--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:55:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1391/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.59 -944.19
2 -941.55 -945.00
--------------------------------------
TOTAL -941.57 -944.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898633 0.090044 0.369331 1.477656 0.864189 1501.00 1501.00 1.000
r(A<->C){all} 0.163370 0.019185 0.000108 0.444501 0.127415 111.77 141.68 1.000
r(A<->G){all} 0.186540 0.022880 0.000018 0.499533 0.149421 127.36 199.90 1.001
r(A<->T){all} 0.161611 0.018690 0.000025 0.435915 0.127294 245.82 287.42 1.000
r(C<->G){all} 0.159448 0.018673 0.000225 0.439473 0.122466 294.70 333.31 1.000
r(C<->T){all} 0.160188 0.017473 0.000197 0.433794 0.128456 187.53 213.20 1.001
r(G<->T){all} 0.168843 0.019482 0.000023 0.450528 0.135072 234.90 280.15 1.000
pi(A){all} 0.191934 0.000223 0.162569 0.220639 0.191953 1079.47 1136.86 1.000
pi(C){all} 0.325191 0.000296 0.293771 0.360587 0.324377 1130.05 1228.52 1.000
pi(G){all} 0.305891 0.000287 0.273584 0.340063 0.305684 1366.21 1378.33 1.000
pi(T){all} 0.176984 0.000207 0.148432 0.204857 0.176696 1290.50 1358.99 1.000
alpha{1,2} 0.423492 0.231512 0.000191 1.358642 0.256990 1220.72 1263.91 1.000
alpha{3} 0.462183 0.240420 0.000169 1.469697 0.302169 1268.04 1306.05 1.000
pinvar{all} 0.997759 0.000007 0.992821 0.999999 0.998620 1104.67 1198.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -905.546864
Model 2: PositiveSelection -905.546699
Model 0: one-ratio -905.546849
Model 7: beta -905.546805
Model 8: beta&w>1 -905.546699
Model 0 vs 1 3.0000000151630957E-5
Model 2 vs 1 3.300000000763248E-4
Model 8 vs 7 2.119999999194988E-4
>C1
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C2
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C3
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C4
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C5
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C6
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
C1 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C2 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C3 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C4 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C5 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C6 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
**************************************************
C1 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C2 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C3 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C4 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C5 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C6 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
**************************************************
C1 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C2 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C3 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C4 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C5 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C6 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
**************************************************
C1 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C2 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C3 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C4 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C5 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C6 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
**************************************************
C1 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C2 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C3 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C4 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C5 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C6 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6960]--->[6960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C2 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C3 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C4 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C5 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
C6 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
**************************************************
C1 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C2 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C3 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C4 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C5 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
C6 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
**************************************************
C1 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C2 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C3 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C4 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C5 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
C6 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
**************************************************
C1 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C2 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C3 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C4 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C5 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
C6 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
**************************************************
C1 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C2 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C3 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C4 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C5 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
C6 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C2 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C3 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C4 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C5 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
C6 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
**************************************************
C1 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C2 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C3 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C4 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C5 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
C6 GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
**************************************************
C1 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C2 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C3 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C4 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C5 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
C6 CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
**************************************************
C1 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C2 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C3 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C4 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C5 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
C6 GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
**************************************************
C1 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C2 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C3 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C4 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C5 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
C6 TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
**************************************************
C1 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C2 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C3 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C4 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C5 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
C6 AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
**************************************************
C1 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C2 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C3 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C4 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C5 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
C6 GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
**************************************************
C1 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C2 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C3 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C4 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C5 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
C6 GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
**************************************************
C1 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C2 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C3 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C4 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C5 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
C6 TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
**************************************************
C1 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C2 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C3 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C4 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C5 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
C6 CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
**************************************************
C1 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C2 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C3 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C4 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C5 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
C6 CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
**************************************************
C1 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C2 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C3 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C4 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C5 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
C6 GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
**************************************************
C1 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C2 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C3 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C4 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C5 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
C6 TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
**************************************************
C1 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C2 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C3 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C4 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C5 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
C6 CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
**********************************************
>C1
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C2
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C3
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C4
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C5
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C6
ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC
GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT
CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC
GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA
TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC
AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT
GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC
GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT
TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG
CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT
CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA
GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG
TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT
CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>C1
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C2
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C3
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C4
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C5
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
>C6
MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859621
Setting output file names to "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1986993088
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5195715323
Seed = 1994025904
Swapseed = 1579859621
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1557.681280 -- -24.965149
Chain 2 -- -1557.681369 -- -24.965149
Chain 3 -- -1557.681369 -- -24.965149
Chain 4 -- -1557.681280 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1557.681132 -- -24.965149
Chain 2 -- -1557.681369 -- -24.965149
Chain 3 -- -1557.681369 -- -24.965149
Chain 4 -- -1557.681280 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1557.681] (-1557.681) (-1557.681) (-1557.681) * [-1557.681] (-1557.681) (-1557.681) (-1557.681)
500 -- [-954.608] (-954.175) (-962.748) (-955.263) * (-951.366) [-949.582] (-965.078) (-948.979) -- 0:00:00
1000 -- (-958.405) [-949.424] (-949.857) (-958.291) * (-957.466) (-946.667) (-952.696) [-951.290] -- 0:00:00
1500 -- (-963.163) [-944.390] (-953.038) (-946.735) * (-948.165) (-944.885) (-960.005) [-945.712] -- 0:00:00
2000 -- (-969.235) [-947.143] (-947.818) (-946.521) * (-951.858) (-956.965) (-956.917) [-950.169] -- 0:00:00
2500 -- (-970.313) (-957.284) (-952.496) [-952.020] * (-952.510) (-948.907) (-951.109) [-949.757] -- 0:00:00
3000 -- (-946.742) [-949.006] (-948.610) (-959.282) * (-960.177) (-954.218) [-947.548] (-950.771) -- 0:00:00
3500 -- (-952.227) (-954.794) [-949.829] (-948.770) * (-945.034) (-955.298) [-949.051] (-949.722) -- 0:00:00
4000 -- (-949.751) [-951.446] (-953.683) (-956.153) * (-952.005) [-953.562] (-955.306) (-949.301) -- 0:00:00
4500 -- [-952.926] (-947.899) (-952.630) (-957.491) * (-957.881) (-948.740) (-960.711) [-956.874] -- 0:00:00
5000 -- (-948.957) [-951.243] (-950.736) (-953.606) * [-947.560] (-947.802) (-953.418) (-949.856) -- 0:00:00
Average standard deviation of split frequencies: 0.074826
5500 -- (-955.453) [-946.638] (-956.124) (-951.365) * (-950.013) [-950.891] (-946.994) (-950.500) -- 0:00:00
6000 -- [-946.318] (-947.573) (-950.073) (-955.315) * (-956.053) (-948.041) [-957.190] (-952.474) -- 0:00:00
6500 -- (-949.924) (-947.165) [-948.939] (-953.018) * (-957.359) [-946.182] (-948.959) (-947.180) -- 0:00:00
7000 -- [-952.357] (-952.052) (-950.686) (-950.774) * (-961.155) [-955.636] (-951.939) (-947.689) -- 0:00:00
7500 -- [-955.275] (-955.125) (-950.336) (-955.145) * [-951.578] (-953.955) (-949.874) (-953.109) -- 0:00:00
8000 -- (-950.310) [-949.500] (-955.815) (-949.020) * (-954.665) (-951.823) [-948.370] (-959.148) -- 0:00:00
8500 -- (-952.619) (-949.328) (-960.502) [-953.141] * (-963.293) (-950.347) [-952.775] (-956.135) -- 0:00:00
9000 -- (-953.266) (-951.621) [-950.374] (-951.548) * (-943.217) (-951.252) [-948.323] (-960.267) -- 0:00:00
9500 -- (-952.519) (-947.321) (-956.561) [-950.050] * (-946.414) [-951.713] (-956.065) (-967.198) -- 0:00:00
10000 -- (-950.063) [-951.975] (-949.351) (-950.602) * (-944.563) (-951.947) (-947.060) [-945.463] -- 0:00:00
Average standard deviation of split frequencies: 0.068300
10500 -- [-956.468] (-945.445) (-943.898) (-956.717) * (-950.724) [-954.167] (-954.934) (-956.582) -- 0:00:00
11000 -- (-957.641) [-951.445] (-955.780) (-946.906) * (-945.017) (-954.090) [-956.270] (-958.229) -- 0:01:29
11500 -- (-954.076) (-947.908) (-946.752) [-951.625] * [-943.556] (-956.828) (-949.022) (-940.783) -- 0:01:25
12000 -- (-947.826) (-952.029) (-949.288) [-948.562] * (-941.980) (-955.182) (-947.748) [-942.984] -- 0:01:22
12500 -- (-958.275) (-952.306) (-948.835) [-948.808] * [-942.077] (-950.854) (-948.495) (-948.343) -- 0:01:19
13000 -- (-954.062) (-949.915) [-949.821] (-956.355) * (-948.226) (-962.684) (-949.908) [-943.913] -- 0:01:15
13500 -- (-951.828) [-950.985] (-951.056) (-954.482) * (-942.313) [-955.234] (-952.928) (-940.464) -- 0:01:13
14000 -- [-948.185] (-953.669) (-947.409) (-957.142) * (-949.235) [-948.606] (-953.503) (-944.126) -- 0:01:10
14500 -- (-950.641) (-958.188) [-947.865] (-960.036) * (-944.870) (-958.098) (-952.940) [-942.137] -- 0:01:07
15000 -- (-957.190) (-950.414) [-953.794] (-949.432) * (-944.936) (-948.140) (-942.101) [-944.530] -- 0:01:05
Average standard deviation of split frequencies: 0.063578
15500 -- [-947.892] (-956.269) (-952.173) (-961.132) * (-945.160) (-953.152) [-946.227] (-945.429) -- 0:01:03
16000 -- [-952.408] (-952.515) (-951.836) (-950.946) * [-943.961] (-954.484) (-943.028) (-941.521) -- 0:01:01
16500 -- (-949.361) (-949.382) (-949.389) [-954.205] * [-944.861] (-953.193) (-943.142) (-941.426) -- 0:00:59
17000 -- (-950.940) (-954.120) [-951.656] (-952.281) * (-941.805) [-945.507] (-943.870) (-941.557) -- 0:00:57
17500 -- (-957.827) [-952.664] (-955.433) (-952.515) * (-944.884) [-950.365] (-942.138) (-942.491) -- 0:00:56
18000 -- [-954.429] (-946.302) (-949.300) (-954.968) * (-941.250) (-967.206) [-942.077] (-943.410) -- 0:00:54
18500 -- (-955.882) (-955.965) (-956.966) [-945.787] * (-945.457) [-940.987] (-944.550) (-943.384) -- 0:00:53
19000 -- (-949.316) (-955.784) [-947.868] (-945.682) * [-945.673] (-941.540) (-942.996) (-941.896) -- 0:00:51
19500 -- (-955.600) (-951.308) [-951.317] (-946.634) * (-943.059) (-943.825) [-943.025] (-943.370) -- 0:00:50
20000 -- (-947.588) (-951.161) (-961.100) [-946.336] * [-941.466] (-940.637) (-944.182) (-942.743) -- 0:00:49
Average standard deviation of split frequencies: 0.059559
20500 -- (-950.401) [-950.454] (-962.815) (-941.629) * (-944.992) (-943.028) [-941.800] (-944.928) -- 0:00:47
21000 -- (-952.007) [-957.798] (-941.731) (-940.662) * (-941.760) (-942.382) [-941.777] (-943.437) -- 0:00:46
21500 -- (-949.282) (-957.653) [-941.273] (-942.570) * (-942.925) (-941.679) [-942.048] (-946.276) -- 0:00:45
22000 -- (-965.481) (-954.773) (-941.805) [-941.224] * (-941.128) (-941.909) [-942.672] (-944.297) -- 0:00:44
22500 -- (-949.949) (-968.303) (-941.283) [-941.442] * [-941.128] (-942.568) (-942.252) (-943.130) -- 0:00:43
23000 -- (-947.277) (-962.438) [-941.973] (-941.141) * (-944.132) (-941.159) (-941.302) [-941.914] -- 0:00:42
23500 -- (-948.789) (-949.070) [-942.301] (-943.951) * (-943.632) [-940.611] (-942.891) (-945.088) -- 0:00:41
24000 -- (-950.127) [-944.815] (-941.315) (-944.048) * (-945.773) [-940.587] (-942.683) (-940.540) -- 0:00:40
24500 -- [-950.334] (-951.627) (-941.617) (-941.965) * (-945.171) (-942.985) [-943.049] (-943.052) -- 0:00:39
25000 -- (-949.244) [-945.440] (-941.279) (-947.355) * (-948.988) (-945.678) (-940.752) [-940.795] -- 0:00:39
Average standard deviation of split frequencies: 0.044421
25500 -- (-952.252) [-948.212] (-941.371) (-943.676) * (-942.664) [-940.641] (-943.684) (-943.834) -- 0:00:38
26000 -- (-956.755) (-952.704) [-943.006] (-946.595) * [-941.154] (-940.414) (-941.784) (-942.087) -- 0:01:14
26500 -- (-951.883) (-947.548) [-941.943] (-940.702) * (-943.176) [-941.944] (-943.693) (-941.462) -- 0:01:13
27000 -- (-954.585) (-951.432) (-942.267) [-940.601] * (-942.085) [-943.807] (-944.029) (-946.085) -- 0:01:12
27500 -- (-955.753) [-950.763] (-944.191) (-944.999) * (-942.618) (-940.823) (-944.562) [-944.428] -- 0:01:10
28000 -- (-950.339) [-953.353] (-943.686) (-943.384) * (-940.352) (-944.096) [-943.041] (-948.618) -- 0:01:09
28500 -- [-948.994] (-950.758) (-940.453) (-941.106) * [-941.350] (-944.476) (-942.720) (-950.381) -- 0:01:08
29000 -- (-952.223) [-945.954] (-946.768) (-948.097) * [-942.617] (-944.073) (-943.904) (-947.733) -- 0:01:06
29500 -- (-949.084) (-946.750) (-941.200) [-941.616] * (-940.878) (-942.591) [-941.169] (-944.062) -- 0:01:05
30000 -- (-950.099) [-950.248] (-942.216) (-943.485) * (-942.667) (-941.118) (-943.700) [-943.409] -- 0:01:04
Average standard deviation of split frequencies: 0.035868
30500 -- (-953.148) (-952.429) (-941.962) [-942.723] * [-940.619] (-941.684) (-941.339) (-941.313) -- 0:01:03
31000 -- [-951.521] (-954.678) (-941.662) (-942.463) * [-944.213] (-941.616) (-942.521) (-941.133) -- 0:01:02
31500 -- (-948.348) (-955.223) (-941.066) [-945.327] * (-944.742) (-944.655) (-941.698) [-941.758] -- 0:01:01
32000 -- (-948.940) (-945.130) (-948.644) [-940.882] * (-940.070) [-941.005] (-943.326) (-940.883) -- 0:01:00
32500 -- [-954.743] (-949.473) (-942.340) (-941.044) * (-941.065) [-943.397] (-940.768) (-945.214) -- 0:00:59
33000 -- (-953.739) [-950.607] (-943.690) (-945.909) * (-940.625) (-941.204) (-941.219) [-942.129] -- 0:00:58
33500 -- (-955.941) [-946.869] (-941.836) (-942.364) * (-944.947) (-943.405) [-940.706] (-941.725) -- 0:00:57
34000 -- [-946.459] (-956.371) (-941.644) (-942.718) * (-941.700) (-942.428) [-944.659] (-942.988) -- 0:00:56
34500 -- (-950.624) (-957.962) (-940.281) [-945.002] * (-941.501) [-942.841] (-943.075) (-947.546) -- 0:00:55
35000 -- (-955.477) (-945.335) (-940.369) [-945.672] * [-941.293] (-941.434) (-942.093) (-947.208) -- 0:00:55
Average standard deviation of split frequencies: 0.021606
35500 -- [-944.524] (-944.438) (-940.875) (-947.625) * [-941.051] (-941.689) (-942.398) (-946.017) -- 0:00:54
36000 -- (-951.333) (-941.262) [-941.571] (-947.388) * (-943.099) (-944.110) (-940.950) [-941.353] -- 0:00:53
36500 -- (-958.247) (-940.784) (-941.757) [-944.039] * [-943.902] (-944.972) (-941.307) (-944.395) -- 0:00:52
37000 -- (-953.858) [-943.639] (-943.391) (-944.100) * (-944.329) (-942.801) [-942.027] (-942.439) -- 0:00:52
37500 -- (-950.852) [-942.771] (-941.857) (-944.703) * [-940.608] (-943.846) (-941.867) (-943.888) -- 0:00:51
38000 -- (-950.232) (-941.181) [-941.273] (-943.876) * [-941.025] (-941.090) (-941.234) (-951.804) -- 0:00:50
38500 -- (-951.894) (-941.579) (-941.209) [-944.280] * [-943.344] (-941.906) (-942.223) (-941.138) -- 0:00:49
39000 -- (-952.790) [-946.647] (-943.497) (-942.392) * (-941.563) (-945.085) (-942.486) [-942.853] -- 0:00:49
