      669500 -- (-943.154) (-946.073) [-941.034] (-943.361) * (-946.089) [-940.357] (-940.088) (-944.952) -- 0:00:21
      670000 -- [-940.444] (-942.950) (-941.487) (-941.496) * (-945.525) (-941.896) [-941.821] (-941.379) -- 0:00:21

      Average standard deviation of split frequencies: 0.010918

      670500 -- (-942.902) (-942.497) [-942.096] (-942.733) * (-940.868) (-942.100) [-942.516] (-941.030) -- 0:00:21
      671000 -- (-940.300) (-942.536) (-940.843) [-942.378] * [-940.613] (-942.712) (-942.168) (-943.747) -- 0:00:21
      671500 -- (-941.090) (-944.986) [-940.441] (-946.115) * (-943.385) (-940.574) [-944.725] (-942.210) -- 0:00:21
      672000 -- (-940.550) (-942.818) [-941.111] (-942.651) * [-945.911] (-940.170) (-941.571) (-941.429) -- 0:00:21
      672500 -- (-940.894) (-943.602) (-943.608) [-942.899] * (-945.567) (-940.866) [-941.591] (-939.897) -- 0:00:21
      673000 -- (-942.013) [-941.505] (-943.233) (-945.553) * [-942.971] (-940.653) (-943.430) (-940.982) -- 0:00:21
      673500 -- [-942.561] (-946.832) (-941.358) (-941.923) * (-942.539) (-941.509) [-942.237] (-940.834) -- 0:00:21
      674000 -- (-942.576) (-947.140) (-943.488) [-943.982] * (-944.937) (-943.774) (-943.379) [-944.410] -- 0:00:21
      674500 -- (-942.960) [-941.382] (-941.280) (-942.148) * (-940.935) [-942.170] (-940.440) (-940.832) -- 0:00:21
      675000 -- (-947.418) (-952.069) [-940.478] (-942.314) * [-941.040] (-940.602) (-945.403) (-942.615) -- 0:00:21

      Average standard deviation of split frequencies: 0.010739

      675500 -- (-945.452) [-942.108] (-940.069) (-942.119) * (-942.250) [-941.163] (-944.526) (-947.692) -- 0:00:21
      676000 -- [-940.610] (-941.078) (-941.320) (-942.617) * (-941.635) [-942.483] (-942.231) (-942.125) -- 0:00:21
      676500 -- (-943.629) [-940.716] (-941.905) (-943.678) * [-941.212] (-941.682) (-941.217) (-944.123) -- 0:00:21
      677000 -- (-943.657) (-940.186) [-940.123] (-942.911) * (-941.823) (-941.185) [-940.706] (-941.977) -- 0:00:20
      677500 -- (-946.339) [-941.462] (-942.901) (-942.244) * (-943.464) (-941.862) [-940.988] (-946.216) -- 0:00:20
      678000 -- (-943.788) [-940.815] (-942.047) (-948.914) * (-945.519) (-941.179) (-941.573) [-940.581] -- 0:00:20
      678500 -- [-941.077] (-949.114) (-941.793) (-944.698) * (-942.226) (-945.738) [-940.804] (-942.207) -- 0:00:20
      679000 -- (-940.963) (-940.974) [-940.681] (-940.598) * (-944.482) (-942.333) (-945.238) [-942.087] -- 0:00:20
      679500 -- (-940.746) [-941.177] (-941.699) (-943.703) * (-945.619) (-940.842) [-943.107] (-941.671) -- 0:00:20
      680000 -- (-943.126) [-944.681] (-942.315) (-941.372) * [-944.696] (-945.077) (-943.702) (-944.910) -- 0:00:20

      Average standard deviation of split frequencies: 0.010712

      680500 -- (-946.194) (-944.173) [-942.899] (-940.645) * (-943.440) (-942.637) [-944.470] (-942.786) -- 0:00:20
      681000 -- (-949.289) (-943.344) [-942.674] (-945.320) * (-941.489) (-942.488) (-944.713) [-944.400] -- 0:00:20
      681500 -- [-944.227] (-947.070) (-944.035) (-944.479) * (-943.993) [-941.235] (-946.632) (-943.671) -- 0:00:20
      682000 -- (-942.572) (-943.607) [-944.409] (-943.497) * (-942.952) (-942.714) [-942.185] (-942.010) -- 0:00:20
      682500 -- (-941.408) (-943.743) [-941.962] (-940.687) * (-946.499) [-942.521] (-943.188) (-941.590) -- 0:00:20
      683000 -- (-942.396) (-942.217) [-943.094] (-941.122) * (-940.590) (-941.938) (-946.595) [-941