39500 -- (-951.239) (-941.481) (-943.686) [-945.186] * (-941.938) (-945.148) (-941.738) [-944.795] -- 0:00:48
40000 -- (-953.121) (-940.610) [-942.367] (-943.884) * (-941.378) (-941.888) (-941.911) [-941.514] -- 0:00:48
Average standard deviation of split frequencies: 0.025014
40500 -- (-951.679) [-942.916] (-941.670) (-941.861) * [-942.225] (-941.410) (-943.052) (-941.942) -- 0:01:11
41000 -- (-953.848) [-943.973] (-940.233) (-941.987) * (-941.132) (-944.004) [-942.379] (-940.617) -- 0:01:10
41500 -- (-949.113) [-942.077] (-941.872) (-941.010) * [-941.167] (-944.578) (-942.708) (-942.221) -- 0:01:09
42000 -- (-958.072) [-940.108] (-941.115) (-943.600) * (-940.887) (-951.779) [-940.161] (-943.497) -- 0:01:08
42500 -- (-949.726) (-944.590) [-942.073] (-941.430) * (-940.798) (-945.080) (-940.746) [-941.468] -- 0:01:07
43000 -- (-965.177) [-941.918] (-941.804) (-943.872) * (-945.534) (-944.850) [-941.710] (-942.870) -- 0:01:06
43500 -- [-956.305] (-940.246) (-942.968) (-944.026) * [-943.048] (-946.708) (-941.503) (-942.180) -- 0:01:05
44000 -- (-949.685) [-941.145] (-942.063) (-947.228) * [-940.514] (-943.195) (-943.674) (-941.433) -- 0:01:05
44500 -- (-949.394) (-943.362) (-942.393) [-944.729] * (-941.036) (-941.079) (-943.239) [-943.094] -- 0:01:04
45000 -- (-960.036) [-944.366] (-942.334) (-945.063) * [-941.401] (-941.844) (-942.566) (-941.855) -- 0:01:03
Average standard deviation of split frequencies: 0.029768
45500 -- (-951.601) [-940.231] (-947.792) (-941.018) * (-942.215) [-943.377] (-944.408) (-942.387) -- 0:01:02
46000 -- (-954.361) (-940.334) [-940.944] (-940.964) * (-942.394) [-943.460] (-945.008) (-942.359) -- 0:01:02
46500 -- (-965.603) [-940.314] (-941.290) (-942.016) * (-942.175) [-942.253] (-944.195) (-940.561) -- 0:01:01
47000 -- (-941.074) (-941.190) [-940.983] (-945.235) * [-941.001] (-942.656) (-949.485) (-943.312) -- 0:01:00
47500 -- (-944.069) (-941.628) (-940.511) [-942.999] * (-940.939) (-942.420) (-946.467) [-943.953] -- 0:01:00
48000 -- [-940.687] (-943.997) (-940.002) (-942.700) * [-940.553] (-940.938) (-943.282) (-943.638) -- 0:00:59
48500 -- (-940.491) (-942.120) [-940.295] (-944.273) * [-941.495] (-940.327) (-942.137) (-941.631) -- 0:00:58
49000 -- (-941.551) (-942.887) [-941.222] (-941.825) * (-949.648) (-941.453) [-941.436] (-942.123) -- 0:00:58
49500 -- [-942.247] (-942.585) (-942.423) (-942.122) * (-941.271) (-940.353) [-946.089] (-941.797) -- 0:00:57
50000 -- (-942.688) (-947.482) [-941.904] (-941.631) * [-942.191] (-940.459) (-944.150) (-944.875) -- 0:00:57
Average standard deviation of split frequencies: 0.028355
50500 -- (-946.898) (-940.809) [-943.503] (-942.660) * (-942.734) [-940.739] (-949.348) (-942.281) -- 0:00:56
51000 -- (-944.657) (-943.478) (-944.511) [-943.210] * (-941.808) (-940.739) (-947.063) [-943.520] -- 0:00:55
51500 -- (-941.740) (-944.396) (-945.395) [-941.550] * [-941.242] (-943.098) (-944.489) (-942.069) -- 0:00:55
52000 -- (-943.260) [-945.456] (-943.652) (-940.987) * (-944.927) (-943.289) (-942.072) [-943.671] -- 0:00:54
52500 -- (-943.277) (-944.318) (-942.451) [-940.919] * (-946.006) [-940.687] (-942.316) (-942.362) -- 0:00:54
53000 -- [-945.939] (-942.624) (-942.550) (-941.658) * (-941.453) [-940.687] (-942.821) (-942.100) -- 0:00:53
53500 -- (-943.657) (-943.636) [-941.904] (-941.667) * (-942.286) (-942.676) (-941.317) [-942.575] -- 0:00:53
54000 -- (-944.102) (-943.561) (-945.241) [-941.682] * [-943.866] (-944.232) (-942.536) (-946.628) -- 0:00:52
54500 -- (-943.366) [-943.905] (-947.143) (-940.971) * (-943.015) (-944.404) [-941.067] (-945.191) -- 0:00:52
55000 -- (-946.336) (-943.155) (-942.782) [-941.374] * (-942.361) [-942.872] (-941.620) (-941.629) -- 0:01:08
Average standard deviation of split frequencies: 0.026517
55500 -- (-944.289) (-943.163) (-940.854) [-941.790] * (-941.000) [-944.382] (-941.681) (-942.194) -- 0:01:08
56000 -- (-941.871) (-944.773) (-942.201) [-940.814] * (-941.627) [-942.523] (-942.310) (-943.182) -- 0:01:07
56500 -- (-943.483) (-950.007) [-942.354] (-942.753) * [-940.060] (-943.578) (-942.026) (-941.950) -- 0:01:06
57000 -- (-943.250) (-944.680) (-941.270) [-942.064] * [-940.806] (-941.330) (-944.591) (-941.722) -- 0:01:06
57500 -- (-943.873) (-941.896) [-941.754] (-944.094) * [-940.258] (-943.574) (-947.623) (-941.462) -- 0:01:05
58000 -- [-940.434] (-943.405) (-943.469) (-942.618) * (-942.533) (-945.820) [-940.654] (-942.014) -- 0:01:04
58500 -- (-940.721) (-942.227) (-943.689) [-946.657] * (-946.618) (-941.036) (-946.354) [-941.013] -- 0:01:04
59000 -- (-942.379) (-942.325) [-941.245] (-942.086) * (-942.574) (-946.390) (-942.920) [-942.890] -- 0:01:03
59500 -- (-944.581) [-942.253] (-941.582) (-942.035) * (-941.572) (-950.747) (-942.408) [-941.380] -- 0:01:03
60000 -- (-942.461) (-942.132) (-945.291) [-941.502] * (-942.648) [-941.839] (-945.038) (-944.369) -- 0:01:02
Average standard deviation of split frequencies: 0.028750
60500 -- (-942.157) [-941.303] (-941.499) (-943.572) * [-942.328] (-942.093) (-943.183) (-943.289) -- 0:01:02
61000 -- (-943.361) [-941.372] (-940.878) (-942.837) * (-944.284) [-942.786] (-941.852) (-944.689) -- 0:01:01
61500 -- (-946.948) [-942.365] (-942.055) (-941.595) * (-940.743) (-946.207) [-940.810] (-941.330) -- 0:01:01
62000 -- (-943.761) (-948.971) (-942.891) [-942.395] * (-940.972) (-945.495) (-943.495) [-941.881] -- 0:01:00
62500 -- [-942.698] (-946.326) (-941.276) (-944.053) * [-942.297] (-944.615) (-943.190) (-941.267) -- 0:01:00
63000 -- (-944.948) (-943.119) [-941.379] (-941.487) * (-942.685) [-941.935] (-949.038) (-940.791) -- 0:00:59
63500 -- (-941.723) [-940.413] (-941.230) (-942.088) * (-942.791) (-940.629) [-941.739] (-943.076) -- 0:00:58
64000 -- (-941.532) (-942.459) (-940.735) [-941.381] * [-941.839] (-940.406) (-943.021) (-943.378) -- 0:00:58
64500 -- [-942.394] (-940.870) (-942.915) (-940.669) * (-941.171) (-944.222) (-940.690) [-940.795] -- 0:00:58
65000 -- [-940.813] (-940.302) (-943.705) (-950.565) * (-943.167) (-948.253) [-942.563] (-945.299) -- 0:00:57
Average standard deviation of split frequencies: 0.024999
65500 -- (-941.170) (-941.794) (-942.582) [-948.186] * [-944.476] (-942.535) (-941.735) (-942.008) -- 0:00:57
66000 -- (-949.811) (-947.542) [-942.938] (-947.564) * (-941.134) [-940.944] (-943.219) (-943.769) -- 0:00:56
66500 -- [-942.750] (-941.926) (-942.181) (-944.384) * (-944.014) [-941.783] (-941.118) (-941.449) -- 0:00:56
67000 -- (-942.978) (-940.169) [-942.661] (-944.783) * (-943.266) (-942.061) (-941.082) [-941.174] -- 0:00:55
67500 -- (-943.489) (-941.133) (-943.359) [-942.248] * (-944.962) (-941.578) (-940.708) [-941.094] -- 0:00:55
68000 -- [-942.403] (-942.120) (-943.524) (-943.107) * (-943.325) [-940.076] (-942.869) (-942.993) -- 0:00:54
68500 -- [-942.227] (-945.810) (-945.293) (-942.350) * (-945.528) (-944.602) (-942.883) [-941.624] -- 0:00:54
69000 -- (-940.864) (-944.410) [-940.705] (-940.997) * (-943.648) (-943.934) (-941.145) [-940.899] -- 0:00:53
69500 -- [-940.665] (-941.950) (-941.794) (-942.620) * [-941.273] (-940.825) (-941.866) (-941.356) -- 0:01:06
70000 -- [-940.626] (-943.567) (-946.053) (-945.073) * (-941.064) (-940.255) [-940.630] (-941.173) -- 0:01:06
Average standard deviation of split frequencies: 0.027054
70500 -- [-940.869] (-941.849) (-943.016) (-942.136) * (-941.027) (-941.818) [-942.409] (-946.981) -- 0:01:05
71000 -- [-941.769] (-942.331) (-941.738) (-943.166) * (-943.213) [-943.739] (-942.953) (-949.159) -- 0:01:05
71500 -- (-945.818) (-943.138) [-942.335] (-942.229) * (-940.695) (-945.095) [-941.813] (-940.995) -- 0:01:04
72000 -- (-940.209) (-946.774) (-941.662) [-940.734] * (-941.770) (-944.580) (-942.578) [-941.752] -- 0:01:04
72500 -- (-940.209) (-941.381) [-943.499] (-941.108) * (-947.133) [-941.124] (-943.681) (-941.099) -- 0:01:03
73000 -- (-942.476) [-941.747] (-941.379) (-942.701) * (-942.177) (-940.652) (-942.799) [-940.993] -- 0:01:03
73500 -- (-940.926) [-941.947] (-941.542) (-943.445) * [-941.744] (-940.297) (-943.073) (-940.969) -- 0:01:03
74000 -- (-940.651) (-941.561) [-942.044] (-942.846) * [-940.424] (-941.730) (-942.686) (-942.208) -- 0:01:02
74500 -- (-943.558) (-941.024) (-941.875) [-943.330] * (-944.491) (-941.078) [-941.788] (-945.915) -- 0:01:02
75000 -- (-941.155) [-941.001] (-942.247) (-942.088) * (-943.081) (-941.036) [-942.434] (-944.388) -- 0:01:01
Average standard deviation of split frequencies: 0.029381
75500 -- (-940.350) [-941.066] (-942.492) (-946.842) * (-943.418) (-941.981) [-943.329] (-942.024) -- 0:01:01
76000 -- (-941.134) [-943.139] (-942.322) (-942.365) * (-942.658) (-941.458) (-941.772) [-941.851] -- 0:01:00
76500 -- [-940.607] (-944.498) (-942.151) (-942.191) * (-946.444) (-942.647) [-941.630] (-941.561) -- 0:01:00
77000 -- [-943.554] (-948.453) (-941.477) (-943.654) * (-945.918) (-942.808) [-942.869] (-940.438) -- 0:00:59
77500 -- [-941.988] (-941.304) (-942.340) (-942.615) * (-943.250) [-943.803] (-945.279) (-943.499) -- 0:00:59
78000 -- (-941.830) [-943.218] (-943.114) (-943.572) * (-940.747) [-944.702] (-944.145) (-942.513) -- 0:00:59
78500 -- (-942.343) [-943.161] (-941.349) (-941.811) * (-943.881) (-942.163) [-942.169] (-940.457) -- 0:00:58
79000 -- (-941.473) (-945.338) (-942.354) [-941.613] * (-941.669) (-946.703) (-943.996) [-941.346] -- 0:00:58
79500 -- [-941.842] (-943.753) (-941.427) (-943.962) * [-941.339] (-941.641) (-946.941) (-940.176) -- 0:00:57
80000 -- [-943.555] (-944.116) (-941.656) (-942.037) * (-946.186) (-943.748) (-941.136) [-941.542] -- 0:00:57
Average standard deviation of split frequencies: 0.027758
80500 -- (-941.396) [-942.512] (-947.171) (-942.018) * (-945.373) (-942.938) (-942.761) [-941.766] -- 0:00:57
81000 -- (-942.495) (-944.338) [-943.676] (-942.296) * (-943.529) (-941.180) (-943.397) [-940.889] -- 0:00:56
81500 -- [-942.281] (-942.133) (-941.023) (-940.976) * (-942.329) (-946.331) [-941.735] (-942.504) -- 0:00:56
82000 -- (-942.293) [-942.093] (-940.100) (-941.353) * [-946.101] (-940.886) (-942.392) (-943.830) -- 0:00:55
82500 -- (-941.956) (-942.338) (-942.545) [-942.354] * (-943.533) (-940.276) (-943.094) [-941.757] -- 0:00:55
83000 -- (-942.863) [-942.484] (-941.530) (-941.525) * [-941.773] (-940.513) (-943.716) (-943.579) -- 0:00:55
83500 -- (-943.667) [-943.950] (-941.269) (-942.849) * (-941.092) [-941.367] (-941.564) (-942.331) -- 0:00:54
84000 -- (-945.446) (-941.667) [-941.870] (-944.254) * [-940.943] (-942.487) (-940.980) (-941.118) -- 0:00:54
84500 -- (-942.047) (-941.144) [-942.976] (-943.685) * [-942.332] (-941.241) (-942.419) (-942.925) -- 0:01:05
85000 -- [-942.283] (-940.583) (-944.009) (-944.697) * (-942.170) (-944.380) (-940.717) [-942.177] -- 0:01:04
Average standard deviation of split frequencies: 0.025319
85500 -- (-944.439) (-942.135) (-942.159) [-942.067] * (-945.586) (-943.688) [-944.235] (-941.486) -- 0:01:04
86000 -- [-941.564] (-942.409) (-943.051) (-942.735) * (-941.479) (-946.326) (-941.563) [-942.610] -- 0:01:03
86500 -- (-941.413) (-942.312) [-943.139] (-944.613) * (-942.233) (-943.556) (-942.578) [-940.810] -- 0:01:03
87000 -- (-944.054) (-940.739) [-940.903] (-942.186) * [-944.927] (-945.512) (-946.340) (-942.629) -- 0:01:02
87500 -- (-943.266) [-947.375] (-945.563) (-941.271) * (-948.089) (-940.407) [-944.811] (-945.114) -- 0:01:02
88000 -- [-941.939] (-946.395) (-944.354) (-940.952) * (-942.634) (-940.240) [-942.309] (-943.114) -- 0:01:02
88500 -- [-940.562] (-940.983) (-942.233) (-943.443) * (-945.546) [-942.212] (-940.949) (-943.098) -- 0:01:01
89000 -- (-944.336) [-944.263] (-941.779) (-943.385) * [-945.618] (-942.328) (-941.896) (-950.485) -- 0:01:01
89500 -- (-941.963) (-940.542) [-945.789] (-942.856) * (-942.848) (-942.551) [-943.254] (-943.250) -- 0:01:01
90000 -- (-941.847) (-940.977) (-941.239) [-940.840] * (-943.973) (-941.962) (-942.591) [-941.838] -- 0:01:00
Average standard deviation of split frequencies: 0.020797
90500 -- (-941.684) (-944.250) (-942.544) [-944.851] * [-941.519] (-942.107) (-945.026) (-942.953) -- 0:01:00
91000 -- (-941.516) (-942.021) (-941.910) [-940.405] * (-941.416) (-944.306) (-941.920) [-941.910] -- 0:00:59
91500 -- (-942.624) (-941.071) [-944.349] (-941.352) * [-944.447] (-943.773) (-941.713) (-941.904) -- 0:00:59
92000 -- [-940.885] (-941.244) (-944.167) (-942.404) * [-941.872] (-943.847) (-942.104) (-944.740) -- 0:00:59
92500 -- (-941.319) [-941.598] (-942.026) (-941.300) * [-942.244] (-941.541) (-940.963) (-943.173) -- 0:00:58
93000 -- (-940.981) (-943.406) [-940.481] (-942.654) * (-941.718) (-942.834) [-941.794] (-940.355) -- 0:00:58
93500 -- (-941.287) [-942.828] (-942.942) (-941.990) * (-941.087) [-941.547] (-942.321) (-941.738) -- 0:00:58
94000 -- (-942.989) (-944.195) [-943.879] (-945.843) * (-943.160) [-940.798] (-943.919) (-942.776) -- 0:00:57
94500 -- (-946.560) (-942.543) (-944.429) [-946.938] * [-942.583] (-943.709) (-941.670) (-942.940) -- 0:00:57
95000 -- (-946.412) (-941.138) (-941.403) [-942.575] * (-941.537) (-942.860) (-940.829) [-942.598] -- 0:00:57
Average standard deviation of split frequencies: 0.021193
95500 -- (-940.757) [-941.037] (-941.516) (-940.696) * (-942.709) (-943.225) (-943.595) [-943.346] -- 0:00:56
96000 -- (-942.659) [-941.462] (-941.223) (-943.208) * (-946.489) (-941.437) (-943.863) [-941.016] -- 0:00:56
96500 -- (-943.892) [-942.047] (-945.543) (-941.936) * (-943.051) (-946.619) [-943.186] (-941.022) -- 0:00:56
97000 -- (-946.743) [-942.181] (-942.746) (-941.221) * (-943.984) (-943.749) (-942.925) [-943.062] -- 0:00:55
97500 -- (-944.606) (-944.178) (-943.091) [-946.232] * (-942.635) (-944.012) [-941.930] (-943.144) -- 0:00:55
98000 -- (-942.873) [-943.807] (-943.750) (-945.385) * (-941.986) [-940.089] (-946.602) (-942.873) -- 0:00:55
98500 -- (-942.786) (-946.300) (-942.832) [-942.025] * (-943.629) [-940.491] (-942.161) (-940.977) -- 0:00:54
99000 -- (-942.169) (-946.293) (-942.084) [-942.047] * (-941.314) [-940.421] (-943.803) (-940.906) -- 0:00:54
99500 -- [-942.056] (-946.625) (-941.968) (-943.519) * (-942.285) [-940.748] (-943.627) (-940.661) -- 0:01:03
100000 -- (-941.027) (-946.319) [-942.001] (-940.556) * [-944.694] (-941.077) (-943.075) (-941.318) -- 0:01:02
Average standard deviation of split frequencies: 0.020604
100500 -- (-940.793) (-941.815) (-948.066) [-941.113] * (-941.341) (-940.175) (-942.985) [-942.219] -- 0:01:02
101000 -- (-941.040) [-940.951] (-945.688) (-941.652) * [-942.288] (-940.602) (-943.631) (-942.167) -- 0:01:02
101500 -- [-941.550] (-944.570) (-942.372) (-942.776) * (-940.371) (-941.190) [-947.666] (-941.837) -- 0:01:01
102000 -- (-941.087) [-941.059] (-941.129) (-941.792) * [-943.355] (-945.351) (-943.896) (-941.495) -- 0:01:01
102500 -- (-941.793) (-940.106) (-941.059) [-942.006] * (-940.767) [-943.565] (-941.979) (-944.201) -- 0:01:01
103000 -- [-940.727] (-943.080) (-944.418) (-945.427) * (-943.327) (-940.954) (-947.693) [-942.094] -- 0:01:00
103500 -- (-942.437) [-941.300] (-944.228) (-940.701) * (-944.763) (-942.448) [-943.463] (-940.713) -- 0:01:00
104000 -- (-940.379) (-941.269) (-943.698) [-941.261] * (-941.118) [-940.910] (-942.584) (-942.259) -- 0:01:00
104500 -- (-941.415) (-945.006) (-943.058) [-944.261] * (-941.443) [-941.406] (-942.037) (-945.315) -- 0:00:59
105000 -- (-942.432) (-946.436) (-947.069) [-942.562] * [-940.755] (-940.712) (-943.083) (-947.349) -- 0:00:59
Average standard deviation of split frequencies: 0.021791
105500 -- (-942.981) (-941.722) [-944.309] (-942.738) * (-940.747) [-940.798] (-942.047) (-946.674) -- 0:00:59
106000 -- (-942.633) [-947.260] (-942.481) (-942.296) * (-941.748) (-949.282) (-943.562) [-943.277] -- 0:00:59
106500 -- [-941.241] (-942.693) (-940.552) (-945.147) * (-944.835) [-944.129] (-943.051) (-942.024) -- 0:00:58
107000 -- [-942.108] (-941.115) (-940.236) (-945.788) * (-942.545) (-943.866) (-942.418) [-941.310] -- 0:00:58
107500 -- (-941.901) (-944.116) [-941.138] (-942.773) * (-941.324) [-943.591] (-942.166) (-941.825) -- 0:00:58
108000 -- (-942.518) [-941.913] (-941.222) (-945.913) * (-940.776) (-942.141) (-946.332) [-941.614] -- 0:00:57
108500 -- (-941.844) [-941.819] (-945.947) (-941.506) * (-940.446) [-941.133] (-945.928) (-941.654) -- 0:00:57
109000 -- (-942.206) (-941.015) [-940.850] (-945.965) * (-943.021) [-941.036] (-943.963) (-941.420) -- 0:00:57
109500 -- [-943.580] (-942.597) (-942.442) (-943.445) * [-942.318] (-943.975) (-941.652) (-942.117) -- 0:00:56
110000 -- (-944.581) (-943.811) [-949.111] (-941.207) * (-943.618) (-944.819) (-941.144) [-940.714] -- 0:00:56
Average standard deviation of split frequencies: 0.022789
110500 -- (-942.385) [-941.670] (-941.154) (-941.576) * (-945.598) (-940.422) [-941.246] (-941.182) -- 0:00:56
111000 -- (-941.958) (-942.279) (-943.192) [-942.980] * (-944.873) [-940.382] (-944.589) (-942.496) -- 0:00:56
111500 -- (-942.770) (-942.170) (-942.377) [-941.357] * (-942.944) [-941.939] (-942.483) (-942.424) -- 0:00:55
112000 -- (-943.531) (-941.591) [-941.801] (-940.779) * [-941.880] (-942.742) (-944.669) (-943.054) -- 0:00:55
112500 -- (-944.458) (-941.390) [-940.796] (-941.022) * (-944.063) (-943.138) [-942.992] (-944.695) -- 0:00:55
113000 -- (-942.323) (-942.284) [-941.451] (-943.259) * (-944.666) (-942.851) (-942.920) [-942.457] -- 0:00:54
113500 -- (-943.175) (-941.143) [-940.703] (-945.457) * (-944.583) (-944.866) [-943.255] (-940.909) -- 0:01:02
114000 -- [-942.182] (-940.978) (-941.049) (-943.802) * [-943.954] (-942.977) (-943.492) (-943.239) -- 0:01:02
114500 -- (-941.038) (-940.991) [-942.736] (-941.518) * [-941.526] (-941.555) (-941.005) (-941.245) -- 0:01:01
115000 -- (-942.343) (-941.419) [-942.301] (-944.986) * (-941.263) [-943.932] (-940.456) (-941.309) -- 0:01:01
Average standard deviation of split frequencies: 0.022886
115500 -- [-941.363] (-940.235) (-942.621) (-944.293) * [-942.748] (-941.194) (-944.725) (-940.386) -- 0:01:01
116000 -- [-941.527] (-947.893) (-942.380) (-941.429) * (-941.829) [-943.261] (-944.485) (-940.406) -- 0:01:00
116500 -- (-940.404) [-940.987] (-943.328) (-941.561) * (-945.002) (-942.885) (-942.896) [-941.998] -- 0:01:00
117000 -- [-943.471] (-941.138) (-941.970) (-944.930) * (-944.551) [-941.627] (-947.355) (-942.348) -- 0:01:00
117500 -- (-943.052) (-941.224) [-941.953] (-941.359) * (-943.200) (-948.473) [-944.254] (-940.371) -- 0:01:00
118000 -- (-944.089) (-941.007) [-943.143] (-941.799) * (-943.399) (-941.691) [-941.488] (-944.087) -- 0:00:59
118500 -- (-940.972) (-942.302) (-942.964) [-942.536] * [-942.804] (-940.227) (-941.467) (-942.644) -- 0:00:59
119000 -- (-940.884) (-944.299) [-943.121] (-942.132) * (-943.392) (-940.865) [-943.628] (-941.327) -- 0:00:59
119500 -- [-942.833] (-942.042) (-942.594) (-941.908) * (-941.800) [-943.436] (-943.401) (-940.452) -- 0:00:58
120000 -- (-941.982) (-943.693) (-942.072) [-940.800] * (-940.953) [-944.435] (-944.056) (-940.145) -- 0:00:58
Average standard deviation of split frequencies: 0.021589
120500 -- [-942.020] (-942.295) (-940.884) (-941.268) * (-941.528) (-942.528) (-941.916) [-940.865] -- 0:00:58
121000 -- [-940.526] (-941.727) (-942.663) (-942.140) * (-943.013) (-943.195) (-940.243) [-941.690] -- 0:00:58
121500 -- (-941.649) (-941.691) [-940.832] (-943.332) * (-945.452) (-942.613) [-940.515] (-940.147) -- 0:00:57
122000 -- [-942.040] (-941.622) (-943.531) (-943.069) * (-944.540) (-942.495) [-940.848] (-942.290) -- 0:00:57
122500 -- [-941.917] (-945.374) (-941.905) (-943.126) * (-943.459) [-945.255] (-943.213) (-941.382) -- 0:00:57
123000 -- [-946.148] (-944.505) (-941.371) (-943.818) * (-943.190) (-947.241) (-943.461) [-943.205] -- 0:00:57
123500 -- (-945.484) (-944.977) [-940.239] (-942.994) * (-941.989) (-946.579) (-943.250) [-944.107] -- 0:00:56
124000 -- (-942.282) (-945.508) (-940.279) [-942.439] * [-942.297] (-942.298) (-950.786) (-943.883) -- 0:00:56
124500 -- [-942.135] (-945.386) (-941.371) (-942.227) * (-942.359) (-940.889) (-948.618) [-941.716] -- 0:00:56
125000 -- [-941.568] (-944.471) (-940.676) (-942.194) * [-941.693] (-948.233) (-943.729) (-942.436) -- 0:00:56
Average standard deviation of split frequencies: 0.022448
125500 -- (-941.067) (-944.681) (-943.411) [-942.572] * (-941.615) [-940.607] (-942.361) (-944.109) -- 0:00:55
126000 -- [-941.109] (-943.308) (-942.749) (-944.456) * [-945.022] (-941.567) (-944.143) (-944.523) -- 0:00:55
126500 -- (-941.518) (-944.677) (-943.705) [-942.179] * (-943.292) [-940.357] (-943.722) (-944.172) -- 0:00:55
127000 -- (-941.488) (-941.987) [-941.195] (-942.312) * (-941.664) [-941.127] (-941.698) (-941.202) -- 0:00:54
127500 -- (-944.434) (-943.065) [-943.737] (-940.839) * [-941.858] (-944.659) (-941.594) (-941.275) -- 0:00:54
128000 -- (-944.051) (-943.429) (-941.911) [-942.974] * [-941.787] (-941.429) (-947.864) (-942.451) -- 0:00:54
128500 -- [-945.308] (-943.930) (-943.967) (-942.289) * (-943.214) [-943.197] (-943.914) (-945.732) -- 0:01:01
129000 -- (-940.982) (-941.433) (-942.733) [-941.734] * (-942.634) (-943.567) (-944.487) [-941.723] -- 0:01:00
129500 -- (-941.387) (-940.782) [-945.387] (-943.250) * (-941.326) (-941.440) (-941.549) [-943.237] -- 0:01:00
130000 -- (-943.619) (-945.937) [-942.474] (-943.889) * [-941.320] (-941.440) (-942.803) (-941.309) -- 0:01:00
Average standard deviation of split frequencies: 0.024684
130500 -- [-946.951] (-943.700) (-941.316) (-941.467) * (-942.015) (-943.852) (-947.494) [-942.610] -- 0:00:59
131000 -- (-942.535) (-942.251) (-941.638) [-942.500] * [-942.239] (-943.615) (-946.914) (-947.238) -- 0:00:59
131500 -- (-941.517) (-944.135) [-943.675] (-941.931) * (-942.593) [-940.808] (-941.759) (-943.356) -- 0:00:59
132000 -- (-942.148) (-941.651) (-942.087) [-941.553] * (-941.566) (-941.463) [-943.753] (-946.190) -- 0:00:59
132500 -- (-948.250) (-943.058) [-944.913] (-943.170) * [-944.118] (-941.855) (-941.220) (-943.250) -- 0:00:58
133000 -- (-945.004) [-941.843] (-947.307) (-941.925) * (-942.431) [-942.672] (-942.486) (-942.183) -- 0:00:58
133500 -- [-949.900] (-941.124) (-946.825) (-940.592) * [-942.126] (-942.475) (-942.757) (-942.458) -- 0:00:58
134000 -- (-945.960) (-943.615) [-940.009] (-945.400) * (-947.733) [-942.138] (-940.737) (-940.817) -- 0:00:58
134500 -- (-954.038) (-946.943) [-943.458] (-943.275) * (-944.139) (-941.297) (-941.600) [-941.607] -- 0:00:57
135000 -- (-946.302) (-943.462) (-941.722) [-943.421] * [-942.749] (-945.696) (-940.554) (-941.420) -- 0:00:57
Average standard deviation of split frequencies: 0.023108
135500 -- (-942.415) (-942.924) [-940.582] (-945.902) * (-941.688) (-943.561) (-940.763) [-940.659] -- 0:00:57
136000 -- (-945.023) (-945.116) [-944.771] (-945.493) * (-945.633) (-942.958) (-940.374) [-942.285] -- 0:00:57
136500 -- (-942.532) (-941.886) (-941.276) [-945.358] * (-940.652) [-942.511] (-941.743) (-941.505) -- 0:00:56
137000 -- (-940.905) (-944.782) [-942.363] (-942.594) * (-942.981) (-944.073) [-940.666] (-941.564) -- 0:00:56
137500 -- (-941.215) [-944.807] (-942.585) (-941.671) * (-943.031) [-940.881] (-941.061) (-941.809) -- 0:00:56
138000 -- [-944.779] (-944.495) (-941.904) (-941.056) * [-941.074] (-942.828) (-942.381) (-943.801) -- 0:00:56
138500 -- (-943.509) [-942.127] (-940.907) (-942.610) * (-941.246) [-943.598] (-941.779) (-940.790) -- 0:00:55
139000 -- (-942.414) (-943.466) [-940.680] (-942.219) * (-940.124) (-941.326) (-940.658) [-940.261] -- 0:00:55
139500 -- [-941.083] (-941.276) (-941.563) (-941.935) * [-940.116] (-942.650) (-941.137) (-941.990) -- 0:00:55
140000 -- [-942.585] (-945.113) (-943.474) (-943.662) * (-942.646) [-942.047] (-943.407) (-942.149) -- 0:00:55
Average standard deviation of split frequencies: 0.022900
140500 -- (-941.555) [-942.450] (-942.545) (-945.864) * (-942.016) [-943.150] (-951.726) (-942.170) -- 0:00:55
141000 -- (-947.626) [-941.410] (-941.932) (-942.822) * (-943.987) (-941.504) (-945.722) [-943.259] -- 0:00:54
141500 -- (-944.673) [-942.048] (-940.932) (-940.729) * [-941.694] (-945.110) (-943.492) (-941.274) -- 0:00:54
142000 -- [-943.256] (-941.104) (-942.703) (-941.277) * [-943.372] (-941.247) (-941.461) (-942.096) -- 0:00:54
142500 -- (-945.215) (-942.564) (-940.649) [-940.613] * (-944.103) (-942.762) (-943.892) [-941.621] -- 0:00:54
143000 -- (-942.839) [-941.069] (-942.522) (-941.241) * (-942.578) (-945.129) (-941.887) [-942.927] -- 0:00:53
143500 -- (-947.448) [-940.662] (-945.302) (-940.949) * [-943.089] (-941.034) (-943.310) (-943.445) -- 0:00:53
144000 -- (-944.838) (-941.092) (-944.077) [-940.631] * (-941.897) [-942.041] (-945.813) (-943.691) -- 0:00:59
144500 -- (-942.897) (-944.902) (-943.022) [-941.432] * (-940.862) (-940.432) [-944.695] (-941.374) -- 0:00:59
145000 -- (-945.950) (-944.529) (-947.097) [-941.318] * (-942.255) (-943.959) [-943.299] (-941.201) -- 0:00:58
Average standard deviation of split frequencies: 0.022602
145500 -- (-944.542) (-942.495) (-942.950) [-941.352] * (-940.694) (-944.795) [-942.041] (-941.886) -- 0:00:58
146000 -- [-943.241] (-943.703) (-943.554) (-942.352) * [-940.779] (-940.442) (-940.858) (-943.122) -- 0:00:58
146500 -- (-940.664) (-943.804) [-940.812] (-944.031) * [-941.479] (-940.664) (-940.388) (-946.281) -- 0:00:58
147000 -- (-943.105) (-944.713) (-941.020) [-943.047] * [-942.086] (-940.645) (-941.288) (-942.587) -- 0:00:58
147500 -- (-942.545) (-941.942) (-944.355) [-942.002] * (-941.900) [-944.986] (-941.392) (-944.513) -- 0:00:57
148000 -- (-943.081) [-943.025] (-942.500) (-941.931) * [-944.078] (-945.036) (-940.544) (-950.499) -- 0:00:57
148500 -- [-943.635] (-941.433) (-943.037) (-944.042) * (-940.823) [-941.478] (-940.840) (-946.191) -- 0:00:57
149000 -- (-945.274) (-942.467) (-940.535) [-942.927] * (-941.137) [-941.999] (-940.662) (-940.879) -- 0:00:57
149500 -- [-944.988] (-942.362) (-942.168) (-945.531) * (-945.214) (-943.867) [-943.244] (-943.139) -- 0:00:56
150000 -- [-948.481] (-943.708) (-940.618) (-941.308) * (-943.051) (-941.732) [-942.053] (-940.132) -- 0:00:56
Average standard deviation of split frequencies: 0.022560
150500 -- [-944.494] (-941.944) (-940.936) (-941.635) * (-946.390) [-941.569] (-944.368) (-941.852) -- 0:00:56
151000 -- [-944.076] (-942.764) (-941.953) (-941.959) * [-942.587] (-943.012) (-944.487) (-946.969) -- 0:00:56
151500 -- (-942.442) (-943.287) [-945.039] (-943.060) * (-942.926) (-943.005) (-943.014) [-943.775] -- 0:00:56
152000 -- (-943.677) [-943.444] (-942.722) (-941.452) * [-942.823] (-941.220) (-941.105) (-943.733) -- 0:00:55
152500 -- (-944.098) (-942.431) (-944.474) [-941.772] * (-943.185) [-941.610] (-940.891) (-944.395) -- 0:00:55
153000 -- (-944.255) (-942.813) (-944.547) [-941.798] * (-943.938) (-941.219) [-941.895] (-941.891) -- 0:00:55
153500 -- [-943.357] (-946.012) (-943.026) (-941.401) * (-944.452) [-940.976] (-940.089) (-942.441) -- 0:00:55
154000 -- (-943.179) [-942.763] (-944.860) (-943.833) * (-946.248) (-950.393) [-943.223] (-946.805) -- 0:00:54
154500 -- (-942.827) (-940.913) (-944.506) [-941.589] * [-945.704] (-942.281) (-942.409) (-942.945) -- 0:00:54
155000 -- [-941.031] (-942.019) (-941.256) (-943.521) * (-942.503) [-942.147] (-942.053) (-945.637) -- 0:00:54
Average standard deviation of split frequencies: 0.021321
155500 -- (-941.051) (-941.828) (-942.578) [-940.477] * (-942.027) (-941.704) [-941.812] (-946.310) -- 0:00:54
156000 -- [-940.986] (-946.859) (-941.283) (-940.994) * (-944.133) [-942.265] (-943.408) (-943.895) -- 0:00:54
156500 -- (-942.683) [-940.284] (-943.350) (-944.730) * (-942.895) (-944.270) [-943.993] (-942.109) -- 0:00:53
157000 -- (-941.176) [-941.678] (-940.568) (-942.384) * (-945.380) [-944.957] (-940.540) (-942.042) -- 0:00:53
157500 -- [-943.938] (-941.899) (-941.618) (-942.735) * [-944.625] (-945.895) (-943.528) (-941.702) -- 0:00:53
158000 -- (-943.824) (-942.864) [-942.475] (-942.583) * (-943.660) (-941.592) [-942.382] (-943.409) -- 0:00:58
158500 -- (-943.109) (-941.970) [-941.503] (-941.574) * (-943.741) (-943.622) [-943.511] (-941.349) -- 0:00:58
159000 -- (-942.669) (-943.990) (-943.419) [-940.930] * (-949.185) (-941.782) [-948.507] (-944.424) -- 0:00:58
159500 -- (-943.878) (-941.893) (-941.735) [-944.205] * (-944.019) (-942.221) [-941.967] (-941.051) -- 0:00:57
160000 -- [-943.556] (-940.401) (-944.735) (-947.236) * [-944.471] (-941.326) (-945.290) (-941.467) -- 0:00:57
Average standard deviation of split frequencies: 0.018122
160500 -- (-945.515) [-940.997] (-944.483) (-942.099) * [-946.699] (-940.552) (-940.356) (-941.541) -- 0:00:57
161000 -- (-944.440) (-940.268) [-943.594] (-945.436) * (-945.763) (-943.624) [-942.913] (-942.423) -- 0:00:57
161500 -- (-944.560) (-940.551) (-945.392) [-942.836] * (-945.897) [-941.911] (-945.202) (-941.838) -- 0:00:57
162000 -- (-941.880) [-943.210] (-941.751) (-940.786) * (-942.982) (-945.034) [-941.898] (-942.615) -- 0:00:56
162500 -- [-944.281] (-941.768) (-942.925) (-942.872) * (-940.703) (-945.264) (-944.355) [-941.822] -- 0:00:56
163000 -- (-941.664) [-945.525] (-942.749) (-943.220) * (-943.404) [-946.925] (-945.662) (-942.825) -- 0:00:56
163500 -- (-942.884) (-940.632) [-942.347] (-947.697) * (-940.876) (-945.657) (-945.194) [-941.756] -- 0:00:56
164000 -- (-944.043) (-941.376) (-945.052) [-942.310] * (-941.607) [-943.267] (-942.638) (-943.657) -- 0:00:56
164500 -- (-944.994) (-940.688) [-943.691] (-941.683) * [-942.098] (-940.978) (-942.476) (-940.823) -- 0:00:55
165000 -- (-940.979) (-941.849) [-942.163] (-941.677) * (-942.211) (-940.740) [-941.819] (-940.974) -- 0:00:55
Average standard deviation of split frequencies: 0.019043
165500 -- [-945.570] (-942.123) (-943.865) (-942.621) * (-942.569) [-940.618] (-941.508) (-940.584) -- 0:00:55
166000 -- (-942.050) (-945.185) (-945.441) [-942.625] * (-942.661) (-941.487) (-946.131) [-940.011] -- 0:00:55
166500 -- (-940.599) (-941.636) (-945.819) [-944.755] * (-942.941) (-942.412) (-941.030) [-941.554] -- 0:00:55
167000 -- [-944.922] (-942.020) (-944.127) (-942.454) * (-944.076) (-943.389) (-941.753) [-940.726] -- 0:00:54
167500 -- [-946.294] (-943.342) (-942.907) (-942.157) * (-941.436) [-940.938] (-943.738) (-941.356) -- 0:00:54
168000 -- (-943.864) (-940.899) [-942.373] (-943.186) * (-942.207) [-940.938] (-944.258) (-944.065) -- 0:00:54
168500 -- (-943.236) [-940.948] (-943.729) (-942.843) * (-943.764) [-944.712] (-943.368) (-944.404) -- 0:00:54
169000 -- (-944.695) [-941.071] (-946.844) (-941.226) * (-945.321) (-943.825) [-944.048] (-942.443) -- 0:00:54
169500 -- [-942.716] (-943.028) (-943.207) (-941.885) * (-941.811) (-942.515) [-940.919] (-942.962) -- 0:00:53
170000 -- [-946.294] (-945.817) (-944.332) (-943.375) * (-940.538) (-941.103) (-941.476) [-946.354] -- 0:00:53
Average standard deviation of split frequencies: 0.018414
170500 -- (-944.281) [-941.233] (-946.068) (-941.277) * (-940.403) (-942.045) (-942.983) [-944.417] -- 0:00:53
171000 -- (-941.158) (-943.369) (-941.558) [-942.721] * (-940.685) (-944.081) [-942.134] (-942.461) -- 0:00:58
171500 -- (-942.172) (-940.541) [-941.759] (-942.261) * (-947.991) [-943.770] (-942.542) (-941.299) -- 0:00:57
172000 -- (-942.284) [-942.663] (-942.788) (-942.891) * [-942.883] (-943.731) (-943.094) (-940.768) -- 0:00:57
172500 -- (-941.204) (-942.748) [-944.559] (-941.902) * (-943.906) [-942.651] (-941.999) (-940.736) -- 0:00:57
173000 -- (-942.849) [-941.075] (-943.413) (-944.812) * (-942.329) (-941.409) (-940.689) [-941.609] -- 0:00:57
173500 -- (-946.494) [-940.879] (-940.288) (-944.491) * (-942.305) (-942.748) (-942.412) [-940.777] -- 0:00:57
174000 -- (-942.693) [-943.570] (-940.676) (-940.304) * (-941.094) (-940.187) [-940.535] (-945.997) -- 0:00:56
174500 -- [-944.752] (-940.088) (-940.999) (-943.619) * [-942.715] (-943.708) (-941.664) (-943.068) -- 0:00:56
175000 -- (-945.300) [-943.873] (-941.013) (-941.051) * (-941.778) [-943.176] (-941.962) (-944.181) -- 0:00:56
Average standard deviation of split frequencies: 0.018749
175500 -- (-941.662) (-946.013) [-940.995] (-941.302) * (-941.171) (-944.388) [-941.743] (-942.536) -- 0:00:56
176000 -- (-943.452) (-942.476) [-943.673] (-941.659) * [-942.588] (-940.737) (-942.139) (-941.333) -- 0:00:56
176500 -- [-941.009] (-941.069) (-942.146) (-945.376) * (-940.300) (-941.909) (-942.086) [-940.715] -- 0:00:55
177000 -- (-941.627) (-941.165) [-945.222] (-943.442) * (-940.504) (-942.448) [-943.425] (-945.623) -- 0:00:55
177500 -- (-940.943) (-941.685) (-942.019) [-941.382] * (-947.730) [-939.992] (-943.744) (-942.659) -- 0:00:55
178000 -- (-943.438) [-945.214] (-941.790) (-941.245) * (-946.215) (-948.159) (-944.344) [-943.278] -- 0:00:55
178500 -- (-943.946) (-944.606) (-945.814) [-943.002] * [-944.838] (-944.329) (-944.031) (-941.698) -- 0:00:55
179000 -- [-943.071] (-947.138) (-943.530) (-942.583) * (-943.750) (-943.259) [-941.495] (-942.865) -- 0:00:55
179500 -- (-942.760) (-943.743) (-941.506) [-944.376] * [-941.778] (-946.300) (-944.236) (-943.416) -- 0:00:54
180000 -- (-942.262) (-942.973) (-941.854) [-940.405] * (-942.712) (-941.615) (-945.117) [-941.147] -- 0:00:54
Average standard deviation of split frequencies: 0.018120
180500 -- (-941.962) (-940.857) [-940.731] (-940.893) * (-942.015) (-942.874) [-946.179] (-942.929) -- 0:00:54
181000 -- (-943.848) (-940.960) (-942.902) [-944.420] * (-942.727) (-940.945) (-947.260) [-941.163] -- 0:00:54
181500 -- (-942.008) (-941.484) (-944.019) [-941.273] * [-944.554] (-941.737) (-945.389) (-941.050) -- 0:00:54
182000 -- (-943.117) [-941.562] (-941.543) (-941.259) * (-952.317) (-942.490) [-942.876] (-940.758) -- 0:00:53
182500 -- (-944.135) (-941.596) (-948.721) [-941.308] * [-942.433] (-942.488) (-942.356) (-944.509) -- 0:00:53
183000 -- (-945.557) [-941.695] (-941.029) (-942.047) * [-941.135] (-941.518) (-942.553) (-943.267) -- 0:00:53
183500 -- (-947.702) [-947.723] (-942.187) (-947.006) * (-941.117) [-945.234] (-942.385) (-943.034) -- 0:00:53
184000 -- (-942.669) [-940.723] (-941.366) (-940.516) * (-942.588) [-944.667] (-941.401) (-947.312) -- 0:00:53
184500 -- (-946.980) [-948.392] (-941.374) (-940.299) * (-943.400) (-940.365) (-949.992) [-941.597] -- 0:00:53
185000 -- [-943.137] (-942.889) (-945.182) (-943.915) * [-940.602] (-940.365) (-945.337) (-948.161) -- 0:00:52
Average standard deviation of split frequencies: 0.019769
185500 -- (-943.828) [-943.064] (-943.687) (-940.211) * [-942.408] (-940.365) (-940.306) (-944.637) -- 0:00:52
186000 -- (-944.901) (-944.265) [-942.781] (-940.155) * [-945.661] (-941.347) (-943.234) (-943.052) -- 0:00:52
186500 -- [-942.743] (-945.648) (-943.258) (-940.083) * [-945.853] (-942.551) (-943.299) (-942.584) -- 0:00:56
187000 -- (-942.276) [-944.380] (-945.521) (-941.290) * [-942.268] (-942.075) (-941.946) (-941.562) -- 0:00:56
187500 -- (-941.138) (-945.014) [-940.447] (-943.346) * (-941.021) [-942.697] (-944.135) (-944.026) -- 0:00:56
188000 -- (-943.658) (-943.969) (-941.227) [-942.525] * (-941.839) (-940.380) (-944.276) [-941.559] -- 0:00:56
188500 -- (-944.589) [-942.828] (-941.805) (-940.750) * (-943.646) [-940.379] (-942.002) (-940.374) -- 0:00:55
189000 -- (-942.396) (-940.980) (-942.036) [-942.832] * (-945.649) (-946.917) (-943.055) [-941.145] -- 0:00:55
189500 -- (-941.172) (-942.793) [-945.817] (-940.701) * (-941.710) (-943.778) (-944.324) [-943.480] -- 0:00:55
190000 -- (-942.609) (-944.220) (-940.749) [-940.763] * (-942.447) (-946.257) (-944.237) [-940.747] -- 0:00:55
Average standard deviation of split frequencies: 0.018738
190500 -- (-944.317) [-942.180] (-941.721) (-942.632) * (-945.886) (-943.041) [-942.222] (-940.472) -- 0:00:55
191000 -- [-943.369] (-940.959) (-941.681) (-949.044) * (-940.957) [-942.861] (-943.347) (-941.677) -- 0:00:55
191500 -- (-941.897) (-941.400) [-940.671] (-947.148) * [-943.953] (-941.321) (-949.531) (-941.002) -- 0:00:54
192000 -- (-940.293) (-940.715) [-940.618] (-941.224) * [-942.354] (-943.863) (-943.611) (-943.069) -- 0:00:54
192500 -- (-941.640) (-942.094) (-941.423) [-941.112] * (-950.287) (-942.880) (-940.691) [-947.110] -- 0:00:54
193000 -- (-944.016) (-942.908) (-942.196) [-943.059] * (-946.006) [-941.005] (-942.015) (-944.755) -- 0:00:54
193500 -- (-941.273) [-941.388] (-942.022) (-942.184) * (-943.377) (-942.123) [-942.775] (-941.570) -- 0:00:54
194000 -- (-941.646) (-941.889) (-942.202) [-940.961] * (-940.523) [-940.552] (-941.667) (-947.280) -- 0:00:54
194500 -- (-941.100) (-941.556) (-942.261) [-941.316] * [-941.428] (-942.370) (-941.967) (-945.064) -- 0:00:53
195000 -- (-941.838) [-941.564] (-942.884) (-945.449) * (-947.028) (-942.116) [-941.966] (-944.226) -- 0:00:53
Average standard deviation of split frequencies: 0.017402
195500 -- (-942.424) (-945.971) [-943.176] (-942.645) * (-945.975) [-945.688] (-945.116) (-943.764) -- 0:00:53
196000 -- (-941.498) (-941.755) [-943.201] (-942.531) * (-950.758) [-942.982] (-942.117) (-945.519) -- 0:00:53
196500 -- (-942.458) (-942.609) (-948.635) [-940.265] * [-941.378] (-945.406) (-941.936) (-944.166) -- 0:00:53
197000 -- (-942.994) (-945.323) (-947.888) [-945.407] * (-941.865) (-942.242) (-941.566) [-943.180] -- 0:00:52
197500 -- (-942.768) [-942.783] (-943.134) (-941.073) * (-943.993) (-942.587) [-947.204] (-943.221) -- 0:00:52
198000 -- (-942.483) (-942.051) (-942.088) [-941.073] * (-941.845) (-943.607) (-944.831) [-941.847] -- 0:00:52
198500 -- (-943.389) [-941.703] (-942.119) (-941.475) * (-941.940) (-943.323) [-947.640] (-941.586) -- 0:00:52
199000 -- (-943.838) [-940.760] (-942.634) (-940.379) * (-942.401) (-943.908) [-942.047] (-941.600) -- 0:00:52
199500 -- (-944.815) [-942.983] (-942.865) (-940.400) * (-941.972) (-942.368) [-947.015] (-940.984) -- 0:00:52
200000 -- (-946.866) (-942.251) (-945.630) [-943.721] * (-941.590) [-940.399] (-944.456) (-941.034) -- 0:00:51
Average standard deviation of split frequencies: 0.015477
200500 -- (-942.754) (-943.957) [-944.957] (-942.233) * (-940.951) [-942.087] (-942.018) (-941.044) -- 0:00:55
201000 -- (-945.326) (-943.657) [-941.050] (-940.466) * (-940.930) (-943.517) [-942.448] (-941.407) -- 0:00:55
201500 -- [-941.413] (-943.701) (-941.131) (-941.755) * (-941.044) [-943.664] (-941.253) (-940.273) -- 0:00:55
202000 -- (-942.134) (-941.967) (-943.922) [-941.793] * (-941.972) (-946.070) (-943.444) [-940.280] -- 0:00:55
202500 -- (-941.766) (-942.440) [-943.242] (-942.508) * [-940.441] (-944.024) (-941.591) (-940.337) -- 0:00:55
203000 -- (-945.664) (-945.663) (-941.004) [-940.606] * [-940.768] (-942.831) (-942.333) (-941.498) -- 0:00:54
203500 -- (-942.586) (-942.320) (-941.092) [-941.820] * (-946.341) [-941.307] (-943.338) (-945.358) -- 0:00:54
204000 -- [-943.358] (-942.433) (-945.731) (-946.730) * (-942.215) [-941.564] (-943.133) (-941.065) -- 0:00:54
204500 -- (-942.116) [-941.284] (-944.344) (-943.464) * [-940.906] (-942.040) (-943.254) (-944.137) -- 0:00:54
205000 -- (-940.897) (-940.655) (-945.989) [-943.006] * (-940.928) [-942.580] (-940.875) (-941.711) -- 0:00:54
Average standard deviation of split frequencies: 0.017095
205500 -- (-941.468) (-943.001) [-942.280] (-944.462) * (-941.177) (-943.718) (-940.800) [-942.564] -- 0:00:54
206000 -- (-943.567) [-941.416] (-941.951) (-946.005) * (-941.448) (-940.634) (-942.563) [-941.036] -- 0:00:53
206500 -- (-946.640) (-941.595) [-942.773] (-942.508) * (-940.420) (-945.869) (-940.918) [-941.369] -- 0:00:53
207000 -- (-946.674) (-944.649) [-943.824] (-943.409) * [-942.503] (-942.962) (-941.292) (-950.532) -- 0:00:53
207500 -- (-943.304) (-944.898) [-946.971] (-943.174) * [-942.032] (-944.476) (-942.416) (-941.088) -- 0:00:53
208000 -- [-942.583] (-941.499) (-944.157) (-945.580) * [-942.881] (-950.912) (-941.317) (-943.452) -- 0:00:53
208500 -- (-940.731) [-944.274] (-942.103) (-941.761) * (-944.003) (-949.917) (-945.054) [-943.715] -- 0:00:53
209000 -- (-940.604) [-941.777] (-941.500) (-942.421) * [-940.942] (-944.169) (-943.270) (-942.965) -- 0:00:52
209500 -- (-943.477) (-943.799) (-941.749) [-943.287] * (-940.822) (-945.119) [-941.640] (-945.624) -- 0:00:52
210000 -- [-942.924] (-942.606) (-942.570) (-943.370) * (-941.094) (-944.812) (-941.386) [-941.633] -- 0:00:52
Average standard deviation of split frequencies: 0.016585
210500 -- (-941.169) (-944.717) (-941.452) [-945.597] * [-941.036] (-947.246) (-941.756) (-942.893) -- 0:00:52
211000 -- (-944.601) (-942.604) [-941.064] (-941.615) * (-940.930) (-947.966) [-941.137] (-940.219) -- 0:00:52
211500 -- (-942.877) (-943.432) [-942.285] (-943.677) * [-941.667] (-941.678) (-943.767) (-941.793) -- 0:00:52
212000 -- (-942.507) [-941.548] (-940.918) (-943.683) * [-943.861] (-941.471) (-944.874) (-944.541) -- 0:00:52
212500 -- (-941.362) [-940.800] (-940.552) (-940.755) * [-943.044] (-944.918) (-942.413) (-945.459) -- 0:00:51
213000 -- (-942.215) (-943.545) [-942.557] (-941.767) * (-943.197) [-942.806] (-943.195) (-943.249) -- 0:00:51
213500 -- [-940.953] (-941.819) (-942.326) (-943.727) * [-941.070] (-941.434) (-943.284) (-942.968) -- 0:00:51
214000 -- (-941.623) [-941.602] (-940.328) (-943.979) * [-942.871] (-941.654) (-944.229) (-942.962) -- 0:00:51
214500 -- [-941.379] (-942.405) (-944.111) (-940.647) * (-943.009) (-941.482) (-943.061) [-943.169] -- 0:00:51
215000 -- (-941.972) (-946.385) (-944.845) [-941.976] * (-942.622) [-941.364] (-942.864) (-942.030) -- 0:00:51
Average standard deviation of split frequencies: 0.016304
215500 -- (-942.001) [-943.338] (-941.991) (-943.839) * (-941.044) (-942.854) [-942.899] (-942.507) -- 0:00:54
216000 -- [-941.778] (-943.745) (-941.329) (-949.549) * (-942.172) [-942.729] (-948.205) (-943.449) -- 0:00:54
216500 -- (-942.136) [-943.140] (-939.993) (-945.702) * [-940.762] (-940.090) (-940.975) (-942.991) -- 0:00:54
217000 -- (-943.560) [-943.046] (-943.019) (-944.539) * (-945.534) [-941.162] (-941.651) (-943.121) -- 0:00:54
217500 -- (-943.223) [-942.402] (-943.351) (-942.906) * (-942.027) (-943.705) [-942.491] (-942.595) -- 0:00:53
218000 -- (-943.992) [-943.944] (-944.677) (-944.861) * (-940.951) (-941.131) (-941.391) [-941.981] -- 0:00:53
218500 -- (-944.113) (-945.002) (-945.794) [-945.522] * [-943.169] (-940.861) (-943.154) (-942.375) -- 0:00:53
219000 -- (-945.144) (-944.549) [-945.693] (-941.501) * [-943.631] (-943.068) (-945.621) (-944.374) -- 0:00:53
219500 -- [-941.519] (-940.834) (-943.301) (-940.359) * (-945.837) (-942.034) [-941.676] (-942.651) -- 0:00:53
220000 -- (-944.366) (-941.465) [-942.215] (-942.074) * (-941.494) [-943.186] (-940.799) (-943.316) -- 0:00:53
Average standard deviation of split frequencies: 0.015582
220500 -- (-941.060) (-940.444) [-940.539] (-941.230) * [-940.667] (-942.823) (-940.136) (-943.316) -- 0:00:53
221000 -- (-941.349) [-942.175] (-940.208) (-944.184) * [-941.426] (-942.068) (-940.350) (-942.096) -- 0:00:52
221500 -- (-942.590) (-944.252) [-942.825] (-943.511) * (-941.288) (-940.710) [-943.434] (-942.373) -- 0:00:52
222000 -- (-944.449) (-941.610) (-944.259) [-942.767] * (-942.567) (-942.175) (-943.448) [-940.618] -- 0:00:52
222500 -- [-944.845] (-943.283) (-940.894) (-943.666) * (-940.880) (-942.352) [-940.668] (-941.360) -- 0:00:52
223000 -- (-941.001) (-941.913) [-942.001] (-943.865) * (-940.065) (-946.225) [-940.720] (-942.143) -- 0:00:52
223500 -- [-942.456] (-941.791) (-941.796) (-943.832) * [-940.098] (-944.301) (-943.004) (-942.879) -- 0:00:52
224000 -- (-943.343) (-944.117) [-940.696] (-943.417) * (-943.662) (-942.780) (-941.157) [-942.209] -- 0:00:51
224500 -- (-943.562) [-940.824] (-940.186) (-942.913) * (-941.025) [-942.944] (-941.754) (-940.870) -- 0:00:51
225000 -- [-944.401] (-941.993) (-942.486) (-945.826) * (-941.021) [-941.782] (-941.473) (-941.137) -- 0:00:51
Average standard deviation of split frequencies: 0.015828
225500 -- [-945.625] (-941.725) (-945.051) (-942.736) * (-944.297) (-941.639) (-942.398) [-941.259] -- 0:00:51
226000 -- [-941.799] (-943.450) (-941.829) (-941.851) * (-946.146) [-940.815] (-945.777) (-941.311) -- 0:00:51
226500 -- [-942.072] (-944.150) (-943.286) (-940.081) * (-947.017) (-941.982) [-942.147] (-941.355) -- 0:00:51
227000 -- (-942.321) (-940.807) [-943.562] (-940.496) * (-944.244) (-942.442) [-941.604] (-942.919) -- 0:00:51
227500 -- (-942.736) [-943.440] (-942.767) (-940.455) * [-942.423] (-947.998) (-941.901) (-941.278) -- 0:00:50
228000 -- (-941.427) (-944.163) (-941.820) [-944.194] * (-940.869) (-943.107) (-941.999) [-939.950] -- 0:00:50
228500 -- [-943.027] (-942.845) (-942.349) (-942.545) * [-940.971] (-942.321) (-945.811) (-940.876) -- 0:00:50
229000 -- (-942.409) (-940.564) (-943.074) [-942.449] * [-940.861] (-943.024) (-941.050) (-939.995) -- 0:00:50
229500 -- (-945.201) [-940.743] (-945.653) (-943.349) * (-942.746) (-947.039) (-942.299) [-940.428] -- 0:00:50
230000 -- [-943.817] (-941.316) (-946.455) (-941.048) * (-941.794) (-945.407) (-942.382) [-940.437] -- 0:00:50
Average standard deviation of split frequencies: 0.016236
230500 -- (-941.515) (-944.488) (-944.378) [-941.413] * (-945.693) [-949.498] (-942.842) (-940.824) -- 0:00:50
231000 -- (-942.343) (-941.408) (-942.323) [-940.485] * (-943.258) [-942.580] (-940.959) (-942.313) -- 0:00:49
231500 -- [-941.435] (-943.373) (-942.686) (-941.831) * [-942.277] (-943.190) (-942.050) (-940.975) -- 0:00:53
232000 -- (-941.795) (-945.635) (-941.258) [-941.066] * (-942.533) [-943.039] (-944.465) (-945.305) -- 0:00:52
232500 -- (-940.222) (-942.998) [-940.818] (-943.923) * (-940.573) (-944.784) (-947.942) [-941.048] -- 0:00:52
233000 -- (-943.212) (-943.655) (-942.979) [-948.427] * [-942.388] (-942.553) (-944.384) (-942.196) -- 0:00:52
233500 -- (-943.440) (-940.757) [-942.144] (-944.507) * [-940.938] (-941.552) (-943.500) (-941.607) -- 0:00:52
234000 -- (-942.261) (-945.715) (-942.321) [-947.797] * (-941.068) [-942.134] (-944.478) (-941.785) -- 0:00:52
234500 -- (-944.308) [-941.902] (-946.163) (-941.460) * (-941.720) (-940.469) [-940.948] (-942.540) -- 0:00:52
235000 -- (-942.524) [-941.563] (-941.207) (-941.919) * (-940.914) (-940.530) [-942.045] (-942.302) -- 0:00:52
Average standard deviation of split frequencies: 0.017037
235500 -- (-943.003) (-940.948) [-940.540] (-946.719) * [-941.012] (-945.570) (-945.252) (-942.291) -- 0:00:51
236000 -- (-941.583) (-940.833) (-943.582) [-943.644] * (-941.849) (-941.228) (-944.712) [-941.300] -- 0:00:51
236500 -- (-943.900) (-942.677) (-949.073) [-940.916] * (-941.659) [-941.757] (-944.153) (-940.591) -- 0:00:51
237000 -- (-942.589) (-943.920) (-942.256) [-940.985] * (-941.656) (-944.817) [-942.789] (-940.498) -- 0:00:51
237500 -- [-941.168] (-942.913) (-941.400) (-944.609) * [-946.293] (-943.400) (-943.766) (-943.837) -- 0:00:51
238000 -- (-941.860) [-945.277] (-941.518) (-944.128) * (-940.593) (-941.758) [-945.362] (-943.285) -- 0:00:51
238500 -- (-942.775) (-945.576) (-941.643) [-942.000] * (-942.268) [-942.170] (-942.307) (-942.962) -- 0:00:51
239000 -- (-941.868) [-942.186] (-946.609) (-941.862) * (-941.167) (-943.620) (-941.300) [-942.873] -- 0:00:50
239500 -- [-941.282] (-943.287) (-943.121) (-945.499) * (-942.030) (-942.329) [-943.043] (-943.447) -- 0:00:50
240000 -- [-945.425] (-941.631) (-942.273) (-947.084) * [-941.592] (-941.429) (-941.623) (-943.163) -- 0:00:50
Average standard deviation of split frequencies: 0.015440
240500 -- (-942.853) (-944.928) [-943.403] (-944.750) * (-943.052) (-945.114) (-941.630) [-940.574] -- 0:00:50
241000 -- (-942.687) [-940.957] (-942.640) (-942.738) * [-943.451] (-945.220) (-941.609) (-942.040) -- 0:00:50
241500 -- [-942.555] (-942.708) (-941.911) (-943.317) * [-941.395] (-941.488) (-942.317) (-943.383) -- 0:00:50
242000 -- (-940.145) [-941.174] (-946.636) (-944.334) * (-941.325) [-943.317] (-944.998) (-944.442) -- 0:00:50
242500 -- (-941.446) (-940.982) [-942.898] (-940.793) * [-940.883] (-943.025) (-942.646) (-945.552) -- 0:00:49
243000 -- (-940.564) [-942.311] (-943.271) (-942.269) * (-941.737) (-943.324) [-942.550] (-943.305) -- 0:00:49
243500 -- [-942.560] (-940.745) (-944.071) (-942.302) * (-943.229) (-941.405) [-941.213] (-942.995) -- 0:00:49
244000 -- (-942.596) (-942.916) (-946.584) [-942.209] * (-945.845) (-940.610) [-941.377] (-943.689) -- 0:00:52
244500 -- [-941.881] (-942.937) (-942.377) (-941.793) * (-942.331) (-941.462) [-941.261] (-940.989) -- 0:00:52
245000 -- (-942.051) (-943.902) [-941.029] (-942.274) * [-945.027] (-941.867) (-943.201) (-941.427) -- 0:00:52
Average standard deviation of split frequencies: 0.013527
245500 -- (-941.493) [-942.449] (-940.842) (-940.394) * (-948.204) (-942.110) [-947.686] (-940.763) -- 0:00:52
246000 -- [-942.794] (-946.473) (-942.029) (-940.109) * [-941.269] (-945.399) (-941.714) (-947.890) -- 0:00:52
246500 -- [-941.542] (-941.265) (-942.888) (-940.865) * (-942.366) [-941.830] (-940.276) (-947.347) -- 0:00:51
247000 -- (-942.481) (-943.869) [-942.801] (-940.477) * (-944.342) (-941.394) (-941.055) [-944.805] -- 0:00:51
247500 -- (-941.562) (-941.576) (-941.929) [-941.420] * (-945.000) (-944.756) (-946.233) [-942.614] -- 0:00:51
248000 -- (-940.014) (-941.394) (-942.313) [-941.077] * (-945.553) (-941.452) (-944.824) [-942.457] -- 0:00:51
248500 -- (-943.391) (-942.707) [-942.614] (-941.112) * (-946.295) (-943.223) [-940.740] (-944.403) -- 0:00:51
249000 -- (-940.430) (-942.257) [-941.817] (-945.382) * (-941.557) (-942.350) (-941.913) [-942.470] -- 0:00:51
249500 -- (-943.631) (-942.613) (-946.069) [-940.692] * [-943.910] (-942.887) (-941.017) (-942.325) -- 0:00:51
250000 -- (-941.051) (-942.375) [-943.567] (-944.479) * (-943.659) [-941.378] (-943.717) (-941.341) -- 0:00:51
Average standard deviation of split frequencies: 0.013517
250500 -- [-943.742] (-944.068) (-941.392) (-940.830) * (-950.070) [-943.342] (-941.871) (-946.685) -- 0:00:50
251000 -- (-943.216) (-942.882) (-942.810) [-940.827] * (-945.007) [-945.191] (-950.886) (-943.755) -- 0:00:50
251500 -- (-944.316) [-941.312] (-942.963) (-940.705) * [-941.195] (-945.271) (-950.661) (-940.582) -- 0:00:50
252000 -- [-944.017] (-941.648) (-941.054) (-941.932) * (-941.965) (-944.343) [-940.198] (-943.563) -- 0:00:50
252500 -- (-948.618) [-942.547] (-943.082) (-942.597) * (-941.478) (-942.443) [-942.172] (-945.571) -- 0:00:50
253000 -- (-942.759) [-942.331] (-941.433) (-945.651) * (-947.396) [-940.157] (-942.522) (-942.807) -- 0:00:50
253500 -- [-945.620] (-941.568) (-944.907) (-943.302) * [-941.812] (-943.836) (-945.864) (-942.329) -- 0:00:50
254000 -- [-941.410] (-943.229) (-953.035) (-940.948) * (-943.896) (-940.260) (-940.142) [-941.149] -- 0:00:49
254500 -- (-941.458) (-942.395) (-942.475) [-941.593] * (-940.898) (-942.881) (-942.233) [-941.243] -- 0:00:49
255000 -- (-940.755) [-944.769] (-942.599) (-941.299) * [-941.920] (-944.422) (-940.666) (-943.010) -- 0:00:49
Average standard deviation of split frequencies: 0.012084
255500 -- (-940.347) (-941.503) [-941.787] (-942.657) * (-942.059) (-944.875) [-940.428] (-941.127) -- 0:00:49
256000 -- (-941.343) (-951.473) [-941.145] (-941.233) * [-942.074] (-944.976) (-940.233) (-940.653) -- 0:00:49
256500 -- (-940.915) (-948.874) (-946.575) [-941.560] * (-948.088) (-943.355) (-943.876) [-940.642] -- 0:00:52
257000 -- [-942.397] (-944.277) (-941.574) (-941.650) * [-941.495] (-942.268) (-942.034) (-941.949) -- 0:00:52
257500 -- (-941.651) (-943.322) (-942.977) [-940.520] * [-941.931] (-942.135) (-943.043) (-942.061) -- 0:00:51
258000 -- (-941.613) [-941.498] (-944.483) (-943.201) * [-941.032] (-941.370) (-946.733) (-941.920) -- 0:00:51
258500 -- [-942.052] (-941.515) (-941.733) (-940.886) * [-943.712] (-941.527) (-942.670) (-941.138) -- 0:00:51
259000 -- (-941.010) (-941.300) [-941.572] (-950.214) * [-943.482] (-942.879) (-946.842) (-942.508) -- 0:00:51
259500 -- (-940.432) [-941.440] (-941.298) (-949.045) * [-941.614] (-941.334) (-943.849) (-942.717) -- 0:00:51
260000 -- (-941.114) (-942.271) [-941.313] (-945.328) * [-940.954] (-944.591) (-943.004) (-945.561) -- 0:00:51
Average standard deviation of split frequencies: 0.011981
260500 -- [-944.841] (-940.780) (-940.810) (-944.552) * (-942.735) (-941.988) (-941.529) [-941.230] -- 0:00:51
261000 -- (-946.387) (-941.402) [-941.614] (-941.406) * (-944.629) (-940.558) (-941.890) [-940.667] -- 0:00:50
261500 -- (-943.689) (-943.413) (-942.488) [-943.661] * (-945.174) (-940.504) [-941.779] (-940.844) -- 0:00:50
262000 -- (-941.700) (-943.247) (-941.716) [-942.871] * [-943.954] (-943.186) (-941.625) (-940.953) -- 0:00:50
262500 -- (-943.254) (-943.381) (-940.367) [-944.020] * (-948.767) (-948.598) [-943.449] (-941.835) -- 0:00:50
263000 -- (-942.565) [-940.772] (-946.261) (-940.244) * (-945.048) (-941.090) [-941.350] (-940.704) -- 0:00:50
263500 -- (-945.862) (-943.372) [-945.798] (-939.850) * (-944.797) (-942.367) [-942.369] (-942.624) -- 0:00:50
264000 -- (-944.141) (-943.625) (-941.363) [-941.325] * [-943.039] (-940.945) (-941.685) (-945.003) -- 0:00:50
264500 -- (-941.985) (-942.661) (-941.625) [-940.982] * [-943.394] (-941.045) (-941.099) (-946.077) -- 0:00:50
265000 -- (-942.792) (-942.992) [-941.932] (-943.064) * [-942.552] (-943.243) (-942.460) (-940.891) -- 0:00:49
Average standard deviation of split frequencies: 0.012093
265500 -- (-944.223) (-944.276) [-942.166] (-942.010) * (-941.492) [-944.665] (-942.647) (-941.988) -- 0:00:49
266000 -- (-942.592) (-941.428) (-941.837) [-941.191] * (-939.961) (-944.364) [-942.085] (-942.914) -- 0:00:49
266500 -- (-942.051) (-942.218) (-941.211) [-944.813] * (-943.130) (-946.465) (-943.214) [-942.856] -- 0:00:49
267000 -- (-942.867) [-942.411] (-940.940) (-946.346) * (-944.398) (-943.261) (-940.657) [-940.432] -- 0:00:49
267500 -- (-940.886) (-940.954) (-946.966) [-943.557] * (-943.341) (-942.510) [-940.355] (-941.110) -- 0:00:49
268000 -- (-945.476) (-941.941) (-942.266) [-944.074] * [-941.521] (-941.296) (-940.857) (-944.931) -- 0:00:49
268500 -- (-942.099) (-944.484) (-942.562) [-940.636] * (-943.161) (-943.832) (-944.010) [-944.721] -- 0:00:49
269000 -- (-943.597) [-941.021] (-941.599) (-941.199) * (-942.658) [-944.220] (-942.362) (-941.586) -- 0:00:48
269500 -- (-941.168) [-947.185] (-942.953) (-941.804) * (-941.826) (-943.191) (-945.016) [-943.527] -- 0:00:51
270000 -- (-941.612) [-942.443] (-944.205) (-942.038) * (-940.526) (-942.764) (-944.022) [-943.876] -- 0:00:51
Average standard deviation of split frequencies: 0.011987
270500 -- (-945.951) [-941.149] (-947.098) (-942.038) * (-942.438) (-940.532) (-944.227) [-941.889] -- 0:00:51
271000 -- (-942.616) (-941.140) (-943.771) [-941.506] * (-943.490) (-940.443) [-941.913] (-943.053) -- 0:00:51
271500 -- [-942.360] (-942.798) (-941.417) (-944.273) * (-943.102) [-944.761] (-942.594) (-942.406) -- 0:00:50
272000 -- (-941.944) [-944.400] (-940.905) (-948.221) * (-942.713) (-942.208) [-943.582] (-943.971) -- 0:00:50
272500 -- (-941.880) [-943.900] (-942.157) (-943.763) * (-941.419) [-943.660] (-940.756) (-941.876) -- 0:00:50
273000 -- (-942.715) [-942.042] (-941.321) (-946.757) * (-942.042) (-944.365) (-940.886) [-942.361] -- 0:00:50
273500 -- (-942.847) (-944.428) [-944.924] (-944.685) * (-943.158) (-946.285) [-942.004] (-941.732) -- 0:00:50
274000 -- (-943.189) (-942.448) [-942.556] (-945.134) * (-945.822) [-942.353] (-942.618) (-945.684) -- 0:00:50
274500 -- (-940.736) (-942.315) [-941.626] (-944.390) * [-942.055] (-945.104) (-942.027) (-941.524) -- 0:00:50
275000 -- (-944.076) (-944.591) [-941.587] (-945.415) * (-942.358) (-941.819) (-942.157) [-941.094] -- 0:00:50
Average standard deviation of split frequencies: 0.012358
275500 -- (-940.611) (-942.496) [-942.200] (-942.675) * [-944.541] (-944.879) (-942.228) (-941.635) -- 0:00:49
276000 -- (-944.135) (-943.028) [-942.431] (-942.167) * [-940.194] (-945.845) (-942.998) (-943.851) -- 0:00:49
276500 -- (-940.903) [-943.026] (-942.618) (-942.570) * (-942.491) (-944.417) (-946.111) [-940.939] -- 0:00:49
277000 -- (-945.044) [-941.750] (-942.456) (-942.913) * (-942.721) [-944.509] (-942.243) (-941.192) -- 0:00:49
277500 -- [-942.537] (-941.928) (-942.822) (-943.416) * (-943.084) (-944.049) (-943.354) [-941.162] -- 0:00:49
278000 -- (-942.549) [-939.994] (-949.262) (-941.999) * [-946.144] (-941.111) (-943.469) (-941.960) -- 0:00:49
278500 -- (-948.172) (-939.991) (-946.961) [-944.620] * (-943.293) (-949.861) (-946.570) [-941.737] -- 0:00:49
279000 -- [-947.785] (-943.871) (-943.904) (-941.696) * (-941.957) (-949.032) [-942.397] (-941.087) -- 0:00:49
279500 -- (-941.323) (-941.937) (-946.299) [-941.158] * (-941.509) (-947.798) (-944.558) [-940.419] -- 0:00:48
280000 -- (-941.044) (-941.356) (-942.079) [-941.260] * (-942.952) (-942.207) [-941.839] (-943.693) -- 0:00:48
Average standard deviation of split frequencies: 0.012251
280500 -- (-942.950) [-940.684] (-941.779) (-942.047) * [-940.951] (-943.257) (-941.610) (-941.954) -- 0:00:48
281000 -- (-943.901) (-944.017) [-940.415] (-942.162) * (-942.044) (-942.848) (-940.782) [-944.144] -- 0:00:48
281500 -- (-941.451) [-943.044] (-942.469) (-941.663) * (-944.544) (-942.529) [-940.899] (-941.860) -- 0:00:48
282000 -- (-943.885) (-943.009) (-941.898) [-941.321] * (-940.406) (-941.652) [-941.561] (-941.548) -- 0:00:48
282500 -- (-941.237) (-940.114) [-940.741] (-942.270) * (-943.325) (-940.744) [-942.395] (-941.983) -- 0:00:48
283000 -- (-943.257) (-941.318) [-944.928] (-947.182) * (-942.116) (-940.941) (-940.855) [-941.912] -- 0:00:48
283500 -- (-941.989) (-944.436) [-943.519] (-942.141) * (-940.797) (-942.016) (-942.735) [-942.366] -- 0:00:48
284000 -- [-941.956] (-941.385) (-946.551) (-943.403) * (-940.173) (-940.922) (-941.507) [-943.414] -- 0:00:47
284500 -- (-941.641) [-940.982] (-945.646) (-941.580) * (-941.669) (-941.438) [-940.337] (-944.351) -- 0:00:47
285000 -- (-941.150) (-942.825) (-943.040) [-941.248] * [-941.443] (-942.302) (-941.060) (-940.384) -- 0:00:47
Average standard deviation of split frequencies: 0.011629
285500 -- (-942.534) (-943.814) [-944.084] (-940.730) * (-941.481) (-945.653) (-941.656) [-939.994] -- 0:00:50
286000 -- (-942.937) [-942.392] (-945.359) (-941.144) * (-943.140) (-950.140) (-943.875) [-940.211] -- 0:00:49
286500 -- (-945.023) (-942.184) [-946.972] (-941.647) * (-941.184) [-945.168] (-951.492) (-940.124) -- 0:00:49
287000 -- (-944.860) (-942.425) (-946.390) [-940.416] * [-941.629] (-944.571) (-943.049) (-947.394) -- 0:00:49
287500 -- [-943.267] (-942.691) (-943.463) (-941.145) * (-941.448) (-941.357) (-941.797) [-941.438] -- 0:00:49
288000 -- (-945.846) (-942.691) [-944.000] (-942.441) * (-941.952) (-941.166) (-944.532) [-942.466] -- 0:00:49
288500 -- (-945.224) (-942.477) [-943.266] (-941.008) * (-942.759) (-943.370) [-943.205] (-942.712) -- 0:00:49
289000 -- (-946.289) (-944.312) [-943.159] (-945.077) * (-941.227) (-944.638) (-943.017) [-942.845] -- 0:00:49
289500 -- (-941.745) (-942.595) [-942.954] (-943.807) * (-943.690) (-942.526) (-945.673) [-940.678] -- 0:00:49
290000 -- (-941.123) (-944.969) (-947.408) [-940.641] * (-945.500) (-941.505) [-940.780] (-942.227) -- 0:00:48
Average standard deviation of split frequencies: 0.011713
290500 -- (-942.956) [-943.665] (-944.885) (-941.766) * (-945.533) [-941.665] (-944.550) (-941.465) -- 0:00:48
291000 -- (-941.306) (-944.893) [-940.171] (-945.122) * (-947.022) (-944.910) [-941.445] (-941.465) -- 0:00:48
291500 -- (-941.499) [-946.244] (-941.676) (-944.523) * (-943.509) [-941.382] (-940.707) (-941.870) -- 0:00:48
292000 -- [-940.458] (-948.231) (-940.956) (-945.415) * (-944.261) [-942.250] (-941.856) (-945.472) -- 0:00:48
292500 -- (-941.309) (-949.852) (-940.302) [-946.564] * (-940.991) [-941.488] (-942.610) (-941.409) -- 0:00:48
293000 -- (-941.268) (-943.092) [-940.403] (-948.107) * (-940.209) (-946.473) [-940.123] (-942.169) -- 0:00:48
293500 -- (-941.771) (-942.497) [-941.779] (-945.895) * (-940.929) [-940.612] (-940.861) (-943.522) -- 0:00:48
294000 -- (-941.015) [-941.060] (-942.414) (-944.184) * [-941.631] (-941.496) (-940.627) (-941.734) -- 0:00:48
294500 -- (-940.885) (-941.880) (-944.778) [-943.313] * (-942.067) (-949.213) [-942.884] (-941.290) -- 0:00:47
295000 -- (-943.695) (-941.233) (-942.057) [-941.349] * (-941.329) (-942.214) [-944.410] (-941.988) -- 0:00:47
Average standard deviation of split frequencies: 0.012179
295500 -- [-943.852] (-946.593) (-942.258) (-940.934) * [-941.277] (-942.083) (-946.569) (-942.262) -- 0:00:47
296000 -- [-943.825] (-944.004) (-944.788) (-941.325) * (-943.750) [-940.556] (-944.059) (-940.652) -- 0:00:47
296500 -- (-944.868) [-943.376] (-944.630) (-943.334) * (-945.391) (-942.533) (-947.563) [-941.885] -- 0:00:47
297000 -- (-944.809) (-944.089) [-946.082] (-941.406) * (-946.542) (-943.135) (-944.167) [-940.995] -- 0:00:47
297500 -- (-944.049) (-941.970) (-944.202) [-943.959] * [-942.365] (-946.504) (-945.241) (-942.120) -- 0:00:47
298000 -- (-945.221) (-948.168) [-943.377] (-945.861) * [-941.070] (-946.350) (-940.998) (-940.911) -- 0:00:47
298500 -- (-943.638) (-941.782) (-942.085) [-944.477] * (-941.029) [-941.126] (-940.838) (-941.332) -- 0:00:47
299000 -- [-942.865] (-941.488) (-941.171) (-940.922) * (-946.570) (-944.469) [-942.208] (-941.858) -- 0:00:46
299500 -- (-941.984) (-942.209) (-942.721) [-941.657] * (-946.570) (-948.221) (-943.074) [-940.963] -- 0:00:46
300000 -- (-945.268) (-945.197) (-942.197) [-941.514] * (-944.629) (-944.407) (-946.222) [-942.486] -- 0:00:46
Average standard deviation of split frequencies: 0.011563
300500 -- [-943.812] (-941.377) (-943.671) (-942.901) * (-940.002) (-944.598) [-941.200] (-941.661) -- 0:00:46
301000 -- (-942.180) (-942.489) (-944.252) [-940.767] * (-942.816) [-943.917] (-946.370) (-942.797) -- 0:00:48
301500 -- (-940.860) (-942.763) (-940.643) [-944.552] * (-941.332) (-942.103) (-946.742) [-943.819] -- 0:00:48
302000 -- (-943.932) [-941.739] (-941.174) (-943.961) * [-943.127] (-945.477) (-944.363) (-941.630) -- 0:00:48
302500 -- (-942.072) (-943.422) (-941.707) [-945.038] * (-944.664) [-942.189] (-941.066) (-942.077) -- 0:00:48
303000 -- (-940.421) (-948.620) (-940.788) [-943.049] * (-944.337) (-947.003) (-940.886) [-942.620] -- 0:00:48
303500 -- (-943.033) [-941.329] (-940.839) (-942.396) * (-943.311) (-943.798) (-944.610) [-941.600] -- 0:00:48
304000 -- [-942.234] (-942.601) (-946.008) (-943.047) * (-946.429) [-941.851] (-947.805) (-942.244) -- 0:00:48
304500 -- [-941.020] (-942.607) (-940.983) (-947.013) * (-943.452) (-941.197) [-941.778] (-941.634) -- 0:00:47
305000 -- (-943.276) [-942.607] (-945.496) (-943.694) * (-944.128) (-942.071) [-942.835] (-942.564) -- 0:00:47
Average standard deviation of split frequencies: 0.010099
305500 -- (-941.552) [-941.078] (-946.009) (-941.351) * (-944.042) [-941.118] (-946.380) (-941.424) -- 0:00:47
306000 -- (-941.456) [-942.421] (-942.479) (-943.019) * (-941.729) (-943.791) [-942.379] (-941.479) -- 0:00:47
306500 -- (-943.503) [-945.940] (-943.110) (-942.239) * (-942.849) (-942.332) [-943.754] (-940.607) -- 0:00:47
307000 -- [-943.191] (-943.882) (-945.412) (-945.044) * (-943.514) (-940.689) (-942.324) [-942.620] -- 0:00:47
307500 -- (-944.853) (-944.536) (-944.379) [-940.714] * (-946.452) (-941.110) (-940.886) [-942.784] -- 0:00:47
308000 -- (-943.459) (-944.957) [-942.610] (-941.391) * (-942.898) [-940.431] (-942.190) (-943.900) -- 0:00:47
308500 -- (-942.579) [-944.957] (-944.976) (-940.471) * [-943.270] (-939.964) (-940.648) (-940.834) -- 0:00:47
309000 -- [-943.031] (-943.105) (-949.909) (-941.129) * (-941.331) (-940.888) (-942.216) [-940.425] -- 0:00:46
309500 -- (-942.092) (-941.448) (-943.816) [-941.992] * (-940.852) [-940.774] (-944.146) (-940.502) -- 0:00:46
310000 -- (-945.410) [-941.177] (-943.378) (-943.716) * (-945.337) [-939.910] (-941.473) (-940.455) -- 0:00:46
Average standard deviation of split frequencies: 0.010032
310500 -- (-945.997) (-941.047) (-942.595) [-941.590] * (-943.291) (-941.075) (-942.948) [-942.376] -- 0:00:46
311000 -- (-943.142) [-940.535] (-940.089) (-941.675) * (-942.646) (-941.892) (-943.751) [-941.244] -- 0:00:46
311500 -- (-944.765) (-940.496) [-940.408] (-941.412) * (-950.007) (-941.146) [-940.312] (-941.079) -- 0:00:46
312000 -- (-942.968) (-940.345) (-940.921) [-940.584] * (-949.127) (-942.957) (-945.908) [-941.141] -- 0:00:46
312500 -- (-943.663) (-940.443) [-940.605] (-941.233) * [-944.867] (-941.712) (-945.756) (-941.984) -- 0:00:46
313000 -- (-944.437) [-941.196] (-940.829) (-940.688) * [-943.912] (-944.460) (-941.799) (-943.348) -- 0:00:46
313500 -- (-942.330) (-946.129) (-941.321) [-942.406] * (-942.497) (-942.678) [-943.385] (-942.795) -- 0:00:45
314000 -- (-941.526) (-944.120) (-942.239) [-941.059] * (-941.748) (-942.817) (-940.639) [-942.340] -- 0:00:45
314500 -- (-940.225) (-946.564) (-942.400) [-941.980] * (-947.115) (-945.421) (-940.233) [-941.506] -- 0:00:45
315000 -- (-943.486) (-943.036) [-942.078] (-941.682) * (-941.228) [-941.817] (-940.706) (-943.461) -- 0:00:45
Average standard deviation of split frequencies: 0.010443
315500 -- [-942.093] (-942.450) (-941.943) (-941.438) * [-944.577] (-950.606) (-942.191) (-944.680) -- 0:00:45
316000 -- (-943.824) [-942.869] (-942.396) (-943.392) * (-941.590) (-944.715) [-940.373] (-945.502) -- 0:00:45
316500 -- (-943.343) (-940.486) [-941.600] (-943.183) * [-942.662] (-940.836) (-941.459) (-942.906) -- 0:00:45
317000 -- (-946.601) (-940.331) [-946.507] (-941.998) * (-942.398) [-940.967] (-942.344) (-944.270) -- 0:00:45
317500 -- (-942.976) [-942.171] (-943.723) (-942.071) * (-940.287) (-942.070) (-945.772) [-943.463] -- 0:00:47
318000 -- (-940.763) (-945.264) (-944.035) [-942.183] * (-940.893) (-941.880) (-943.257) [-942.368] -- 0:00:47
318500 -- (-942.923) [-941.287] (-942.681) (-943.551) * (-942.122) (-945.669) [-940.723] (-941.973) -- 0:00:47
319000 -- (-942.602) [-941.887] (-943.590) (-943.636) * (-942.065) (-943.984) [-940.607] (-943.954) -- 0:00:46
319500 -- (-940.945) [-941.157] (-942.352) (-941.902) * [-943.266] (-943.980) (-943.735) (-940.470) -- 0:00:46
320000 -- (-944.244) [-942.557] (-940.216) (-946.052) * [-943.517] (-942.254) (-941.756) (-943.227) -- 0:00:46
Average standard deviation of split frequencies: 0.009253
320500 -- [-943.914] (-943.467) (-942.445) (-942.226) * (-943.395) (-941.648) [-942.362] (-941.669) -- 0:00:46
321000 -- [-941.287] (-947.295) (-940.630) (-941.153) * (-944.656) [-940.367] (-942.058) (-943.361) -- 0:00:46
321500 -- (-943.267) [-944.117] (-941.039) (-940.955) * (-943.013) (-942.899) [-944.632] (-940.698) -- 0:00:46
322000 -- (-944.397) (-946.419) [-940.829] (-940.668) * (-942.553) (-942.592) (-941.504) [-945.618] -- 0:00:46
322500 -- (-940.190) (-941.745) (-941.008) [-940.523] * (-944.308) [-944.642] (-941.405) (-943.548) -- 0:00:46
323000 -- (-941.857) (-945.282) [-942.492] (-940.156) * (-944.332) [-940.747] (-941.883) (-943.470) -- 0:00:46
323500 -- (-946.820) (-942.458) [-942.720] (-944.087) * (-941.288) (-941.522) [-940.478] (-948.045) -- 0:00:46
324000 -- (-941.312) (-944.675) (-947.784) [-943.023] * (-943.890) (-942.011) (-942.020) [-944.392] -- 0:00:45
324500 -- [-945.889] (-945.488) (-940.969) (-943.805) * (-943.463) (-943.340) (-940.919) [-940.129] -- 0:00:45
325000 -- (-942.794) [-941.037] (-940.779) (-944.258) * (-947.980) (-943.123) [-942.193] (-940.959) -- 0:00:45
Average standard deviation of split frequencies: 0.009187
325500 -- (-943.402) [-941.202] (-940.857) (-941.246) * (-943.948) [-940.476] (-943.641) (-941.489) -- 0:00:45
326000 -- (-949.986) [-941.285] (-940.336) (-940.647) * [-942.770] (-941.393) (-943.268) (-944.779) -- 0:00:45
326500 -- (-941.628) [-940.162] (-943.062) (-941.064) * (-940.821) (-940.619) (-940.329) [-946.062] -- 0:00:45
327000 -- (-943.221) [-943.925] (-947.274) (-940.644) * [-941.584] (-942.517) (-942.571) (-943.974) -- 0:00:45
327500 -- (-941.355) (-942.816) [-941.724] (-942.592) * (-943.473) (-942.152) (-945.723) [-941.572] -- 0:00:45
328000 -- [-941.979] (-942.776) (-941.828) (-943.201) * (-942.851) (-940.349) (-944.444) [-941.562] -- 0:00:45
328500 -- (-942.003) (-943.155) [-942.198] (-941.815) * (-941.076) (-941.250) [-946.469] (-946.410) -- 0:00:44
329000 -- (-942.808) (-946.006) [-940.509] (-942.616) * [-944.368] (-945.547) (-942.502) (-943.708) -- 0:00:44
329500 -- (-943.618) [-940.495] (-946.310) (-942.099) * (-944.932) (-942.127) [-945.011] (-942.036) -- 0:00:44
330000 -- (-943.061) [-941.606] (-940.922) (-947.178) * [-942.297] (-940.754) (-941.286) (-941.382) -- 0:00:44
Average standard deviation of split frequencies: 0.009712
330500 -- [-940.423] (-948.238) (-942.755) (-945.661) * (-943.360) (-942.189) (-940.839) [-942.834] -- 0:00:44
331000 -- (-942.149) (-943.070) [-943.487] (-944.680) * (-942.689) (-941.396) [-941.436] (-943.564) -- 0:00:44
331500 -- [-944.227] (-943.168) (-942.276) (-943.160) * [-944.660] (-944.641) (-941.357) (-947.044) -- 0:00:44
332000 -- (-943.052) (-942.222) (-943.317) [-941.958] * [-942.119] (-943.591) (-943.654) (-942.133) -- 0:00:44
332500 -- (-944.172) (-943.891) [-940.484] (-940.647) * [-944.259] (-942.308) (-940.685) (-942.169) -- 0:00:44
333000 -- [-942.059] (-948.225) (-942.553) (-941.219) * (-941.373) [-941.376] (-941.627) (-946.816) -- 0:00:44
333500 -- [-941.130] (-945.625) (-940.874) (-946.179) * (-941.725) [-943.052] (-942.364) (-944.947) -- 0:00:45
334000 -- (-942.631) (-942.332) (-944.077) [-945.258] * (-942.740) (-940.842) [-943.557] (-941.076) -- 0:00:45
334500 -- [-941.752] (-943.275) (-944.653) (-946.283) * [-943.998] (-945.130) (-942.295) (-942.781) -- 0:00:45
335000 -- (-946.920) (-942.227) (-940.865) [-945.115] * (-945.500) (-942.008) (-941.771) [-941.944] -- 0:00:45
Average standard deviation of split frequencies: 0.009119
335500 -- (-948.151) (-942.046) (-942.023) [-946.329] * (-942.310) (-940.772) [-942.894] (-945.289) -- 0:00:45
336000 -- (-943.815) (-941.729) (-941.947) [-947.854] * (-941.277) [-941.004] (-942.909) (-943.928) -- 0:00:45
336500 -- (-942.613) [-943.299] (-941.525) (-944.957) * (-943.518) (-944.036) [-941.693] (-943.070) -- 0:00:45
337000 -- (-941.302) [-942.390] (-942.727) (-942.765) * [-940.393] (-943.087) (-940.062) (-942.049) -- 0:00:45
337500 -- (-947.813) (-942.601) [-943.617] (-940.955) * (-943.968) (-942.765) (-943.026) [-945.047] -- 0:00:45
338000 -- (-951.323) (-941.963) [-942.613] (-940.641) * (-942.337) (-942.777) (-942.626) [-942.345] -- 0:00:45
338500 -- (-944.110) [-940.837] (-943.992) (-947.122) * (-942.730) [-942.328] (-945.559) (-942.562) -- 0:00:44
339000 -- (-942.129) [-941.221] (-946.225) (-943.399) * (-943.319) [-942.196] (-941.105) (-940.868) -- 0:00:44
339500 -- (-942.878) [-946.548] (-941.291) (-943.696) * (-940.869) (-941.420) [-941.388] (-942.218) -- 0:00:44
340000 -- (-945.133) (-951.070) [-941.296] (-941.692) * (-941.081) (-940.585) (-943.357) [-941.473] -- 0:00:44
Average standard deviation of split frequencies: 0.009427
340500 -- (-941.534) (-944.479) (-942.108) [-941.031] * (-941.665) [-945.786] (-941.404) (-947.779) -- 0:00:44
341000 -- (-944.925) [-943.068] (-940.665) (-943.952) * [-942.371] (-941.876) (-942.285) (-944.323) -- 0:00:44
341500 -- [-943.457] (-944.172) (-942.284) (-944.277) * (-940.420) [-942.664] (-942.434) (-943.157) -- 0:00:44
342000 -- [-942.403] (-944.800) (-944.893) (-944.839) * [-943.474] (-941.870) (-942.721) (-941.197) -- 0:00:44
342500 -- [-943.262] (-943.197) (-942.945) (-950.323) * (-940.139) (-943.082) [-943.169] (-944.634) -- 0:00:44
343000 -- [-940.595] (-943.663) (-943.255) (-946.983) * (-941.512) (-946.329) (-945.608) [-944.023] -- 0:00:44
343500 -- [-942.506] (-942.581) (-943.310) (-941.031) * [-941.028] (-942.627) (-943.126) (-941.471) -- 0:00:43
344000 -- (-942.951) (-947.409) (-942.101) [-942.263] * [-941.032] (-947.266) (-943.388) (-942.354) -- 0:00:43
344500 -- (-941.561) (-943.216) (-943.084) [-942.569] * (-943.560) [-941.731] (-943.442) (-941.844) -- 0:00:43
345000 -- (-943.559) (-940.569) [-942.711] (-942.040) * (-941.682) (-941.455) (-941.970) [-945.083] -- 0:00:43
Average standard deviation of split frequencies: 0.008656
345500 -- [-942.283] (-943.152) (-941.095) (-942.979) * (-944.493) (-941.496) [-944.275] (-941.508) -- 0:00:43
346000 -- (-942.459) (-943.925) [-940.817] (-941.757) * (-942.488) [-940.403] (-941.593) (-942.415) -- 0:00:43
346500 -- (-944.244) (-942.637) [-942.791] (-940.560) * (-944.164) (-942.593) [-940.920] (-943.273) -- 0:00:43
347000 -- [-941.659] (-945.496) (-943.672) (-941.941) * (-943.118) (-946.796) [-942.865] (-940.961) -- 0:00:43
347500 -- (-941.525) (-947.784) (-946.429) [-943.034] * [-942.390] (-945.194) (-941.510) (-941.613) -- 0:00:43
348000 -- (-945.442) (-942.390) (-946.209) [-943.074] * [-943.469] (-942.214) (-940.315) (-941.600) -- 0:00:43
348500 -- [-941.515] (-942.728) (-946.380) (-942.393) * [-942.466] (-941.720) (-942.099) (-940.831) -- 0:00:42
349000 -- (-942.622) (-945.077) (-942.837) [-941.538] * [-942.388] (-943.034) (-942.669) (-941.905) -- 0:00:42
349500 -- (-941.584) (-940.607) [-945.428] (-942.315) * (-944.100) (-941.909) [-941.281] (-942.422) -- 0:00:44
350000 -- (-942.522) [-942.776] (-941.778) (-946.606) * (-942.982) (-943.342) (-942.555) [-942.533] -- 0:00:44
Average standard deviation of split frequencies: 0.009494
350500 -- (-943.700) (-940.092) (-942.460) [-943.274] * (-945.509) [-940.164] (-945.206) (-943.403) -- 0:00:44
351000 -- [-945.891] (-940.820) (-946.821) (-941.386) * (-942.108) (-941.147) (-944.632) [-941.449] -- 0:00:44
351500 -- (-944.422) (-941.786) [-940.771] (-942.661) * (-945.529) (-943.922) (-945.233) [-942.355] -- 0:00:44
352000 -- (-943.153) [-943.588] (-941.035) (-941.741) * (-943.421) (-941.432) [-944.158] (-942.034) -- 0:00:44
352500 -- (-942.759) (-945.812) [-944.111] (-944.404) * [-940.707] (-945.899) (-941.231) (-940.902) -- 0:00:44
353000 -- [-942.228] (-942.602) (-942.252) (-944.045) * (-942.848) (-941.782) [-940.289] (-941.128) -- 0:00:43
353500 -- (-943.061) (-943.084) (-942.224) [-942.981] * [-941.857] (-943.143) (-950.226) (-942.600) -- 0:00:43
354000 -- [-941.503] (-941.174) (-942.164) (-945.478) * (-942.445) (-945.021) [-944.354] (-941.114) -- 0:00:43
354500 -- (-947.796) (-942.000) [-942.965] (-946.817) * (-941.720) (-943.345) [-943.855] (-941.058) -- 0:00:43
355000 -- (-943.426) [-942.505] (-941.595) (-945.191) * (-942.956) (-943.263) [-944.559] (-940.711) -- 0:00:43
Average standard deviation of split frequencies: 0.009186
355500 -- [-942.400] (-943.086) (-940.178) (-944.364) * [-941.612] (-944.567) (-943.873) (-944.181) -- 0:00:43
356000 -- (-944.255) (-943.688) (-942.241) [-941.932] * [-940.967] (-941.589) (-948.157) (-942.162) -- 0:00:43
356500 -- [-941.821] (-944.799) (-943.166) (-945.302) * (-944.668) [-942.616] (-941.183) (-942.550) -- 0:00:43
357000 -- (-942.179) (-946.378) (-946.830) [-940.406] * (-942.379) (-944.797) (-944.323) [-942.870] -- 0:00:43
357500 -- (-941.810) [-945.669] (-949.169) (-943.547) * (-942.790) (-941.387) [-946.204] (-941.130) -- 0:00:43
358000 -- (-942.610) (-940.723) [-943.561] (-941.714) * (-940.620) (-941.148) [-941.155] (-945.563) -- 0:00:43
358500 -- (-943.508) [-944.424] (-940.967) (-944.153) * (-940.668) [-942.198] (-943.580) (-941.696) -- 0:00:42
359000 -- (-942.273) (-941.958) [-940.476] (-942.143) * (-943.381) (-940.790) (-943.226) [-945.486] -- 0:00:42
359500 -- (-943.978) (-942.431) [-940.964] (-942.909) * (-942.750) (-944.822) [-943.117] (-942.669) -- 0:00:42
360000 -- (-944.514) (-943.851) [-940.900] (-944.694) * (-942.903) (-942.967) (-942.486) [-943.228] -- 0:00:42
Average standard deviation of split frequencies: 0.008801
360500 -- (-946.591) (-944.379) [-940.516] (-942.744) * (-942.007) (-944.039) (-942.354) [-943.143] -- 0:00:42
361000 -- [-942.703] (-944.700) (-940.598) (-940.810) * (-945.691) (-945.204) [-942.793] (-943.210) -- 0:00:42
361500 -- [-944.653] (-945.044) (-941.771) (-941.570) * [-943.757] (-947.096) (-943.946) (-941.349) -- 0:00:42
362000 -- (-945.687) (-941.401) (-941.818) [-945.724] * (-943.755) [-941.367] (-942.382) (-944.483) -- 0:00:42
362500 -- (-943.271) (-941.612) (-942.552) [-942.792] * [-942.041] (-942.515) (-943.584) (-941.494) -- 0:00:42
363000 -- (-941.770) [-944.822] (-942.883) (-941.049) * [-942.332] (-943.802) (-940.333) (-946.885) -- 0:00:42
363500 -- [-941.799] (-945.067) (-943.311) (-941.267) * (-942.950) [-943.201] (-940.674) (-942.062) -- 0:00:42
364000 -- (-943.526) (-942.411) [-944.475] (-941.154) * [-942.563] (-944.002) (-943.946) (-942.194) -- 0:00:41
364500 -- (-940.360) (-943.183) [-941.485] (-941.634) * (-943.582) (-943.554) (-942.448) [-942.822] -- 0:00:41
365000 -- (-942.828) [-940.384] (-942.913) (-945.363) * (-943.700) (-943.481) (-941.636) [-942.237] -- 0:00:41
Average standard deviation of split frequencies: 0.008211
365500 -- [-942.886] (-942.159) (-941.857) (-941.675) * [-940.709] (-942.733) (-945.457) (-941.504) -- 0:00:43
366000 -- (-940.677) [-940.664] (-941.690) (-942.961) * [-941.742] (-947.579) (-942.550) (-941.423) -- 0:00:43
366500 -- (-947.044) (-943.903) (-941.355) [-940.620] * (-940.764) [-942.981] (-941.583) (-943.400) -- 0:00:43
367000 -- (-944.154) [-941.649] (-941.796) (-941.639) * [-941.032] (-941.975) (-940.610) (-941.571) -- 0:00:43
367500 -- [-941.667] (-946.297) (-943.531) (-940.644) * [-943.872] (-940.200) (-940.390) (-942.438) -- 0:00:43
368000 -- (-942.128) [-942.693] (-944.057) (-942.582) * (-942.695) (-942.437) [-940.602] (-941.322) -- 0:00:42
368500 -- (-941.829) (-942.262) (-941.767) [-943.510] * (-942.447) [-942.248] (-940.602) (-942.360) -- 0:00:42
369000 -- [-941.784] (-943.161) (-945.612) (-944.649) * (-941.852) [-942.185] (-942.543) (-944.535) -- 0:00:42
369500 -- (-941.705) (-940.749) (-941.550) [-940.960] * [-940.767] (-943.306) (-941.853) (-941.606) -- 0:00:42
370000 -- (-944.867) [-941.295] (-941.226) (-941.255) * (-941.325) [-941.680] (-943.604) (-944.146) -- 0:00:42
Average standard deviation of split frequencies: 0.008028
370500 -- (-942.894) (-944.931) (-942.064) [-943.223] * (-943.094) [-940.951] (-943.732) (-944.178) -- 0:00:42
371000 -- (-943.704) [-943.775] (-942.522) (-946.867) * (-945.125) (-941.132) [-941.568] (-943.781) -- 0:00:42
371500 -- (-942.805) (-943.194) (-943.881) [-941.976] * (-941.403) [-942.866] (-943.175) (-942.942) -- 0:00:42
372000 -- [-944.042] (-940.930) (-941.349) (-942.145) * (-947.918) [-942.533] (-944.478) (-943.846) -- 0:00:42
372500 -- (-941.585) (-942.019) [-941.405] (-942.355) * (-941.128) [-940.356] (-943.201) (-942.044) -- 0:00:42
373000 -- (-941.554) (-943.228) [-940.338] (-943.800) * [-941.028] (-942.032) (-940.989) (-943.118) -- 0:00:42
373500 -- (-945.471) [-940.778] (-940.390) (-942.134) * (-941.597) (-943.580) [-941.348] (-943.983) -- 0:00:41
374000 -- (-942.939) (-942.812) (-946.672) [-943.769] * (-943.928) [-942.114] (-942.650) (-948.997) -- 0:00:41
374500 -- (-945.228) [-943.779] (-942.130) (-943.769) * (-943.047) [-942.860] (-944.642) (-941.227) -- 0:00:41
375000 -- (-941.055) [-943.190] (-941.506) (-942.115) * (-942.502) [-945.240] (-944.729) (-940.849) -- 0:00:41
Average standard deviation of split frequencies: 0.008463
375500 -- (-946.754) [-943.424] (-942.523) (-943.919) * (-941.482) (-941.555) (-941.510) [-942.480] -- 0:00:41
376000 -- (-944.561) (-943.740) (-940.384) [-943.361] * (-941.837) (-941.606) (-942.495) [-940.339] -- 0:00:41
376500 -- [-943.676] (-940.889) (-941.113) (-946.649) * (-942.310) [-942.433] (-943.960) (-941.677) -- 0:00:41
377000 -- [-943.478] (-942.961) (-941.083) (-943.381) * (-944.292) [-942.434] (-945.811) (-941.744) -- 0:00:41
377500 -- (-940.951) (-941.941) [-943.263] (-942.237) * (-947.455) [-942.450] (-945.016) (-942.570) -- 0:00:41
378000 -- (-939.983) (-943.152) (-944.876) [-941.091] * [-939.925] (-944.753) (-944.675) (-942.363) -- 0:00:41
378500 -- (-939.983) (-942.744) (-945.021) [-944.616] * [-940.985] (-943.216) (-945.331) (-941.965) -- 0:00:41
379000 -- (-940.334) [-943.310] (-941.312) (-944.730) * (-941.871) (-942.177) (-941.724) [-940.832] -- 0:00:40
379500 -- (-940.352) (-943.408) (-940.741) [-940.082] * [-941.503] (-946.973) (-944.232) (-940.377) -- 0:00:40
380000 -- (-939.864) [-940.893] (-940.839) (-941.818) * (-942.929) (-944.449) (-944.384) [-942.449] -- 0:00:40
Average standard deviation of split frequencies: 0.007066
380500 -- (-940.781) (-940.367) [-943.746] (-942.933) * [-940.994] (-943.021) (-945.380) (-945.592) -- 0:00:40
381000 -- (-940.455) [-944.043] (-943.864) (-941.981) * (-942.030) (-942.549) [-940.924] (-944.676) -- 0:00:40
381500 -- (-942.805) (-944.609) (-943.270) [-940.791] * [-943.423] (-942.852) (-940.161) (-945.325) -- 0:00:42
382000 -- (-945.625) (-943.533) [-942.178] (-941.031) * (-944.202) [-942.957] (-940.568) (-941.457) -- 0:00:42
382500 -- (-943.751) [-941.562] (-940.334) (-941.152) * [-943.370] (-942.797) (-940.785) (-941.840) -- 0:00:41
383000 -- [-942.677] (-943.435) (-943.352) (-942.759) * (-943.705) (-942.031) (-940.785) [-942.112] -- 0:00:41
383500 -- (-940.339) [-943.466] (-941.733) (-940.654) * (-945.030) [-945.561] (-941.918) (-942.456) -- 0:00:41
384000 -- (-942.420) [-940.637] (-941.530) (-942.060) * (-942.999) (-941.703) (-942.001) [-943.146] -- 0:00:41
384500 -- (-943.024) (-942.675) [-942.098] (-941.747) * (-940.698) (-940.516) [-940.935] (-941.239) -- 0:00:41
385000 -- (-943.210) (-944.984) [-941.120] (-941.555) * [-942.089] (-942.877) (-942.940) (-946.291) -- 0:00:41
Average standard deviation of split frequencies: 0.006753
385500 -- (-941.716) (-941.676) [-941.534] (-942.119) * (-942.217) (-942.084) (-941.612) [-942.777] -- 0:00:41
386000 -- (-944.329) [-942.614] (-941.089) (-942.106) * (-942.717) (-943.162) [-941.182] (-944.639) -- 0:00:41
386500 -- (-943.813) (-944.090) [-941.143] (-942.603) * (-941.756) [-940.967] (-941.944) (-942.116) -- 0:00:41
387000 -- (-942.434) (-943.333) [-941.731] (-941.604) * [-944.721] (-941.424) (-942.257) (-942.580) -- 0:00:41
387500 -- (-942.142) [-943.071] (-941.497) (-942.989) * (-944.933) [-942.991] (-942.400) (-942.918) -- 0:00:41
388000 -- (-944.713) [-940.230] (-941.003) (-940.612) * (-942.725) (-941.023) [-943.123] (-942.535) -- 0:00:41
388500 -- (-950.210) (-940.532) [-942.016] (-943.851) * (-949.342) (-942.250) (-942.415) [-944.556] -- 0:00:40
389000 -- [-948.058] (-941.189) (-942.273) (-942.244) * (-941.382) (-941.871) [-941.856] (-943.665) -- 0:00:40
389500 -- (-941.948) (-941.189) [-945.521] (-943.045) * (-942.163) (-942.409) [-947.735] (-947.844) -- 0:00:40
390000 -- (-941.201) [-940.618] (-942.364) (-942.504) * [-945.993] (-940.929) (-942.430) (-941.725) -- 0:00:40
Average standard deviation of split frequencies: 0.006672
390500 -- [-942.078] (-941.682) (-941.708) (-941.253) * (-942.654) (-943.234) (-946.005) [-941.228] -- 0:00:40
391000 -- (-943.090) [-944.823] (-943.179) (-942.569) * (-941.035) (-944.805) (-940.866) [-940.845] -- 0:00:40
391500 -- [-941.174] (-945.839) (-942.344) (-943.653) * [-941.706] (-942.228) (-941.910) (-943.965) -- 0:00:40
392000 -- (-943.657) (-940.837) [-945.553] (-942.918) * (-941.922) (-941.045) (-941.651) [-942.044] -- 0:00:40
392500 -- (-941.218) [-940.671] (-941.111) (-941.651) * (-943.995) (-942.567) [-943.557] (-943.210) -- 0:00:40
393000 -- (-941.288) [-941.422] (-940.826) (-941.669) * (-942.051) (-946.793) (-943.835) [-940.380] -- 0:00:40
393500 -- (-941.862) [-942.469] (-943.697) (-941.535) * (-943.238) [-940.672] (-940.897) (-940.368) -- 0:00:40
394000 -- [-940.333] (-946.885) (-945.610) (-941.810) * (-942.550) [-940.574] (-945.881) (-940.691) -- 0:00:39
394500 -- [-941.102] (-943.950) (-945.612) (-942.386) * (-941.190) (-942.100) [-943.729] (-942.596) -- 0:00:39
395000 -- (-940.950) [-942.005] (-940.971) (-941.118) * (-941.215) (-942.097) [-942.820] (-940.697) -- 0:00:39
Average standard deviation of split frequencies: 0.007703
395500 -- [-940.533] (-940.922) (-940.283) (-941.248) * (-940.693) (-945.922) [-940.506] (-943.204) -- 0:00:39
396000 -- [-942.606] (-940.231) (-944.626) (-944.002) * (-945.227) (-945.985) [-943.053] (-946.937) -- 0:00:39
396500 -- (-943.624) (-944.152) [-942.844] (-942.768) * (-942.598) (-944.902) [-943.369] (-944.561) -- 0:00:39
397000 -- (-943.172) (-941.630) (-940.683) [-941.791] * (-944.779) (-948.515) (-942.597) [-944.285] -- 0:00:39
397500 -- (-943.476) (-942.704) (-940.674) [-941.730] * (-942.676) [-943.992] (-946.502) (-944.170) -- 0:00:40
398000 -- (-941.041) (-941.438) (-940.521) [-941.168] * (-942.650) (-942.906) [-943.058] (-944.848) -- 0:00:40
398500 -- (-941.517) [-940.598] (-943.352) (-941.640) * (-943.531) (-942.362) [-942.012] (-945.155) -- 0:00:40
399000 -- (-944.928) (-941.940) (-941.833) [-943.062] * (-941.063) [-943.061] (-945.606) (-946.913) -- 0:00:40
399500 -- (-944.728) [-943.203] (-942.567) (-940.981) * [-940.892] (-943.559) (-944.277) (-945.633) -- 0:00:40
400000 -- [-944.119] (-942.694) (-942.881) (-940.596) * (-942.460) (-943.350) (-947.638) [-940.406] -- 0:00:40
Average standard deviation of split frequencies: 0.007280
400500 -- (-943.402) (-941.922) [-943.187] (-943.136) * [-941.891] (-946.036) (-947.889) (-942.037) -- 0:00:40
401000 -- (-941.069) (-941.433) (-943.689) [-942.034] * (-941.908) (-941.555) (-951.928) [-944.940] -- 0:00:40
401500 -- (-942.601) [-942.066] (-943.475) (-941.138) * [-942.135] (-948.593) (-948.363) (-943.293) -- 0:00:40
402000 -- (-942.394) (-941.562) (-943.060) [-944.162] * (-945.871) (-941.525) (-942.521) [-942.617] -- 0:00:40
402500 -- (-941.519) (-943.308) [-942.306] (-946.725) * (-940.838) (-941.835) (-941.037) [-943.660] -- 0:00:40
403000 -- (-943.136) (-943.915) [-942.976] (-942.387) * (-941.926) (-942.973) [-941.460] (-942.801) -- 0:00:39
403500 -- [-942.324] (-945.730) (-947.135) (-942.701) * [-943.439] (-946.015) (-941.672) (-941.321) -- 0:00:39
404000 -- [-940.384] (-942.192) (-943.861) (-952.607) * [-944.940] (-942.213) (-942.784) (-940.696) -- 0:00:39
404500 -- [-940.428] (-941.886) (-942.579) (-942.835) * [-942.715] (-942.232) (-941.931) (-941.179) -- 0:00:39
405000 -- [-941.152] (-943.236) (-940.686) (-940.636) * (-947.703) (-943.365) [-941.298] (-941.214) -- 0:00:39
Average standard deviation of split frequencies: 0.007620
405500 -- (-944.417) [-947.986] (-944.084) (-941.608) * (-942.269) (-941.763) [-943.508] (-945.416) -- 0:00:39
406000 -- (-944.001) (-942.348) (-943.409) [-942.171] * [-941.565] (-942.623) (-940.648) (-948.324) -- 0:00:39
406500 -- [-941.117] (-942.102) (-942.959) (-945.513) * (-941.626) (-946.337) [-940.448] (-946.606) -- 0:00:39
407000 -- [-940.619] (-941.766) (-944.683) (-943.540) * (-943.622) (-940.836) [-940.473] (-942.314) -- 0:00:39
407500 -- (-945.058) [-941.562] (-941.920) (-943.485) * (-943.432) (-942.670) [-943.550] (-942.357) -- 0:00:39
408000 -- (-940.326) [-943.429] (-943.031) (-944.418) * (-940.780) (-941.257) (-944.042) [-942.053] -- 0:00:39
408500 -- (-941.447) (-940.679) [-941.334] (-942.496) * (-940.875) (-944.322) [-942.525] (-941.594) -- 0:00:39
409000 -- (-943.202) (-945.124) [-943.199] (-945.140) * (-944.046) (-939.936) (-944.610) [-941.155] -- 0:00:39
409500 -- (-944.031) [-941.075] (-942.865) (-945.192) * (-941.669) [-940.804] (-942.510) (-940.703) -- 0:00:38
410000 -- [-942.465] (-941.091) (-941.043) (-942.985) * (-943.912) [-940.730] (-940.429) (-941.368) -- 0:00:38
Average standard deviation of split frequencies: 0.007605
410500 -- [-940.549] (-941.748) (-942.317) (-940.631) * (-942.884) (-943.277) [-940.682] (-946.801) -- 0:00:38
411000 -- (-944.870) [-942.785] (-943.170) (-942.531) * (-940.528) [-945.173] (-940.413) (-944.399) -- 0:00:38
411500 -- (-941.676) (-942.859) [-942.231] (-942.123) * (-942.086) (-943.363) (-946.059) [-943.603] -- 0:00:38
412000 -- (-944.643) (-942.309) (-940.496) [-940.239] * [-941.370] (-945.193) (-944.669) (-941.021) -- 0:00:38
412500 -- (-943.398) (-942.663) (-941.888) [-944.020] * (-944.296) (-944.504) [-943.558] (-940.839) -- 0:00:38
413000 -- [-944.423] (-943.837) (-942.159) (-942.563) * (-942.208) (-945.016) [-941.451] (-945.298) -- 0:00:39
413500 -- [-942.092] (-943.149) (-941.629) (-944.461) * (-942.973) [-941.329] (-942.854) (-942.005) -- 0:00:39
414000 -- [-943.531] (-941.858) (-941.928) (-941.470) * (-941.595) (-943.359) (-943.247) [-946.778] -- 0:00:39
414500 -- (-943.793) (-945.229) (-941.036) [-944.346] * [-942.660] (-945.432) (-944.144) (-946.417) -- 0:00:39
415000 -- (-946.403) (-943.486) (-940.789) [-942.088] * (-941.540) (-940.733) (-943.474) [-946.807] -- 0:00:39
Average standard deviation of split frequencies: 0.007666
415500 -- [-944.203] (-943.305) (-940.255) (-942.068) * (-941.542) (-940.788) [-944.328] (-947.710) -- 0:00:39
416000 -- (-943.057) (-941.960) [-941.716] (-946.537) * (-941.158) [-943.982] (-943.568) (-947.634) -- 0:00:39
416500 -- (-942.184) [-940.849] (-942.562) (-944.997) * (-944.043) [-941.088] (-941.361) (-943.105) -- 0:00:39
417000 -- (-944.568) [-942.861] (-941.001) (-943.597) * [-941.140] (-946.616) (-942.688) (-941.408) -- 0:00:39
417500 -- (-943.325) (-944.852) (-943.156) [-941.915] * (-943.398) [-945.392] (-944.168) (-941.164) -- 0:00:39
418000 -- [-943.286] (-949.591) (-942.519) (-945.799) * (-945.057) [-943.086] (-941.995) (-943.712) -- 0:00:38
418500 -- (-940.902) [-941.199] (-941.318) (-942.704) * [-942.272] (-944.231) (-941.396) (-943.168) -- 0:00:38
419000 -- (-943.291) [-944.684] (-940.975) (-940.984) * [-942.328] (-944.176) (-942.597) (-940.705) -- 0:00:38
419500 -- (-942.128) (-942.868) (-947.574) [-940.897] * [-941.956] (-943.489) (-942.291) (-942.530) -- 0:00:38
420000 -- [-945.512] (-945.282) (-941.049) (-941.179) * (-943.404) (-944.299) (-946.650) [-942.132] -- 0:00:38
Average standard deviation of split frequencies: 0.007251
420500 -- (-942.671) (-941.431) [-942.606] (-943.455) * (-941.700) (-941.863) (-943.918) [-941.962] -- 0:00:38
421000 -- (-941.445) [-943.671] (-942.687) (-945.023) * [-940.968] (-943.406) (-942.485) (-942.649) -- 0:00:38
421500 -- [-940.446] (-940.771) (-940.639) (-941.905) * [-942.827] (-940.953) (-943.773) (-942.641) -- 0:00:38
422000 -- (-942.069) [-941.707] (-940.581) (-941.934) * [-943.719] (-943.340) (-945.927) (-947.880) -- 0:00:38
422500 -- (-941.366) (-942.754) (-940.964) [-942.733] * (-943.707) [-941.586] (-942.351) (-942.386) -- 0:00:38
423000 -- (-941.343) (-941.081) [-941.634] (-943.977) * [-942.205] (-942.248) (-941.027) (-941.503) -- 0:00:38
423500 -- [-941.099] (-944.353) (-941.342) (-946.974) * [-944.763] (-941.257) (-943.672) (-943.239) -- 0:00:38
424000 -- (-941.099) (-943.525) (-941.223) [-944.607] * (-941.164) (-940.538) [-940.512] (-943.024) -- 0:00:38
424500 -- (-941.145) [-942.653] (-941.337) (-942.213) * (-943.173) (-940.612) [-943.360] (-941.420) -- 0:00:37
425000 -- [-941.912] (-942.081) (-942.172) (-940.828) * (-943.088) (-940.609) (-941.854) [-943.087] -- 0:00:37
Average standard deviation of split frequencies: 0.006965
425500 -- (-941.065) (-942.450) (-942.428) [-940.965] * (-946.036) [-940.962] (-946.204) (-941.972) -- 0:00:37
426000 -- (-941.026) (-942.939) (-941.702) [-941.447] * (-944.070) (-940.493) [-940.666] (-940.606) -- 0:00:37
426500 -- [-941.006] (-942.635) (-944.563) (-942.274) * (-943.914) [-940.036] (-942.863) (-940.956) -- 0:00:37
427000 -- [-942.457] (-941.227) (-940.507) (-943.343) * (-944.506) (-940.925) [-941.044] (-940.704) -- 0:00:37
427500 -- (-944.114) [-940.777] (-940.238) (-945.810) * (-941.760) [-941.264] (-941.130) (-943.348) -- 0:00:37
428000 -- (-942.564) [-940.852] (-944.707) (-941.310) * [-941.989] (-940.506) (-941.300) (-947.181) -- 0:00:37
428500 -- (-943.963) (-942.659) (-941.419) [-940.892] * (-944.188) (-940.741) [-944.049] (-940.474) -- 0:00:37
429000 -- (-945.514) (-945.295) [-941.208] (-943.808) * (-942.060) (-940.711) [-940.904] (-942.364) -- 0:00:37
429500 -- (-942.837) [-942.918] (-942.306) (-943.250) * [-942.530] (-940.209) (-942.322) (-942.144) -- 0:00:38
430000 -- (-944.603) [-943.481] (-941.690) (-943.691) * (-942.495) [-941.050] (-942.071) (-946.440) -- 0:00:38
Average standard deviation of split frequencies: 0.007340
430500 -- (-943.257) [-941.535] (-946.179) (-943.351) * (-942.430) [-941.640] (-941.556) (-944.866) -- 0:00:38
431000 -- (-943.809) (-942.277) [-943.792] (-946.639) * [-941.161] (-942.733) (-940.596) (-942.248) -- 0:00:38
431500 -- (-944.762) [-943.701] (-942.868) (-941.134) * (-943.838) [-942.126] (-942.615) (-941.912) -- 0:00:38
432000 -- (-942.178) (-945.868) [-943.674] (-943.674) * (-943.975) (-942.635) (-942.739) [-942.038] -- 0:00:38
432500 -- (-943.987) (-940.970) [-944.349] (-943.290) * (-941.225) (-942.564) [-944.213] (-943.125) -- 0:00:38
433000 -- (-943.529) (-942.265) [-942.446] (-948.392) * [-941.385] (-941.963) (-942.591) (-944.529) -- 0:00:37
433500 -- (-942.587) [-944.353] (-941.622) (-941.921) * (-940.939) (-941.329) (-946.486) [-942.731] -- 0:00:37
434000 -- [-942.580] (-946.911) (-942.018) (-941.136) * (-941.070) (-942.894) [-940.280] (-941.102) -- 0:00:37
434500 -- (-942.348) [-941.230] (-941.323) (-942.189) * (-940.167) (-941.290) (-940.299) [-941.221] -- 0:00:37
435000 -- [-941.290] (-943.606) (-941.235) (-942.441) * [-941.275] (-942.704) (-940.118) (-943.958) -- 0:00:37
Average standard deviation of split frequencies: 0.006893
435500 -- (-940.563) (-942.766) [-945.550] (-940.676) * [-943.103] (-942.264) (-943.488) (-943.160) -- 0:00:37
436000 -- [-941.522] (-943.039) (-945.097) (-940.497) * (-946.104) [-941.310] (-943.430) (-944.287) -- 0:00:37
436500 -- [-942.515] (-952.528) (-946.832) (-940.314) * (-942.738) (-944.522) (-940.730) [-942.731] -- 0:00:37
437000 -- (-941.029) [-941.183] (-941.229) (-940.928) * (-944.852) (-942.278) [-942.284] (-944.022) -- 0:00:37
437500 -- (-943.899) (-940.375) (-940.720) [-940.909] * (-945.221) [-944.587] (-943.072) (-941.161) -- 0:00:37
438000 -- (-942.748) [-943.835] (-941.966) (-943.280) * [-943.326] (-941.255) (-947.068) (-941.025) -- 0:00:37
438500 -- (-945.082) (-942.420) [-942.276] (-943.266) * (-945.869) (-940.480) (-941.357) [-940.361] -- 0:00:37
439000 -- [-942.374] (-941.640) (-945.910) (-941.323) * (-941.795) [-940.829] (-940.811) (-940.966) -- 0:00:37
439500 -- [-941.302] (-941.110) (-946.173) (-941.591) * [-940.532] (-940.061) (-943.866) (-943.133) -- 0:00:36
440000 -- (-941.365) [-941.749] (-944.244) (-941.510) * (-940.845) [-941.505] (-940.898) (-940.428) -- 0:00:36
Average standard deviation of split frequencies: 0.007087
440500 -- [-943.648] (-942.042) (-941.360) (-940.155) * (-941.790) [-940.544] (-943.840) (-940.257) -- 0:00:36
441000 -- (-941.594) (-943.231) (-942.623) [-940.160] * (-941.381) [-940.519] (-941.792) (-941.039) -- 0:00:36
441500 -- (-941.083) [-942.704] (-941.842) (-944.793) * [-943.649] (-943.788) (-941.119) (-940.803) -- 0:00:36
442000 -- (-941.642) (-942.142) [-941.807] (-942.956) * [-941.748] (-941.265) (-940.956) (-940.437) -- 0:00:36
442500 -- (-941.833) (-941.594) (-941.712) [-946.346] * (-942.987) (-942.182) (-943.414) [-943.389] -- 0:00:36
443000 -- (-940.134) (-945.154) (-945.474) [-945.076] * (-941.791) (-942.152) (-943.490) [-942.402] -- 0:00:36
443500 -- (-941.368) [-940.619] (-943.480) (-945.076) * (-944.175) (-940.699) (-941.818) [-941.621] -- 0:00:36
444000 -- (-941.531) (-941.393) (-943.408) [-943.258] * (-943.106) [-940.346] (-940.759) (-946.004) -- 0:00:36
444500 -- (-941.814) [-942.179] (-947.513) (-941.916) * (-943.540) [-942.159] (-942.637) (-943.682) -- 0:00:36
445000 -- (-944.530) [-943.915] (-941.820) (-940.997) * (-944.561) (-943.007) [-942.442] (-943.263) -- 0:00:36
Average standard deviation of split frequencies: 0.007465
445500 -- (-943.900) (-943.219) (-942.323) [-942.028] * (-940.809) (-942.890) [-941.440] (-941.226) -- 0:00:37
446000 -- (-943.904) [-941.883] (-941.298) (-942.719) * (-941.435) (-941.034) [-940.440] (-941.863) -- 0:00:37
446500 -- (-941.503) [-941.675] (-940.831) (-941.814) * (-942.931) (-942.520) [-940.275] (-942.943) -- 0:00:37
447000 -- (-941.847) (-943.639) [-941.211] (-940.879) * (-942.449) (-942.148) [-942.504] (-941.793) -- 0:00:37
447500 -- (-942.479) (-942.651) [-941.213] (-940.995) * (-944.290) (-942.062) [-942.028] (-940.449) -- 0:00:37
448000 -- (-941.677) (-941.694) [-945.735] (-941.568) * (-940.106) [-942.242] (-941.369) (-944.775) -- 0:00:36
448500 -- (-940.415) [-941.580] (-942.013) (-941.303) * [-940.636] (-943.154) (-940.604) (-941.831) -- 0:00:36
449000 -- (-944.870) [-941.411] (-942.031) (-943.820) * [-940.565] (-940.704) (-940.770) (-941.086) -- 0:00:36
449500 -- [-942.919] (-941.568) (-942.319) (-941.495) * (-940.394) (-941.770) (-942.267) [-941.014] -- 0:00:36
450000 -- [-944.775] (-944.578) (-942.494) (-942.281) * (-940.378) (-942.494) (-941.912) [-943.389] -- 0:00:36
Average standard deviation of split frequencies: 0.006768
450500 -- (-942.729) (-943.576) (-947.313) [-941.616] * [-942.027] (-945.663) (-944.705) (-942.195) -- 0:00:36
451000 -- (-941.556) (-942.274) (-946.695) [-941.840] * [-946.494] (-941.078) (-943.733) (-941.710) -- 0:00:36
451500 -- (-941.061) (-942.513) (-941.482) [-942.112] * (-943.174) (-940.349) [-942.629] (-943.589) -- 0:00:36
452000 -- (-941.432) (-940.985) (-942.752) [-945.279] * (-942.353) [-943.916] (-941.451) (-941.007) -- 0:00:36
452500 -- (-943.361) (-941.412) [-943.894] (-941.731) * (-940.870) (-943.286) [-941.904] (-943.940) -- 0:00:36
453000 -- (-947.625) (-941.503) (-940.391) [-942.261] * (-941.096) (-943.624) (-940.942) [-949.809] -- 0:00:36
453500 -- [-941.000] (-942.330) (-941.037) (-942.592) * (-945.439) [-941.655] (-941.142) (-941.021) -- 0:00:36
454000 -- (-944.804) (-944.102) [-943.957] (-942.798) * (-946.998) (-943.023) (-943.002) [-943.119] -- 0:00:36
454500 -- (-944.643) [-941.602] (-948.104) (-942.843) * (-941.533) (-946.011) [-943.058] (-945.158) -- 0:00:36
455000 -- [-941.596] (-942.501) (-940.874) (-943.315) * [-941.816] (-946.126) (-942.265) (-945.928) -- 0:00:35
Average standard deviation of split frequencies: 0.006138
455500 -- (-940.385) (-943.623) (-941.657) [-943.774] * (-940.270) [-945.308] (-942.504) (-944.256) -- 0:00:35
456000 -- (-942.050) (-944.128) [-942.739] (-943.111) * (-941.287) (-944.431) [-942.281] (-942.447) -- 0:00:35
456500 -- (-949.477) [-943.964] (-941.572) (-942.169) * (-942.422) [-944.784] (-943.930) (-940.809) -- 0:00:35
457000 -- (-942.602) [-944.708] (-941.503) (-944.625) * (-941.877) (-942.717) (-940.775) [-940.167] -- 0:00:35
457500 -- (-941.821) (-941.213) (-945.018) [-944.645] * (-943.449) (-942.236) [-940.855] (-939.908) -- 0:00:35
458000 -- [-941.207] (-940.817) (-941.994) (-942.121) * (-947.710) (-943.303) (-944.016) [-940.802] -- 0:00:35
458500 -- (-945.093) (-940.588) (-941.900) [-940.333] * (-950.464) (-944.653) (-941.762) [-942.530] -- 0:00:35
459000 -- (-943.463) (-941.481) [-940.173] (-940.609) * (-941.802) (-941.989) (-945.509) [-941.373] -- 0:00:35
459500 -- [-941.865] (-942.618) (-944.055) (-948.086) * (-941.228) (-942.660) (-946.307) [-942.528] -- 0:00:35
460000 -- (-941.129) (-942.093) [-943.636] (-941.587) * (-941.088) (-942.524) [-943.099] (-939.986) -- 0:00:35
Average standard deviation of split frequencies: 0.006652
460500 -- (-940.488) [-942.284] (-942.288) (-943.424) * (-940.694) (-943.184) [-940.156] (-941.663) -- 0:00:35
461000 -- [-940.836] (-943.916) (-946.027) (-943.232) * (-941.694) (-950.192) (-941.510) [-941.207] -- 0:00:35
461500 -- (-943.893) [-940.674] (-946.133) (-942.731) * [-942.811] (-942.480) (-940.984) (-942.263) -- 0:00:36
462000 -- (-940.446) (-940.347) [-941.823] (-943.973) * (-943.987) (-942.132) [-944.451] (-942.314) -- 0:00:36
462500 -- (-943.987) (-940.483) (-943.614) [-942.346] * (-942.187) (-943.856) (-942.389) [-941.516] -- 0:00:36
463000 -- (-943.659) (-943.552) [-941.199] (-941.906) * [-943.111] (-942.775) (-941.225) (-947.737) -- 0:00:35
463500 -- [-941.904] (-943.138) (-941.562) (-941.747) * (-942.327) (-942.613) [-941.372] (-944.098) -- 0:00:35
464000 -- (-941.444) (-948.166) [-943.652] (-945.965) * (-940.694) [-940.913] (-942.905) (-941.721) -- 0:00:35
464500 -- (-941.101) [-941.302] (-939.958) (-944.614) * (-941.079) (-947.273) [-940.777] (-945.559) -- 0:00:35
465000 -- (-941.250) (-941.564) (-944.110) [-942.081] * (-942.508) (-944.392) (-941.861) [-941.127] -- 0:00:35
Average standard deviation of split frequencies: 0.006512
465500 -- (-940.199) (-940.933) (-940.238) [-942.058] * (-942.261) (-944.241) [-941.916] (-944.803) -- 0:00:35
466000 -- (-940.975) (-941.654) (-942.811) [-942.201] * (-944.823) (-942.829) (-941.431) [-941.978] -- 0:00:35
466500 -- (-940.462) [-941.650] (-942.299) (-944.489) * (-942.809) (-941.589) (-941.531) [-942.468] -- 0:00:35
467000 -- (-943.758) (-944.693) [-941.250] (-942.964) * (-943.421) (-940.355) [-944.807] (-940.774) -- 0:00:35
467500 -- (-941.928) (-947.985) [-943.241] (-942.922) * (-942.783) (-940.976) (-944.165) [-940.721] -- 0:00:35
468000 -- (-945.056) (-942.319) (-942.517) [-941.446] * (-942.882) (-943.614) (-943.816) [-940.360] -- 0:00:35
468500 -- (-946.287) [-941.064] (-942.497) (-940.743) * (-942.627) (-941.222) (-945.415) [-942.675] -- 0:00:35
469000 -- (-946.903) (-942.980) (-941.972) [-940.738] * [-941.271] (-941.333) (-942.245) (-942.259) -- 0:00:35
469500 -- [-942.440] (-943.421) (-943.607) (-941.954) * (-940.183) [-940.785] (-944.428) (-943.841) -- 0:00:35
470000 -- (-942.960) (-945.694) (-942.823) [-940.656] * (-941.198) (-941.428) [-943.133] (-941.971) -- 0:00:34
Average standard deviation of split frequencies: 0.006948
470500 -- (-943.086) (-943.448) (-943.573) [-943.183] * (-946.502) (-940.687) (-943.648) [-940.882] -- 0:00:34
471000 -- [-942.109] (-940.141) (-942.420) (-941.099) * (-944.339) (-940.858) [-942.336] (-945.226) -- 0:00:34
471500 -- (-941.603) (-942.364) (-940.559) [-941.162] * (-942.037) (-940.855) [-942.147] (-942.826) -- 0:00:34
472000 -- (-942.063) (-940.245) [-941.933] (-942.805) * (-943.702) (-941.817) [-942.813] (-942.103) -- 0:00:34
472500 -- (-945.911) (-940.973) (-943.400) [-941.039] * (-943.736) [-943.463] (-941.280) (-940.319) -- 0:00:34
473000 -- (-941.991) (-940.822) [-943.539] (-941.599) * (-943.618) (-948.099) (-941.430) [-941.088] -- 0:00:34
473500 -- (-941.897) (-940.751) (-942.124) [-942.278] * [-943.541] (-943.686) (-942.156) (-945.752) -- 0:00:34
474000 -- [-944.974] (-940.566) (-941.606) (-940.562) * (-941.983) [-943.246] (-941.682) (-941.199) -- 0:00:34
474500 -- (-940.829) (-941.308) (-941.159) [-943.969] * (-941.808) [-942.074] (-940.604) (-943.844) -- 0:00:34
475000 -- [-943.695] (-943.000) (-940.680) (-941.344) * (-948.665) (-943.899) [-940.346] (-941.104) -- 0:00:34
Average standard deviation of split frequencies: 0.006809
475500 -- (-944.707) (-944.387) [-943.463] (-941.097) * (-944.276) (-943.654) [-941.846] (-941.280) -- 0:00:34
476000 -- (-945.158) (-941.750) [-940.925] (-941.170) * [-940.218] (-944.266) (-942.532) (-941.500) -- 0:00:34
476500 -- (-942.056) (-941.120) [-942.829] (-940.288) * [-941.461] (-945.629) (-944.596) (-942.866) -- 0:00:34
477000 -- [-942.237] (-941.730) (-940.336) (-940.815) * [-943.340] (-942.028) (-944.804) (-941.827) -- 0:00:33
477500 -- (-946.198) [-943.273] (-941.438) (-943.946) * [-941.063] (-942.921) (-942.301) (-943.367) -- 0:00:35
478000 -- (-941.433) (-942.080) (-942.742) [-940.425] * (-941.538) [-942.160] (-944.015) (-943.251) -- 0:00:34
478500 -- (-943.698) [-941.203] (-943.617) (-942.766) * (-941.788) [-942.465] (-947.788) (-940.590) -- 0:00:34
479000 -- [-943.243] (-943.541) (-943.485) (-942.521) * [-946.529] (-942.407) (-941.885) (-942.197) -- 0:00:34
479500 -- [-941.489] (-943.609) (-947.148) (-943.754) * [-943.362] (-941.132) (-945.493) (-943.166) -- 0:00:34
480000 -- (-940.477) (-946.585) [-943.538] (-941.339) * (-943.078) (-942.050) [-946.051] (-943.477) -- 0:00:34
Average standard deviation of split frequencies: 0.007049
480500 -- (-940.839) (-942.056) (-942.370) [-940.455] * (-942.286) (-942.911) [-944.620] (-943.546) -- 0:00:34
481000 -- (-942.172) (-940.806) [-942.016] (-942.139) * [-942.543] (-942.131) (-942.180) (-946.021) -- 0:00:34
481500 -- (-943.293) (-940.893) (-941.293) [-945.188] * (-942.380) (-943.589) (-942.430) [-943.300] -- 0:00:34
482000 -- (-941.293) (-943.064) (-941.229) [-941.028] * (-940.378) (-941.401) [-944.151] (-943.559) -- 0:00:34
482500 -- (-944.868) (-944.733) [-943.171] (-942.325) * (-941.173) (-941.570) (-941.908) [-943.352] -- 0:00:34
483000 -- (-943.625) [-940.983] (-943.276) (-940.936) * (-940.991) [-943.314] (-941.563) (-941.283) -- 0:00:34
483500 -- (-944.586) (-940.679) [-941.995] (-949.909) * (-940.841) [-942.543] (-951.822) (-943.962) -- 0:00:34
484000 -- (-945.419) (-944.407) [-941.864] (-948.189) * (-943.027) (-941.893) [-940.454] (-947.498) -- 0:00:34
484500 -- (-943.574) (-945.983) [-942.341] (-942.570) * (-943.283) (-942.775) (-942.452) [-947.739] -- 0:00:34
485000 -- (-945.175) (-941.957) [-940.601] (-944.864) * (-941.068) [-945.822] (-942.690) (-940.785) -- 0:00:33
Average standard deviation of split frequencies: 0.006850
485500 -- (-941.837) [-940.715] (-940.419) (-942.821) * (-942.410) (-942.134) (-941.940) [-941.623] -- 0:00:33
486000 -- [-943.038] (-940.183) (-939.964) (-941.202) * (-942.542) [-942.107] (-942.225) (-941.466) -- 0:00:33
486500 -- [-943.591] (-940.217) (-940.039) (-943.175) * [-942.166] (-943.264) (-947.032) (-940.919) -- 0:00:33
487000 -- (-943.073) (-940.707) [-939.994] (-944.154) * (-942.785) (-949.333) (-941.841) [-943.815] -- 0:00:33
487500 -- (-940.913) [-942.550] (-940.651) (-943.237) * (-943.424) [-946.375] (-941.006) (-941.524) -- 0:00:33
488000 -- [-940.557] (-940.943) (-942.102) (-945.045) * (-942.499) [-943.114] (-941.256) (-943.064) -- 0:00:33
488500 -- [-940.708] (-941.609) (-944.492) (-945.828) * (-946.475) (-945.622) [-943.260] (-943.324) -- 0:00:33
489000 -- (-941.654) (-941.408) (-940.113) [-941.384] * (-942.474) (-942.206) [-943.160] (-941.110) -- 0:00:33
489500 -- (-944.005) (-941.020) [-939.917] (-941.524) * (-943.731) (-941.005) (-942.007) [-942.240] -- 0:00:33
490000 -- (-940.896) [-941.685] (-942.835) (-942.484) * (-943.008) (-942.969) [-942.352] (-940.954) -- 0:00:33
Average standard deviation of split frequencies: 0.006965
490500 -- (-940.770) [-941.519] (-947.097) (-940.876) * (-942.998) [-944.300] (-942.718) (-943.207) -- 0:00:33
491000 -- (-941.564) (-941.356) (-944.771) [-945.390] * (-943.794) (-941.492) [-943.037] (-945.445) -- 0:00:33
491500 -- (-943.075) (-941.742) [-944.386] (-942.458) * [-942.984] (-942.313) (-942.323) (-941.647) -- 0:00:33
492000 -- (-942.927) [-945.023] (-941.536) (-943.850) * [-940.488] (-942.211) (-941.181) (-940.481) -- 0:00:33
492500 -- (-942.069) (-941.809) (-942.817) [-942.337] * [-944.946] (-942.232) (-941.990) (-944.673) -- 0:00:32
493000 -- [-941.872] (-941.420) (-940.325) (-942.155) * (-942.703) (-945.303) (-944.102) [-943.590] -- 0:00:32
493500 -- [-941.517] (-942.453) (-943.807) (-944.710) * (-942.943) (-941.943) [-941.950] (-944.868) -- 0:00:32
494000 -- (-940.030) [-942.118] (-945.925) (-943.264) * (-942.648) (-946.029) (-943.843) [-943.006] -- 0:00:33
494500 -- (-940.029) (-941.090) (-943.410) [-947.300] * (-943.622) [-941.450] (-941.407) (-943.444) -- 0:00:33
495000 -- (-940.616) (-941.324) (-942.000) [-942.412] * (-940.154) (-940.517) (-942.396) [-940.985] -- 0:00:33
Average standard deviation of split frequencies: 0.006950
495500 -- (-942.080) [-945.098] (-942.306) (-942.124) * (-941.891) (-941.181) (-942.041) [-942.888] -- 0:00:33
496000 -- (-941.883) (-945.938) (-941.680) [-942.116] * (-944.567) [-940.470] (-941.437) (-941.646) -- 0:00:33
496500 -- [-943.883] (-943.712) (-943.587) (-942.054) * (-943.724) (-940.904) [-942.413] (-940.498) -- 0:00:33
497000 -- [-943.997] (-943.368) (-943.235) (-941.302) * (-942.646) [-941.138] (-943.417) (-943.025) -- 0:00:33
497500 -- (-943.742) [-940.551] (-941.218) (-941.222) * (-943.032) (-941.314) (-942.003) [-942.260] -- 0:00:33
498000 -- (-940.809) [-941.716] (-941.842) (-942.666) * (-945.117) (-941.190) [-941.834] (-940.375) -- 0:00:33
498500 -- (-944.856) (-941.721) [-940.246] (-941.574) * (-943.876) [-941.014] (-942.344) (-942.034) -- 0:00:33
499000 -- (-940.425) (-944.411) [-942.089] (-943.346) * (-943.028) (-944.187) (-941.747) [-947.022] -- 0:00:33
499500 -- (-940.395) (-942.073) (-945.618) [-943.022] * (-944.246) (-942.963) (-942.269) [-943.522] -- 0:00:33
500000 -- (-944.245) (-945.909) (-946.131) [-945.313] * (-942.273) (-941.096) (-944.758) [-943.169] -- 0:00:33
Average standard deviation of split frequencies: 0.007120
500500 -- (-942.372) [-944.508] (-942.951) (-947.260) * [-941.741] (-942.291) (-943.885) (-941.223) -- 0:00:32
501000 -- (-943.260) (-944.032) [-940.548] (-942.280) * (-942.136) [-940.315] (-943.466) (-941.631) -- 0:00:32
501500 -- (-946.144) (-945.587) [-941.588] (-943.965) * (-941.283) (-941.106) (-943.886) [-941.141] -- 0:00:32
502000 -- [-942.633] (-943.766) (-942.205) (-948.491) * (-941.181) (-941.410) (-944.599) [-943.749] -- 0:00:32
502500 -- [-942.224] (-944.784) (-946.293) (-944.512) * (-941.071) [-940.551] (-942.576) (-943.410) -- 0:00:32
503000 -- (-943.471) [-946.873] (-942.025) (-944.329) * (-942.763) [-940.612] (-942.819) (-942.819) -- 0:00:32
503500 -- (-943.026) (-941.481) (-943.023) [-940.682] * [-941.231] (-941.897) (-946.456) (-945.746) -- 0:00:32
504000 -- (-943.419) [-941.711] (-943.857) (-940.698) * (-942.184) (-944.019) (-947.017) [-946.356] -- 0:00:32
504500 -- (-942.316) [-943.667] (-940.192) (-944.241) * (-941.463) (-940.106) [-942.459] (-942.868) -- 0:00:32
505000 -- [-940.740] (-943.349) (-940.044) (-943.770) * (-943.492) (-941.186) (-946.823) [-940.394] -- 0:00:32
Average standard deviation of split frequencies: 0.007220
505500 -- [-942.627] (-944.344) (-942.861) (-942.710) * [-942.320] (-942.546) (-941.884) (-942.556) -- 0:00:32
506000 -- (-941.546) (-944.831) (-941.630) [-942.154] * [-941.661] (-942.712) (-942.330) (-942.931) -- 0:00:32
506500 -- (-940.066) [-941.427] (-941.378) (-942.121) * (-941.952) (-946.548) (-942.863) [-942.700] -- 0:00:32
507000 -- [-941.426] (-941.869) (-940.881) (-943.323) * (-942.873) (-944.320) (-943.004) [-943.156] -- 0:00:32
507500 -- (-946.051) (-942.415) (-942.444) [-945.036] * (-943.060) [-946.061] (-942.927) (-940.993) -- 0:00:32
508000 -- [-941.820] (-945.153) (-941.284) (-943.844) * (-941.506) (-940.565) (-943.550) [-943.098] -- 0:00:31
508500 -- (-941.954) (-947.709) (-941.509) [-942.541] * (-942.398) (-941.389) (-942.072) [-943.098] -- 0:00:31
509000 -- (-940.687) (-941.268) [-943.514] (-940.743) * (-945.596) [-943.115] (-942.508) (-941.828) -- 0:00:31
509500 -- (-944.500) [-940.517] (-946.315) (-941.957) * (-945.573) [-943.207] (-943.254) (-942.761) -- 0:00:31
510000 -- (-943.879) (-940.940) (-946.205) [-944.037] * [-942.870] (-940.745) (-942.994) (-940.791) -- 0:00:32
Average standard deviation of split frequencies: 0.007327
510500 -- [-945.832] (-941.538) (-941.860) (-944.951) * [-943.058] (-946.818) (-942.769) (-941.356) -- 0:00:32
511000 -- [-943.466] (-941.440) (-945.203) (-941.440) * (-943.447) [-941.537] (-941.418) (-943.077) -- 0:00:32
511500 -- (-943.848) [-941.315] (-944.715) (-944.838) * (-941.084) (-941.412) (-944.971) [-941.903] -- 0:00:32
512000 -- (-941.239) (-941.987) [-943.081] (-943.337) * [-940.305] (-942.409) (-941.933) (-945.708) -- 0:00:32
512500 -- [-940.171] (-940.529) (-944.737) (-947.699) * (-940.498) [-942.931] (-943.168) (-950.638) -- 0:00:32
513000 -- (-940.424) [-942.397] (-941.256) (-940.879) * (-944.878) [-943.199] (-944.586) (-943.161) -- 0:00:32
513500 -- [-941.950] (-942.937) (-940.973) (-940.297) * [-940.570] (-940.521) (-946.244) (-945.052) -- 0:00:32
514000 -- (-940.934) (-942.774) (-942.348) [-941.979] * [-940.126] (-941.041) (-945.018) (-951.092) -- 0:00:32
514500 -- (-941.347) [-940.713] (-942.343) (-942.455) * (-940.423) (-941.658) (-944.582) [-941.942] -- 0:00:32
515000 -- (-940.615) (-941.084) (-944.120) [-942.173] * (-940.639) (-940.518) [-940.336] (-940.009) -- 0:00:32
Average standard deviation of split frequencies: 0.007765
515500 -- (-944.194) (-941.002) (-940.337) [-940.898] * (-941.805) (-940.672) [-941.362] (-942.326) -- 0:00:31
516000 -- (-942.542) (-941.732) (-941.667) [-941.204] * [-940.949] (-941.523) (-941.425) (-944.282) -- 0:00:31
516500 -- [-941.512] (-942.976) (-942.178) (-942.696) * (-942.257) [-942.794] (-942.736) (-942.780) -- 0:00:31
517000 -- (-941.526) (-944.089) (-940.890) [-941.693] * (-942.104) (-943.821) [-943.002] (-943.368) -- 0:00:31
517500 -- (-941.121) [-942.534] (-940.906) (-941.748) * [-944.558] (-943.106) (-943.756) (-942.737) -- 0:00:31
518000 -- (-941.036) (-943.818) [-941.562] (-941.712) * [-943.320] (-944.832) (-943.050) (-943.667) -- 0:00:31
518500 -- (-940.648) (-942.706) (-943.146) [-942.954] * (-942.447) (-945.329) [-943.104] (-941.555) -- 0:00:31
519000 -- [-941.438] (-944.206) (-943.026) (-942.073) * (-941.281) [-944.036] (-944.091) (-941.511) -- 0:00:31
519500 -- (-942.089) (-943.765) [-945.014] (-941.305) * (-944.821) [-945.697] (-941.714) (-943.311) -- 0:00:31
520000 -- [-947.071] (-942.166) (-940.255) (-940.947) * (-946.957) (-944.789) [-944.271] (-944.530) -- 0:00:31
Average standard deviation of split frequencies: 0.007526
520500 -- (-942.966) (-941.715) (-942.016) [-943.362] * (-944.308) (-942.903) [-942.743] (-947.601) -- 0:00:31
521000 -- (-941.950) (-940.511) (-940.881) [-943.033] * [-943.192] (-943.633) (-941.935) (-945.316) -- 0:00:31
521500 -- (-945.280) (-944.457) [-943.823] (-943.735) * [-948.187] (-943.074) (-941.754) (-945.967) -- 0:00:31
522000 -- (-945.181) [-941.402] (-941.522) (-943.362) * (-944.419) (-941.637) (-942.733) [-941.445] -- 0:00:31
522500 -- [-940.146] (-945.954) (-942.066) (-942.710) * [-945.204] (-942.301) (-942.560) (-940.020) -- 0:00:31
523000 -- [-942.426] (-948.868) (-941.224) (-940.623) * (-944.482) (-940.833) (-940.354) [-942.060] -- 0:00:31
523500 -- (-943.736) (-943.893) (-942.310) [-941.027] * (-941.497) (-940.833) [-943.192] (-943.030) -- 0:00:30
524000 -- [-942.532] (-943.043) (-941.192) (-946.616) * (-941.324) (-940.751) [-942.390] (-945.936) -- 0:00:30
524500 -- (-943.104) [-943.734] (-940.802) (-946.142) * (-944.833) (-943.273) [-941.676] (-944.541) -- 0:00:30
525000 -- (-943.926) (-941.209) (-943.625) [-945.057] * [-940.752] (-941.792) (-943.745) (-947.025) -- 0:00:30
Average standard deviation of split frequencies: 0.007562
525500 -- (-947.107) [-941.098] (-943.425) (-943.458) * [-940.752] (-942.504) (-942.109) (-944.585) -- 0:00:30
526000 -- (-941.225) [-940.761] (-941.867) (-941.516) * (-943.210) [-942.328] (-942.775) (-941.783) -- 0:00:30
526500 -- [-943.584] (-940.494) (-942.948) (-940.515) * (-941.746) (-944.906) [-942.641] (-942.279) -- 0:00:31
527000 -- (-940.491) [-940.964] (-943.190) (-940.441) * (-942.175) (-944.148) [-941.247] (-943.181) -- 0:00:31
527500 -- [-940.902] (-943.390) (-941.376) (-940.559) * (-942.005) (-942.446) (-943.966) [-942.622] -- 0:00:31
528000 -- [-940.936] (-944.188) (-941.969) (-942.330) * (-943.436) (-943.815) (-941.464) [-942.757] -- 0:00:31
528500 -- (-941.504) [-942.880] (-947.124) (-941.295) * [-940.913] (-944.696) (-943.268) (-944.433) -- 0:00:31
529000 -- [-942.427] (-943.469) (-940.566) (-943.324) * [-941.892] (-941.300) (-942.625) (-940.760) -- 0:00:31
529500 -- [-941.748] (-940.787) (-941.717) (-943.352) * (-942.269) [-941.742] (-943.002) (-944.614) -- 0:00:31
530000 -- [-941.083] (-943.355) (-940.553) (-942.593) * (-947.934) (-944.280) [-944.133] (-940.284) -- 0:00:31
Average standard deviation of split frequencies: 0.008050
530500 -- [-943.752] (-941.120) (-943.022) (-940.940) * (-947.145) [-942.879] (-943.502) (-942.316) -- 0:00:30
531000 -- (-944.305) (-944.343) (-943.462) [-941.040] * (-943.104) [-950.656] (-943.266) (-941.482) -- 0:00:30
531500 -- [-942.656] (-944.280) (-943.342) (-942.701) * (-941.123) (-940.890) (-942.378) [-941.088] -- 0:00:30
532000 -- (-944.803) [-944.937] (-944.014) (-944.193) * (-941.847) (-941.640) (-944.548) [-941.217] -- 0:00:30
532500 -- (-940.824) (-943.814) [-941.014] (-944.726) * [-944.623] (-941.348) (-940.951) (-942.523) -- 0:00:30
533000 -- (-940.139) (-946.444) (-941.480) [-944.234] * (-942.432) (-941.411) [-942.736] (-944.983) -- 0:00:30
533500 -- (-942.272) [-940.429] (-941.840) (-942.153) * (-944.607) [-942.197] (-941.127) (-943.159) -- 0:00:30
534000 -- (-943.967) (-940.396) (-941.555) [-941.066] * (-941.134) [-940.665] (-940.617) (-942.666) -- 0:00:30
534500 -- (-944.010) (-940.596) (-940.654) [-941.334] * [-941.073] (-940.893) (-941.792) (-941.042) -- 0:00:30
535000 -- (-942.827) (-941.185) [-941.579] (-941.439) * (-941.174) (-941.689) (-944.598) [-944.140] -- 0:00:30
Average standard deviation of split frequencies: 0.007915
535500 -- (-942.198) [-940.383] (-944.112) (-940.882) * (-940.680) (-940.314) [-944.278] (-947.635) -- 0:00:30
536000 -- (-947.725) (-941.291) [-943.591] (-946.429) * [-941.509] (-943.061) (-944.919) (-941.940) -- 0:00:30
536500 -- [-943.260] (-945.112) (-942.316) (-940.750) * (-942.023) (-941.863) (-940.408) [-946.883] -- 0:00:30
537000 -- (-944.426) (-944.374) (-942.450) [-942.266] * (-945.744) (-946.889) [-942.850] (-948.090) -- 0:00:30
537500 -- (-941.051) [-941.104] (-941.206) (-949.202) * (-943.699) [-945.413] (-940.115) (-943.088) -- 0:00:30
538000 -- (-940.759) (-944.591) [-940.643] (-943.401) * (-945.573) (-941.009) (-940.592) [-944.603] -- 0:00:30
538500 -- (-940.968) [-940.648] (-940.772) (-942.900) * (-949.624) [-940.670] (-941.789) (-942.036) -- 0:00:29
539000 -- (-941.660) (-941.966) (-942.010) [-942.499] * (-941.713) [-940.760] (-942.327) (-940.591) -- 0:00:29
539500 -- (-941.431) (-943.613) (-940.628) [-942.984] * (-943.425) (-944.133) [-941.162] (-940.911) -- 0:00:29
540000 -- [-940.814] (-942.192) (-944.866) (-942.722) * (-942.401) [-945.301] (-944.223) (-940.485) -- 0:00:29
Average standard deviation of split frequencies: 0.008501
540500 -- (-942.624) [-945.514] (-941.812) (-942.671) * [-941.608] (-944.798) (-940.967) (-941.525) -- 0:00:29
541000 -- (-940.735) (-945.947) [-942.812] (-942.242) * [-940.575] (-941.222) (-941.742) (-941.972) -- 0:00:29
541500 -- (-940.183) [-944.501] (-944.362) (-943.895) * (-944.480) (-943.694) [-940.608] (-941.543) -- 0:00:29
542000 -- (-942.328) (-943.666) [-945.875] (-943.427) * (-940.208) (-941.772) [-941.323] (-942.231) -- 0:00:29
542500 -- [-940.915] (-946.799) (-947.673) (-944.212) * (-943.412) [-941.472] (-944.687) (-942.068) -- 0:00:29
543000 -- (-942.607) (-946.040) (-951.987) [-942.956] * (-943.486) (-941.656) [-942.889] (-943.530) -- 0:00:29
543500 -- (-943.573) (-943.860) [-942.508] (-941.720) * [-944.766] (-940.237) (-944.679) (-940.543) -- 0:00:30
544000 -- (-942.709) (-942.717) (-943.091) [-941.634] * (-945.055) (-942.368) (-944.118) [-943.294] -- 0:00:30
544500 -- (-942.342) (-945.060) [-941.363] (-940.544) * (-943.437) (-942.509) (-942.123) [-945.922] -- 0:00:30
545000 -- (-940.465) (-944.123) [-941.300] (-941.432) * (-947.454) [-945.067] (-943.757) (-946.592) -- 0:00:30
Average standard deviation of split frequencies: 0.008742
545500 -- [-941.871] (-940.829) (-942.989) (-941.192) * (-941.707) [-941.806] (-944.050) (-941.156) -- 0:00:29
546000 -- (-941.828) (-940.444) (-943.016) [-941.075] * (-942.006) (-943.450) (-944.200) [-941.402] -- 0:00:29
546500 -- (-944.378) (-943.010) (-943.221) [-940.527] * (-941.483) (-942.019) (-943.773) [-943.633] -- 0:00:29
547000 -- [-944.447] (-940.877) (-945.065) (-940.585) * (-940.869) (-946.650) [-941.234] (-942.309) -- 0:00:29
547500 -- (-942.668) (-941.770) (-941.304) [-941.758] * (-940.956) (-942.910) (-939.957) [-942.557] -- 0:00:29
548000 -- (-942.419) (-945.030) [-942.265] (-940.247) * (-941.396) [-941.154] (-940.975) (-947.159) -- 0:00:29
548500 -- (-940.609) (-941.831) (-942.097) [-943.094] * (-941.088) (-944.579) [-940.862] (-941.731) -- 0:00:29
549000 -- (-943.509) [-944.233] (-944.547) (-941.857) * (-940.968) (-940.780) [-944.938] (-943.177) -- 0:00:29
549500 -- [-942.386] (-943.561) (-942.800) (-940.697) * (-940.968) (-940.999) [-942.455] (-941.986) -- 0:00:29
550000 -- [-943.916] (-943.205) (-940.730) (-943.688) * (-940.968) (-940.829) (-940.339) [-941.304] -- 0:00:29
Average standard deviation of split frequencies: 0.008507
550500 -- (-944.294) [-942.770] (-941.231) (-944.025) * (-940.856) (-941.015) (-941.969) [-941.984] -- 0:00:29
551000 -- [-942.602] (-944.778) (-942.366) (-941.249) * (-943.231) (-945.122) (-941.135) [-942.030] -- 0:00:29
551500 -- (-941.003) (-942.182) (-943.243) [-942.354] * (-943.040) (-949.505) [-942.856] (-941.563) -- 0:00:29
552000 -- (-941.745) (-941.646) (-940.569) [-942.514] * (-941.300) (-941.396) (-943.935) [-942.600] -- 0:00:29
552500 -- (-941.737) (-940.341) [-940.703] (-944.082) * (-943.345) [-941.555] (-941.820) (-943.174) -- 0:00:29
553000 -- [-941.782] (-943.814) (-941.894) (-940.918) * (-943.053) (-942.795) [-941.300] (-944.697) -- 0:00:29
553500 -- (-943.481) [-940.727] (-941.873) (-943.443) * [-945.267] (-946.508) (-943.354) (-943.161) -- 0:00:29
554000 -- [-942.532] (-941.196) (-940.520) (-942.018) * [-943.035] (-943.005) (-946.091) (-942.245) -- 0:00:28
554500 -- (-943.678) (-941.262) [-941.166] (-944.577) * [-941.165] (-943.965) (-949.616) (-942.472) -- 0:00:28
555000 -- (-942.170) (-941.104) [-941.870] (-942.771) * (-940.964) [-944.948] (-952.509) (-943.475) -- 0:00:28
Average standard deviation of split frequencies: 0.009167
555500 -- [-941.526] (-942.962) (-946.205) (-943.304) * (-943.734) (-944.698) [-945.235] (-944.152) -- 0:00:28
556000 -- (-940.873) [-943.681] (-942.358) (-942.145) * (-947.967) [-943.803] (-943.119) (-942.722) -- 0:00:28
556500 -- [-941.088] (-942.609) (-941.956) (-944.818) * (-945.317) [-940.674] (-940.810) (-942.830) -- 0:00:28
557000 -- [-940.479] (-942.957) (-941.439) (-942.067) * (-941.666) [-940.520] (-941.606) (-942.275) -- 0:00:28
557500 -- [-943.738] (-941.475) (-942.257) (-942.484) * (-941.084) (-941.318) (-940.561) [-942.616] -- 0:00:28
558000 -- (-941.223) [-940.559] (-940.569) (-941.710) * [-940.688] (-941.855) (-942.379) (-943.967) -- 0:00:28
558500 -- (-947.305) (-944.818) (-942.277) [-941.755] * (-941.195) [-944.883] (-943.307) (-943.814) -- 0:00:28
559000 -- (-945.197) [-944.037] (-940.393) (-943.571) * (-943.927) (-943.052) (-943.470) [-940.665] -- 0:00:28
559500 -- (-941.519) [-940.786] (-943.206) (-942.137) * [-941.936] (-944.975) (-942.190) (-940.397) -- 0:00:29
560000 -- (-945.255) [-942.352] (-944.444) (-943.680) * (-940.941) [-941.686] (-941.671) (-940.367) -- 0:00:29
Average standard deviation of split frequencies: 0.009196
560500 -- [-941.397] (-944.384) (-941.267) (-943.253) * (-941.098) (-941.531) (-942.298) [-942.759] -- 0:00:29
561000 -- (-945.319) (-943.438) (-940.451) [-942.300] * (-944.874) [-942.584] (-941.720) (-942.765) -- 0:00:28
561500 -- (-943.878) (-941.224) [-940.333] (-941.602) * (-943.803) (-942.995) (-942.459) [-944.907] -- 0:00:28
562000 -- (-941.851) (-940.572) (-942.367) [-941.897] * (-941.878) (-942.269) [-941.694] (-944.942) -- 0:00:28
562500 -- (-942.755) (-941.794) (-941.600) [-940.193] * [-942.689] (-942.461) (-942.333) (-940.240) -- 0:00:28
563000 -- (-942.160) [-940.877] (-941.542) (-940.484) * [-941.589] (-942.055) (-940.341) (-939.985) -- 0:00:28
563500 -- [-941.477] (-940.693) (-942.865) (-940.996) * [-940.091] (-944.696) (-941.597) (-942.136) -- 0:00:28
564000 -- (-942.027) (-940.266) (-945.770) [-946.435] * (-942.504) (-943.705) (-943.724) [-940.332] -- 0:00:28
564500 -- [-940.459] (-940.628) (-941.928) (-941.990) * (-942.669) (-941.347) (-941.663) [-941.167] -- 0:00:28
565000 -- (-948.278) (-940.893) [-942.139] (-941.110) * [-941.457] (-941.445) (-944.248) (-942.667) -- 0:00:28
Average standard deviation of split frequencies: 0.009370
565500 -- [-947.997] (-945.642) (-942.325) (-941.894) * (-942.926) (-941.919) (-942.232) [-940.884] -- 0:00:28
566000 -- [-948.058] (-940.943) (-944.794) (-940.640) * (-942.934) (-941.712) (-942.611) [-940.782] -- 0:00:28
566500 -- (-941.589) (-940.791) [-940.724] (-943.613) * (-941.313) [-942.479] (-942.967) (-941.344) -- 0:00:28
567000 -- (-941.395) (-941.579) (-943.170) [-942.740] * (-942.016) (-940.861) [-943.195] (-944.695) -- 0:00:28
567500 -- (-942.326) (-941.174) (-943.641) [-943.654] * (-944.292) (-940.685) [-940.521] (-944.661) -- 0:00:28
568000 -- (-946.100) (-941.374) [-940.113] (-941.218) * (-944.444) (-941.487) (-942.858) [-943.281] -- 0:00:28
568500 -- (-941.067) [-942.441] (-941.758) (-942.451) * (-943.841) [-940.662] (-943.029) (-945.074) -- 0:00:28
569000 -- (-941.982) [-941.124] (-941.434) (-941.891) * (-944.301) [-941.115] (-940.764) (-944.248) -- 0:00:28
569500 -- [-943.215] (-941.164) (-941.887) (-942.398) * [-940.895] (-941.836) (-940.901) (-941.179) -- 0:00:27
570000 -- (-947.533) [-941.025] (-945.430) (-942.169) * (-943.305) (-941.507) [-942.640] (-941.261) -- 0:00:27
Average standard deviation of split frequencies: 0.009758
570500 -- (-944.330) (-943.993) [-944.691] (-940.172) * (-943.926) (-941.715) [-942.199] (-944.992) -- 0:00:27
571000 -- (-952.899) [-943.148] (-943.338) (-940.152) * [-941.316] (-940.169) (-941.828) (-944.920) -- 0:00:27
571500 -- [-944.625] (-941.156) (-943.243) (-941.856) * [-942.878] (-942.778) (-943.548) (-941.801) -- 0:00:27
572000 -- (-940.597) (-942.479) (-947.921) [-941.859] * (-942.030) [-940.106] (-945.904) (-944.758) -- 0:00:27
572500 -- (-941.391) (-944.896) (-947.212) [-943.638] * (-944.596) (-940.895) (-944.553) [-943.318] -- 0:00:27
573000 -- [-942.737] (-944.186) (-943.191) (-943.225) * (-945.616) (-947.865) (-945.793) [-941.164] -- 0:00:27
573500 -- (-943.558) [-941.960] (-941.876) (-944.799) * (-943.230) (-941.916) (-941.109) [-940.322] -- 0:00:27
574000 -- (-942.446) (-942.433) (-942.354) [-944.724] * (-943.944) (-942.051) (-941.065) [-940.503] -- 0:00:27
574500 -- [-941.311] (-940.873) (-945.692) (-941.914) * (-944.244) (-940.543) (-941.177) [-942.586] -- 0:00:27
575000 -- (-946.863) [-940.953] (-946.102) (-941.919) * [-940.291] (-943.733) (-942.052) (-942.239) -- 0:00:27
Average standard deviation of split frequencies: 0.010384
575500 -- [-942.919] (-941.543) (-942.187) (-941.670) * (-940.460) (-942.230) (-940.879) [-940.971] -- 0:00:27
576000 -- (-946.373) [-943.885] (-942.053) (-944.945) * (-941.033) [-941.657] (-947.307) (-941.283) -- 0:00:27
576500 -- (-943.681) (-942.047) [-941.383] (-948.571) * (-941.229) [-940.942] (-941.339) (-940.822) -- 0:00:27
577000 -- (-941.415) (-942.041) [-942.291] (-943.474) * [-944.124] (-945.169) (-944.128) (-940.673) -- 0:00:27
577500 -- (-942.735) (-947.452) [-941.566] (-940.765) * (-944.990) (-946.388) [-943.819] (-943.567) -- 0:00:27
578000 -- [-941.946] (-943.187) (-942.950) (-940.689) * [-943.738] (-941.636) (-941.933) (-947.495) -- 0:00:27
578500 -- [-943.647] (-942.821) (-945.499) (-941.898) * (-941.440) (-948.045) (-942.314) [-942.440] -- 0:00:27
579000 -- [-942.535] (-941.263) (-941.318) (-946.178) * (-940.084) (-943.458) (-944.093) [-941.344] -- 0:00:27
579500 -- [-941.871] (-941.158) (-941.477) (-944.660) * [-942.841] (-943.238) (-943.759) (-941.642) -- 0:00:27
580000 -- (-943.549) (-942.827) [-940.810] (-942.183) * (-943.701) (-945.045) [-940.957] (-942.046) -- 0:00:27
Average standard deviation of split frequencies: 0.010503
580500 -- (-941.170) (-940.409) [-942.557] (-942.216) * (-941.929) (-945.934) (-941.336) [-942.156] -- 0:00:27
581000 -- (-943.084) (-942.156) [-941.981] (-942.730) * (-940.965) (-944.295) [-940.325] (-946.137) -- 0:00:27
581500 -- (-945.602) (-941.684) [-941.896] (-941.979) * (-944.251) (-946.197) (-940.677) [-940.955] -- 0:00:27
582000 -- (-945.814) (-941.922) (-944.498) [-944.844] * (-943.341) (-940.800) (-940.809) [-940.900] -- 0:00:27
582500 -- [-942.581] (-946.204) (-942.024) (-941.218) * (-940.906) (-943.989) [-941.078] (-945.543) -- 0:00:27
583000 -- (-941.509) [-942.864] (-940.772) (-940.544) * (-944.316) (-941.454) [-942.475] (-945.505) -- 0:00:27
583500 -- (-947.974) [-942.640] (-941.625) (-940.274) * (-944.451) [-940.530] (-943.373) (-943.480) -- 0:00:27
584000 -- (-949.169) (-944.590) (-941.718) [-945.084] * [-940.626] (-940.643) (-943.257) (-943.939) -- 0:00:27
584500 -- [-944.770] (-943.111) (-942.900) (-944.405) * (-946.941) [-944.429] (-941.666) (-942.372) -- 0:00:27
585000 -- (-942.634) [-943.785] (-945.276) (-941.317) * (-946.667) (-943.140) [-941.046] (-943.736) -- 0:00:26
Average standard deviation of split frequencies: 0.009955
585500 -- (-944.193) [-942.202] (-943.737) (-941.309) * (-943.844) [-941.351] (-943.462) (-943.258) -- 0:00:26
586000 -- (-942.343) [-943.325] (-953.261) (-946.930) * (-946.010) (-945.140) (-942.546) [-942.737] -- 0:00:26
586500 -- (-946.180) (-942.015) (-950.213) [-942.805] * (-941.850) [-939.979] (-944.820) (-942.425) -- 0:00:26
587000 -- (-943.335) [-941.633] (-941.212) (-943.423) * (-942.896) [-940.921] (-944.505) (-943.254) -- 0:00:26
587500 -- (-941.497) (-942.194) [-943.885] (-945.062) * (-946.154) (-940.905) (-942.660) [-944.454] -- 0:00:26
588000 -- (-947.412) (-942.175) (-944.888) [-942.061] * (-946.301) (-941.558) (-944.475) [-944.023] -- 0:00:26
588500 -- [-941.618] (-943.437) (-941.672) (-941.462) * (-949.893) (-940.347) [-941.223] (-942.488) -- 0:00:26
589000 -- (-942.523) (-943.411) [-944.616] (-940.176) * (-944.746) (-941.319) [-942.729] (-943.677) -- 0:00:26
589500 -- (-942.801) (-943.576) [-941.623] (-940.544) * (-940.941) [-940.630] (-943.453) (-941.419) -- 0:00:26
590000 -- (-943.720) [-945.092] (-944.009) (-942.154) * (-941.207) (-940.623) (-945.848) [-941.638] -- 0:00:26
Average standard deviation of split frequencies: 0.009727
590500 -- (-947.128) (-943.969) (-941.816) [-941.830] * (-949.869) (-942.108) (-942.514) [-941.466] -- 0:00:26
591000 -- (-944.410) (-943.718) [-944.742] (-941.453) * (-942.061) [-942.412] (-942.767) (-940.603) -- 0:00:26
591500 -- [-942.685] (-945.122) (-947.089) (-942.284) * (-942.595) (-941.136) [-941.554] (-941.961) -- 0:00:26
592000 -- (-940.442) [-945.571] (-941.519) (-942.693) * (-941.219) [-942.622] (-942.818) (-942.511) -- 0:00:26
592500 -- [-941.283] (-943.122) (-941.121) (-940.980) * (-942.259) (-941.201) [-940.618] (-944.715) -- 0:00:26
593000 -- (-940.355) (-943.537) [-940.399] (-942.860) * (-943.569) [-940.982] (-943.889) (-942.517) -- 0:00:26
593500 -- (-940.392) [-941.163] (-941.113) (-945.158) * (-943.995) [-941.246] (-943.561) (-941.283) -- 0:00:26
594000 -- (-941.948) (-942.227) (-944.922) [-940.706] * (-940.705) (-942.719) [-942.430] (-942.348) -- 0:00:26
594500 -- (-941.465) (-941.100) [-941.066] (-941.579) * (-943.014) [-942.432] (-941.913) (-945.527) -- 0:00:26
595000 -- [-941.742] (-945.937) (-942.831) (-941.367) * (-940.418) (-942.595) [-942.898] (-942.695) -- 0:00:26
Average standard deviation of split frequencies: 0.009837
595500 -- [-947.054] (-945.411) (-941.496) (-942.789) * (-941.532) (-948.312) [-944.295] (-945.346) -- 0:00:26
596000 -- (-942.607) (-941.211) (-942.708) [-944.757] * [-941.351] (-947.753) (-941.219) (-942.935) -- 0:00:26
596500 -- (-941.372) [-940.977] (-945.213) (-950.886) * (-941.739) (-941.124) (-941.102) [-941.976] -- 0:00:26
597000 -- (-942.407) (-941.058) [-940.500] (-944.636) * (-944.627) (-942.509) [-941.023] (-942.508) -- 0:00:26
597500 -- (-941.494) (-941.321) [-941.857] (-944.964) * (-947.920) [-942.265] (-942.498) (-942.421) -- 0:00:26
598000 -- (-942.373) (-946.871) [-943.543] (-941.999) * (-944.554) (-941.344) (-942.248) [-940.028] -- 0:00:26
598500 -- (-941.332) (-949.252) [-942.154] (-940.573) * (-940.997) (-941.389) (-940.752) [-941.891] -- 0:00:26
599000 -- [-941.336] (-940.491) (-946.355) (-940.580) * (-940.969) (-941.685) (-942.459) [-944.658] -- 0:00:26
599500 -- [-943.118] (-943.437) (-944.901) (-941.843) * (-940.027) [-940.793] (-941.751) (-941.934) -- 0:00:26
600000 -- (-941.998) (-942.787) [-944.145] (-946.459) * (-941.404) [-946.260] (-940.683) (-942.225) -- 0:00:25
Average standard deviation of split frequencies: 0.010569
600500 -- (-942.638) [-941.676] (-942.940) (-941.980) * [-941.590] (-940.123) (-940.241) (-940.886) -- 0:00:25
601000 -- [-941.514] (-940.606) (-944.849) (-941.964) * [-942.019] (-943.250) (-942.708) (-942.557) -- 0:00:25
601500 -- (-944.324) [-941.673] (-941.148) (-942.363) * [-941.536] (-943.280) (-940.430) (-947.352) -- 0:00:25
602000 -- (-942.929) [-940.565] (-940.976) (-941.406) * [-942.010] (-940.757) (-942.664) (-944.764) -- 0:00:25
602500 -- (-944.640) (-941.064) (-941.320) [-940.432] * (-944.166) [-942.207] (-940.841) (-941.913) -- 0:00:25
603000 -- (-940.084) (-943.151) [-940.656] (-941.808) * (-942.125) [-942.735] (-941.655) (-941.611) -- 0:00:25
603500 -- (-940.780) [-940.714] (-944.948) (-942.050) * (-942.466) (-940.330) [-940.622] (-945.876) -- 0:00:25
604000 -- (-943.330) (-945.819) [-941.115] (-940.563) * (-943.364) (-940.349) (-941.270) [-941.236] -- 0:00:25
604500 -- (-944.497) (-943.435) [-942.733] (-940.109) * (-941.020) (-945.599) (-941.654) [-941.053] -- 0:00:25
605000 -- [-944.774] (-942.864) (-942.119) (-941.264) * (-940.695) (-948.064) (-943.519) [-946.993] -- 0:00:25
Average standard deviation of split frequencies: 0.009853
605500 -- [-942.022] (-944.893) (-942.210) (-941.406) * (-942.820) (-941.380) (-943.807) [-944.489] -- 0:00:25
606000 -- [-941.475] (-943.207) (-945.996) (-940.697) * (-945.024) (-941.003) (-943.428) [-942.570] -- 0:00:25
606500 -- (-943.446) [-941.984] (-944.083) (-947.004) * (-942.737) (-941.103) [-944.267] (-941.942) -- 0:00:25
607000 -- (-947.241) (-941.436) (-945.437) [-944.416] * [-942.999] (-941.650) (-941.266) (-942.810) -- 0:00:25
607500 -- (-941.514) (-939.909) [-941.947] (-942.824) * (-941.155) (-942.022) [-940.390] (-945.568) -- 0:00:25
608000 -- (-944.139) [-941.961] (-942.089) (-943.097) * [-943.941] (-943.764) (-942.978) (-941.057) -- 0:00:25
608500 -- (-942.890) [-941.329] (-940.544) (-940.801) * (-942.868) (-945.014) [-942.216] (-941.530) -- 0:00:25
609000 -- [-940.954] (-943.538) (-940.522) (-940.617) * (-942.868) (-943.441) [-942.626] (-940.452) -- 0:00:25
609500 -- (-941.990) (-941.295) (-942.730) [-942.589] * (-945.126) (-940.860) (-940.886) [-941.699] -- 0:00:25
610000 -- [-941.990] (-945.815) (-946.470) (-941.838) * (-944.840) (-941.976) [-944.144] (-942.465) -- 0:00:25
Average standard deviation of split frequencies: 0.010035
610500 -- (-942.222) (-944.596) (-944.456) [-941.055] * (-943.784) [-943.424] (-940.372) (-944.024) -- 0:00:25
611000 -- (-941.404) (-943.971) [-941.834] (-941.313) * (-944.148) (-940.299) (-941.326) [-940.817] -- 0:00:25
611500 -- [-942.036] (-950.483) (-940.865) (-941.276) * (-940.785) (-940.259) [-941.832] (-941.451) -- 0:00:25
612000 -- (-942.073) [-943.760] (-941.151) (-943.592) * (-946.441) (-940.698) [-943.359] (-943.633) -- 0:00:25
612500 -- (-941.343) (-943.901) (-946.168) [-941.495] * (-941.524) (-940.675) (-942.282) [-940.930] -- 0:00:25
613000 -- (-942.970) [-941.804] (-945.876) (-940.905) * (-942.592) (-944.735) (-941.553) [-942.374] -- 0:00:25
613500 -- (-941.103) (-940.567) [-945.509] (-944.538) * (-940.352) (-943.169) [-941.383] (-942.091) -- 0:00:25
614000 -- (-940.809) [-940.664] (-943.407) (-943.090) * (-940.390) (-944.741) (-941.690) [-944.741] -- 0:00:25
614500 -- (-941.625) [-941.339] (-943.541) (-949.513) * (-940.192) (-944.231) (-942.583) [-940.457] -- 0:00:25
615000 -- [-943.860] (-941.366) (-942.941) (-943.572) * (-942.692) (-944.192) (-942.981) [-941.298] -- 0:00:25
Average standard deviation of split frequencies: 0.009999
615500 -- (-943.598) (-940.665) (-942.548) [-943.800] * (-942.186) [-943.593] (-941.206) (-943.303) -- 0:00:24
616000 -- (-941.965) (-942.580) (-946.896) [-944.067] * (-943.469) (-939.981) (-941.126) [-942.517] -- 0:00:24
616500 -- (-943.478) (-945.604) (-945.247) [-943.472] * (-941.624) (-940.949) (-941.272) [-942.889] -- 0:00:24
617000 -- (-941.751) [-946.237] (-942.052) (-942.109) * [-944.794] (-941.142) (-941.628) (-943.523) -- 0:00:24
617500 -- [-940.255] (-944.732) (-947.159) (-939.977) * (-940.961) [-942.205] (-945.312) (-939.916) -- 0:00:24
618000 -- (-942.041) (-946.467) (-940.709) [-941.469] * (-941.782) (-942.665) (-944.892) [-941.936] -- 0:00:24
618500 -- [-940.392] (-945.297) (-941.130) (-941.559) * [-943.861] (-940.310) (-947.906) (-944.215) -- 0:00:24
619000 -- (-942.628) (-943.557) (-941.436) [-943.733] * (-941.403) [-940.939] (-945.940) (-940.305) -- 0:00:24
619500 -- (-946.037) (-942.206) (-941.141) [-941.357] * (-941.031) [-940.675] (-946.160) (-941.471) -- 0:00:24
620000 -- (-945.824) (-942.603) [-942.547] (-942.200) * (-944.522) [-941.526] (-945.040) (-940.888) -- 0:00:24
Average standard deviation of split frequencies: 0.009519
620500 -- (-941.971) [-942.052] (-942.284) (-942.425) * (-940.682) [-942.705] (-942.625) (-942.241) -- 0:00:24
621000 -- (-943.716) (-944.025) (-943.508) [-941.827] * (-945.315) (-946.656) [-940.422] (-941.205) -- 0:00:24
621500 -- (-945.461) (-941.754) (-942.503) [-942.951] * [-941.120] (-942.941) (-941.393) (-941.700) -- 0:00:24
622000 -- (-946.418) [-941.298] (-941.843) (-944.383) * (-942.193) [-940.702] (-942.865) (-943.658) -- 0:00:24
622500 -- (-946.817) [-941.406] (-941.273) (-943.909) * (-942.364) [-940.871] (-941.622) (-945.166) -- 0:00:24
623000 -- (-942.560) [-942.487] (-943.013) (-941.224) * (-947.437) (-941.232) [-944.281] (-940.836) -- 0:00:24
623500 -- (-943.090) (-942.879) [-942.327] (-945.371) * (-942.183) (-942.066) [-943.772] (-940.700) -- 0:00:24
624000 -- (-943.827) (-940.286) [-941.897] (-943.627) * (-941.639) (-948.076) [-940.399] (-942.581) -- 0:00:24
624500 -- (-943.403) (-941.571) [-942.533] (-941.893) * [-941.628] (-943.879) (-946.213) (-942.901) -- 0:00:24
625000 -- (-941.380) (-942.253) [-941.310] (-942.396) * [-940.604] (-944.454) (-947.883) (-942.994) -- 0:00:24
Average standard deviation of split frequencies: 0.009539
625500 -- [-941.901] (-944.544) (-942.023) (-945.951) * (-947.231) (-943.712) [-942.185] (-942.652) -- 0:00:24
626000 -- (-941.207) (-943.229) [-940.651] (-942.573) * [-943.120] (-943.924) (-941.045) (-942.724) -- 0:00:24
626500 -- (-941.663) [-941.352] (-940.862) (-940.118) * (-942.031) [-942.368] (-941.068) (-940.723) -- 0:00:24
627000 -- (-942.282) [-940.385] (-940.335) (-943.953) * (-941.262) [-941.968] (-942.357) (-948.156) -- 0:00:24
627500 -- (-944.380) (-941.729) (-940.668) [-943.510] * (-941.102) (-941.555) [-941.573] (-942.838) -- 0:00:24
628000 -- (-940.518) [-940.525] (-942.860) (-943.277) * (-942.010) (-943.808) (-942.247) [-941.663] -- 0:00:24
628500 -- [-941.544] (-942.494) (-941.233) (-943.258) * (-941.668) (-942.585) [-942.802] (-942.651) -- 0:00:24
629000 -- [-943.184] (-944.912) (-942.026) (-942.309) * [-942.369] (-942.674) (-942.412) (-943.057) -- 0:00:24
629500 -- (-947.420) (-945.859) (-943.122) [-945.311] * (-944.403) (-941.828) [-942.123] (-940.523) -- 0:00:24
630000 -- (-946.668) (-941.899) [-942.143] (-942.135) * (-942.381) (-943.898) [-940.948] (-941.581) -- 0:00:24
Average standard deviation of split frequencies: 0.010116
630500 -- (-941.695) (-942.764) [-941.346] (-940.044) * (-941.576) (-945.095) [-943.701] (-944.109) -- 0:00:24
631000 -- [-940.729] (-942.719) (-942.531) (-941.063) * (-943.425) [-942.394] (-943.118) (-946.820) -- 0:00:23
631500 -- (-942.189) (-942.195) (-942.278) [-940.248] * (-941.029) (-941.293) [-940.815] (-942.248) -- 0:00:23
632000 -- (-942.421) [-941.242] (-943.777) (-941.354) * (-942.995) (-945.349) (-944.682) [-942.302] -- 0:00:23
632500 -- (-943.716) (-941.184) [-943.224] (-943.677) * (-944.540) [-941.427] (-942.716) (-941.747) -- 0:00:23
633000 -- [-940.990] (-940.664) (-945.281) (-942.420) * (-942.161) (-946.294) [-942.618] (-941.043) -- 0:00:23
633500 -- (-943.772) [-940.462] (-943.145) (-940.902) * [-944.014] (-952.693) (-945.040) (-942.195) -- 0:00:23
634000 -- (-945.732) [-943.679] (-941.714) (-941.100) * (-943.062) (-940.776) (-940.894) [-943.513] -- 0:00:23
634500 -- (-940.980) [-943.018] (-941.090) (-942.464) * (-940.391) (-942.636) (-943.690) [-943.308] -- 0:00:23
635000 -- (-941.435) (-941.513) (-941.217) [-940.433] * [-943.089] (-941.090) (-942.786) (-942.509) -- 0:00:23
Average standard deviation of split frequencies: 0.010772
635500 -- (-941.055) [-940.105] (-942.091) (-940.271) * (-940.611) (-943.724) [-942.478] (-941.146) -- 0:00:23
636000 -- (-944.473) (-940.423) [-945.379] (-940.256) * (-940.266) (-942.783) (-942.802) [-941.466] -- 0:00:23
636500 -- (-943.596) (-940.552) [-941.306] (-943.752) * [-941.964] (-949.292) (-940.580) (-942.792) -- 0:00:23
637000 -- (-943.546) [-941.898] (-942.009) (-943.461) * (-940.873) (-946.388) [-942.505] (-940.513) -- 0:00:23
637500 -- [-941.986] (-942.603) (-942.835) (-942.022) * [-942.484] (-940.747) (-940.213) (-941.792) -- 0:00:23
638000 -- [-940.668] (-941.965) (-944.293) (-940.767) * (-940.669) (-940.923) [-942.232] (-943.437) -- 0:00:23
638500 -- (-942.259) [-942.398] (-943.294) (-945.169) * (-940.993) (-940.987) [-940.768] (-943.981) -- 0:00:23
639000 -- (-943.266) [-943.414] (-942.471) (-941.303) * [-942.002] (-946.265) (-942.008) (-942.756) -- 0:00:23
639500 -- (-945.583) [-942.902] (-941.761) (-945.512) * (-946.088) (-943.478) [-944.732] (-941.868) -- 0:00:23
640000 -- (-941.178) (-944.588) [-940.520] (-945.149) * (-944.891) [-942.609] (-942.975) (-940.351) -- 0:00:23
Average standard deviation of split frequencies: 0.011037
640500 -- (-940.073) [-942.904] (-943.028) (-941.778) * [-942.498] (-943.696) (-943.626) (-942.288) -- 0:00:23
641000 -- (-941.003) [-942.024] (-944.363) (-942.021) * [-941.999] (-944.665) (-942.734) (-943.986) -- 0:00:23
641500 -- (-942.275) (-943.214) (-946.877) [-941.735] * (-943.066) [-944.064] (-944.108) (-941.086) -- 0:00:23
642000 -- (-941.198) (-944.335) [-941.179] (-940.196) * (-943.330) (-943.383) (-947.473) [-942.849] -- 0:00:23
642500 -- (-940.525) [-941.837] (-947.593) (-940.875) * [-942.453] (-940.292) (-940.300) (-940.350) -- 0:00:23
643000 -- (-940.712) (-943.214) (-941.044) [-941.200] * (-942.230) [-941.128] (-941.101) (-943.560) -- 0:00:23
643500 -- (-945.323) [-941.274] (-941.653) (-943.923) * [-940.020] (-941.539) (-943.479) (-943.490) -- 0:00:23
644000 -- (-942.288) (-940.232) (-941.842) [-944.540] * (-941.393) [-941.160] (-941.860) (-942.533) -- 0:00:23
644500 -- [-942.237] (-942.116) (-940.578) (-940.574) * (-942.419) (-943.022) [-942.705] (-943.859) -- 0:00:23
645000 -- (-944.522) (-943.907) (-943.439) [-944.841] * [-940.925] (-942.389) (-940.750) (-943.476) -- 0:00:23
Average standard deviation of split frequencies: 0.011174
645500 -- (-941.130) [-943.124] (-941.117) (-945.116) * [-940.649] (-941.283) (-941.379) (-942.600) -- 0:00:23
646000 -- (-941.065) (-941.537) (-942.815) [-941.980] * [-941.967] (-941.590) (-941.155) (-942.459) -- 0:00:23
646500 -- (-941.231) (-943.263) (-944.348) [-944.827] * [-941.068] (-944.319) (-948.379) (-940.306) -- 0:00:22
647000 -- (-941.264) (-941.716) (-941.660) [-940.910] * [-940.911] (-940.420) (-944.087) (-940.940) -- 0:00:22
647500 -- (-943.008) (-943.576) [-942.272] (-944.519) * [-942.777] (-943.165) (-944.985) (-947.489) -- 0:00:22
648000 -- (-942.764) (-940.893) (-942.780) [-941.389] * (-941.028) (-942.205) [-942.941] (-942.138) -- 0:00:22
648500 -- (-942.772) [-942.351] (-949.406) (-941.263) * (-942.562) [-941.515] (-944.003) (-946.177) -- 0:00:22
649000 -- (-943.521) [-941.788] (-944.352) (-943.477) * (-940.849) (-945.417) (-941.690) [-941.901] -- 0:00:22
649500 -- (-944.564) (-943.902) [-941.471] (-941.736) * (-941.080) (-942.943) (-941.766) [-941.224] -- 0:00:22
650000 -- (-940.967) (-944.614) [-942.348] (-942.988) * (-941.288) [-940.988] (-951.391) (-941.470) -- 0:00:22
Average standard deviation of split frequencies: 0.011366
650500 -- (-944.332) (-944.228) [-940.499] (-943.316) * [-942.021] (-941.727) (-947.521) (-940.504) -- 0:00:22
651000 -- (-942.998) (-940.991) (-941.464) [-941.149] * (-942.167) (-943.006) (-943.270) [-942.743] -- 0:00:22
651500 -- (-941.607) [-941.210] (-942.069) (-942.543) * [-942.051] (-946.824) (-941.734) (-948.503) -- 0:00:22
652000 -- (-942.428) (-942.393) [-943.476] (-948.689) * (-941.731) (-943.861) (-942.743) [-945.640] -- 0:00:22
652500 -- (-940.846) (-946.220) (-942.187) [-944.491] * [-940.774] (-943.934) (-942.134) (-942.621) -- 0:00:22
653000 -- (-941.189) (-944.607) (-942.617) [-941.638] * (-943.625) (-941.437) (-940.178) [-942.908] -- 0:00:22
653500 -- [-943.058] (-943.319) (-944.310) (-940.813) * (-944.345) [-940.556] (-941.934) (-940.644) -- 0:00:22
654000 -- [-941.769] (-941.259) (-945.308) (-940.317) * (-945.977) (-941.266) (-941.599) [-941.924] -- 0:00:22
654500 -- [-948.222] (-941.196) (-943.667) (-943.191) * (-942.451) [-940.436] (-942.218) (-941.227) -- 0:00:22
655000 -- (-944.065) (-942.205) [-943.926] (-940.380) * (-944.780) (-943.583) (-944.543) [-940.358] -- 0:00:22
Average standard deviation of split frequencies: 0.010875
655500 -- [-941.253] (-941.403) (-941.985) (-946.262) * (-943.485) [-941.222] (-941.644) (-941.838) -- 0:00:22
656000 -- (-940.338) [-946.213] (-941.856) (-941.602) * (-941.375) (-950.778) (-940.549) [-940.678] -- 0:00:22
656500 -- (-943.141) [-945.248] (-943.801) (-941.211) * (-943.318) (-944.473) (-944.435) [-941.643] -- 0:00:22
657000 -- (-946.204) (-941.563) (-943.092) [-944.388] * (-942.535) (-941.428) [-944.220] (-944.083) -- 0:00:22
657500 -- (-945.747) [-941.822] (-941.630) (-945.745) * [-942.338] (-941.901) (-941.368) (-941.641) -- 0:00:22
658000 -- (-942.204) (-944.113) (-940.420) [-945.057] * (-943.426) [-942.819] (-942.883) (-943.101) -- 0:00:22
658500 -- [-941.611] (-941.992) (-940.683) (-943.685) * (-940.376) [-941.312] (-941.879) (-943.287) -- 0:00:22
659000 -- (-941.995) (-942.250) (-942.324) [-945.106] * (-941.668) [-941.871] (-942.155) (-944.799) -- 0:00:22
659500 -- [-941.511] (-943.542) (-944.120) (-944.206) * (-942.757) (-941.051) [-941.589] (-941.549) -- 0:00:22
660000 -- (-942.667) (-942.670) [-946.791] (-946.021) * [-943.686] (-941.320) (-942.592) (-943.245) -- 0:00:22
Average standard deviation of split frequencies: 0.010132
660500 -- (-942.834) (-944.547) [-942.275] (-942.395) * (-945.600) [-940.519] (-942.973) (-943.287) -- 0:00:22
661000 -- (-943.612) (-945.192) (-942.000) [-942.967] * (-941.003) (-944.956) (-945.998) [-942.677] -- 0:00:22
661500 -- (-944.794) (-944.783) (-944.851) [-941.654] * (-940.336) (-943.631) (-943.542) [-942.423] -- 0:00:22
662000 -- (-941.442) [-942.079] (-944.792) (-943.367) * (-940.781) (-940.798) [-941.109] (-944.615) -- 0:00:21
662500 -- [-942.777] (-941.400) (-945.183) (-942.839) * (-946.843) (-941.233) (-941.664) [-942.530] -- 0:00:21
663000 -- (-947.210) (-942.713) [-942.740] (-942.907) * (-943.387) (-941.703) [-941.531] (-943.405) -- 0:00:21
663500 -- (-948.217) (-945.231) [-940.698] (-941.416) * (-941.830) (-940.961) [-940.975] (-942.633) -- 0:00:21
664000 -- (-941.692) (-942.962) (-942.464) [-940.818] * (-943.959) [-941.897] (-943.465) (-943.127) -- 0:00:21
664500 -- (-941.981) (-951.942) (-940.373) [-941.779] * (-943.947) (-940.750) [-942.335] (-942.508) -- 0:00:21
665000 -- (-941.456) [-943.282] (-940.915) (-941.336) * (-942.241) (-941.166) (-942.664) [-942.480] -- 0:00:21
Average standard deviation of split frequencies: 0.010883
665500 -- (-942.826) (-944.334) [-940.850] (-942.001) * (-943.746) (-940.682) [-942.417] (-942.089) -- 0:00:21
666000 -- (-943.141) (-940.923) [-943.814] (-943.123) * (-944.724) (-940.053) (-942.595) [-940.795] -- 0:00:21
666500 -- (-942.892) [-940.515] (-941.369) (-944.911) * (-943.828) (-940.772) [-943.224] (-942.071) -- 0:00:21
667000 -- (-943.667) (-940.370) (-940.343) [-941.441] * (-943.092) (-940.744) [-940.313] (-941.959) -- 0:00:21
667500 -- (-940.425) [-941.846] (-941.995) (-944.771) * [-943.354] (-943.164) (-944.764) (-944.461) -- 0:00:21
668000 -- (-940.743) [-941.393] (-943.220) (-941.894) * (-942.412) (-942.602) (-948.096) [-940.688] -- 0:00:21
668500 -- (-940.662) (-940.660) (-945.432) [-942.084] * (-944.120) (-943.752) [-941.436] (-941.429) -- 0:00:21
669000 -- (-942.790) (-946.750) [-942.559] (-942.271) * (-948.900) [-941.942] (-941.859) (-942.123) -- 0:00:21
669500 -- (-943.154) (-946.073) [-941.034] (-943.361) * (-946.089) [-940.357] (-940.088) (-944.952) -- 0:00:21
670000 -- [-940.444] (-942.950) (-941.487) (-941.496) * (-945.525) (-941.896) [-941.821] (-941.379) -- 0:00:21
Average standard deviation of split frequencies: 0.010918
670500 -- (-942.902) (-942.497) [-942.096] (-942.733) * (-940.868) (-942.100) [-942.516] (-941.030) -- 0:00:21
671000 -- (-940.300) (-942.536) (-940.843) [-942.378] * [-940.613] (-942.712) (-942.168) (-943.747) -- 0:00:21
671500 -- (-941.090) (-944.986) [-940.441] (-946.115) * (-943.385) (-940.574) [-944.725] (-942.210) -- 0:00:21
672000 -- (-940.550) (-942.818) [-941.111] (-942.651) * [-945.911] (-940.170) (-941.571) (-941.429) -- 0:00:21
672500 -- (-940.894) (-943.602) (-943.608) [-942.899] * (-945.567) (-940.866) [-941.591] (-939.897) -- 0:00:21
673000 -- (-942.013) [-941.505] (-943.233) (-945.553) * [-942.971] (-940.653) (-943.430) (-940.982) -- 0:00:21
673500 -- [-942.561] (-946.832) (-941.358) (-941.923) * (-942.539) (-941.509) [-942.237] (-940.834) -- 0:00:21
674000 -- (-942.576) (-947.140) (-943.488) [-943.982] * (-944.937) (-943.774) (-943.379) [-944.410] -- 0:00:21
674500 -- (-942.960) [-941.382] (-941.280) (-942.148) * (-940.935) [-942.170] (-940.440) (-940.832) -- 0:00:21
675000 -- (-947.418) (-952.069) [-940.478] (-942.314) * [-941.040] (-940.602) (-945.403) (-942.615) -- 0:00:21
Average standard deviation of split frequencies: 0.010739
675500 -- (-945.452) [-942.108] (-940.069) (-942.119) * (-942.250) [-941.163] (-944.526) (-947.692) -- 0:00:21
676000 -- [-940.610] (-941.078) (-941.320) (-942.617) * (-941.635) [-942.483] (-942.231) (-942.125) -- 0:00:21
676500 -- (-943.629) [-940.716] (-941.905) (-943.678) * [-941.212] (-941.682) (-941.217) (-944.123) -- 0:00:21
677000 -- (-943.657) (-940.186) [-940.123] (-942.911) * (-941.823) (-941.185) [-940.706] (-941.977) -- 0:00:20
677500 -- (-946.339) [-941.462] (-942.901) (-942.244) * (-943.464) (-941.862) [-940.988] (-946.216) -- 0:00:20
678000 -- (-943.788) [-940.815] (-942.047) (-948.914) * (-945.519) (-941.179) (-941.573) [-940.581] -- 0:00:20
678500 -- [-941.077] (-949.114) (-941.793) (-944.698) * (-942.226) (-945.738) [-940.804] (-942.207) -- 0:00:20
679000 -- (-940.963) (-940.974) [-940.681] (-940.598) * (-944.482) (-942.333) (-945.238) [-942.087] -- 0:00:20
679500 -- (-940.746) [-941.177] (-941.699) (-943.703) * (-945.619) (-940.842) [-943.107] (-941.671) -- 0:00:20
680000 -- (-943.126) [-944.681] (-942.315) (-941.372) * [-944.696] (-945.077) (-943.702) (-944.910) -- 0:00:20
Average standard deviation of split frequencies: 0.010712
680500 -- (-946.194) (-944.173) [-942.899] (-940.645) * (-943.440) (-942.637) [-944.470] (-942.786) -- 0:00:20
681000 -- (-949.289) (-943.344) [-942.674] (-945.320) * (-941.489) (-942.488) (-944.713) [-944.400] -- 0:00:20
681500 -- [-944.227] (-947.070) (-944.035) (-944.479) * (-943.993) [-941.235] (-946.632) (-943.671) -- 0:00:20
682000 -- (-942.572) (-943.607) [-944.409] (-943.497) * (-942.952) (-942.714) [-942.185] (-942.010) -- 0:00:20
682500 -- (-941.408) (-943.743) [-941.962] (-940.687) * (-946.499) [-942.521] (-943.188) (-941.590) -- 0:00:20
683000 -- (-942.396) (-942.217) [-943.094] (-941.122) * (-940.590) (-941.938) (-946.595) [-941.616] -- 0:00:20
683500 -- (-941.883) (-941.231) [-943.014] (-940.161) * [-946.501] (-942.137) (-945.317) (-941.553) -- 0:00:20
684000 -- (-943.696) (-941.860) (-943.504) [-940.205] * (-941.312) (-942.237) (-946.459) [-943.025] -- 0:00:20
684500 -- (-941.999) [-941.733] (-944.229) (-940.949) * (-941.771) [-942.553] (-941.960) (-940.233) -- 0:00:20
685000 -- (-949.581) [-942.019] (-941.188) (-941.630) * (-942.085) [-943.893] (-943.693) (-941.890) -- 0:00:20
Average standard deviation of split frequencies: 0.011316
685500 -- (-949.063) (-941.777) [-942.632] (-941.787) * [-945.194] (-944.867) (-941.631) (-944.010) -- 0:00:20
686000 -- (-946.798) [-942.948] (-942.745) (-940.949) * (-942.816) (-942.590) (-943.187) [-942.063] -- 0:00:20
686500 -- [-942.247] (-942.140) (-944.059) (-942.794) * (-943.963) (-943.472) [-943.606] (-942.069) -- 0:00:20
687000 -- (-941.043) [-941.885] (-941.610) (-942.368) * (-942.478) (-942.508) [-945.265] (-945.390) -- 0:00:20
687500 -- (-943.261) (-940.968) [-944.724] (-943.293) * (-944.198) (-941.998) (-948.843) [-946.157] -- 0:00:20
688000 -- (-941.447) (-942.021) [-940.122] (-944.255) * (-942.483) (-941.293) (-946.485) [-943.278] -- 0:00:20
688500 -- (-946.178) (-943.027) (-941.306) [-943.026] * (-944.945) (-940.504) [-940.993] (-941.066) -- 0:00:20
689000 -- (-945.944) [-942.624] (-943.025) (-941.135) * (-945.891) (-941.051) (-940.419) [-940.635] -- 0:00:20
689500 -- (-941.145) (-942.857) [-942.141] (-942.606) * (-942.013) (-940.400) (-940.054) [-943.848] -- 0:00:20
690000 -- (-941.645) (-941.922) (-940.582) [-943.774] * (-941.647) (-941.835) [-940.528] (-941.184) -- 0:00:20
Average standard deviation of split frequencies: 0.011467
690500 -- (-943.785) (-941.093) [-944.853] (-944.450) * (-939.981) (-941.011) (-944.271) [-946.209] -- 0:00:20
691000 -- (-942.837) [-940.767] (-940.266) (-942.942) * (-942.334) (-941.008) [-942.748] (-941.140) -- 0:00:20
691500 -- (-946.585) [-941.157] (-942.985) (-942.491) * (-944.066) [-943.129] (-941.681) (-942.284) -- 0:00:20
692000 -- (-942.057) (-941.667) [-943.993] (-942.061) * (-943.731) (-943.943) (-943.808) [-940.999] -- 0:00:20
692500 -- (-942.927) [-944.415] (-942.612) (-941.903) * (-942.528) [-942.441] (-943.037) (-945.718) -- 0:00:19
693000 -- [-941.018] (-942.600) (-943.770) (-941.188) * (-942.379) (-945.766) [-943.084] (-942.147) -- 0:00:19
693500 -- (-940.491) (-946.186) [-940.948] (-943.074) * [-944.769] (-945.353) (-943.096) (-944.451) -- 0:00:19
694000 -- (-942.865) (-942.711) (-941.270) [-941.128] * (-940.696) (-948.147) (-943.333) [-940.368] -- 0:00:19
694500 -- (-941.819) (-941.692) (-941.863) [-940.255] * [-942.906] (-940.456) (-941.372) (-941.567) -- 0:00:19
695000 -- (-944.520) (-940.966) [-944.261] (-941.525) * (-941.038) (-943.554) [-940.259] (-947.841) -- 0:00:19
Average standard deviation of split frequencies: 0.010964
695500 -- (-944.738) (-941.894) (-941.396) [-943.502] * (-944.683) [-942.261] (-941.436) (-943.613) -- 0:00:19
696000 -- [-940.855] (-944.249) (-943.347) (-943.476) * (-946.656) [-942.672] (-941.488) (-941.132) -- 0:00:19
696500 -- (-943.238) (-943.175) [-940.727] (-941.836) * (-943.639) (-942.137) (-941.403) [-944.905] -- 0:00:19
697000 -- (-945.369) [-941.143] (-945.301) (-940.725) * (-944.021) [-940.909] (-946.861) (-945.262) -- 0:00:19
697500 -- [-941.119] (-940.173) (-945.632) (-940.761) * [-942.143] (-941.131) (-942.752) (-942.422) -- 0:00:19
698000 -- (-942.065) (-942.253) (-945.279) [-943.744] * [-942.012] (-942.594) (-941.904) (-941.248) -- 0:00:19
698500 -- (-944.149) [-943.011] (-946.355) (-943.541) * (-946.833) (-940.822) (-941.738) [-940.711] -- 0:00:19
699000 -- (-942.298) (-946.634) [-941.525] (-944.035) * (-944.637) (-940.548) [-943.189] (-944.041) -- 0:00:19
699500 -- (-941.840) (-946.196) [-940.355] (-944.828) * [-942.030] (-942.282) (-942.794) (-942.131) -- 0:00:19
700000 -- (-941.025) [-941.145] (-942.389) (-942.131) * (-940.613) (-944.342) [-941.358] (-943.052) -- 0:00:19
Average standard deviation of split frequencies: 0.011527
700500 -- [-941.635] (-941.079) (-940.553) (-941.484) * (-945.298) (-942.379) [-941.043] (-942.923) -- 0:00:19
701000 -- [-942.671] (-943.028) (-940.356) (-944.492) * (-944.267) [-942.046] (-942.148) (-941.766) -- 0:00:19
701500 -- (-942.315) [-942.724] (-940.735) (-941.940) * (-941.786) [-939.934] (-944.109) (-943.113) -- 0:00:19
702000 -- [-941.109] (-942.253) (-947.163) (-941.725) * (-941.039) (-942.210) (-943.354) [-945.558] -- 0:00:19
702500 -- (-943.771) [-942.871] (-943.103) (-941.872) * (-941.118) [-941.131] (-942.130) (-940.791) -- 0:00:19
703000 -- (-944.571) (-942.477) (-941.807) [-942.333] * [-944.005] (-943.410) (-943.305) (-940.940) -- 0:00:19
703500 -- (-946.865) (-944.432) (-942.934) [-942.203] * (-944.186) (-941.842) (-943.456) [-940.266] -- 0:00:19
704000 -- (-943.585) [-942.262] (-943.329) (-944.465) * (-943.369) (-945.489) [-944.010] (-940.321) -- 0:00:19
704500 -- (-945.647) (-941.960) (-940.406) [-941.516] * [-942.489] (-942.454) (-943.210) (-942.248) -- 0:00:19
705000 -- (-943.284) (-941.517) [-946.401] (-943.561) * [-941.129] (-941.634) (-940.442) (-944.544) -- 0:00:19
Average standard deviation of split frequencies: 0.011476
705500 -- (-942.180) [-940.543] (-947.909) (-945.168) * (-941.197) (-941.962) [-945.341] (-944.853) -- 0:00:19
706000 -- [-940.368] (-950.995) (-945.411) (-941.000) * (-940.426) (-941.489) [-943.344] (-942.093) -- 0:00:19
706500 -- (-942.225) (-944.080) [-940.383] (-942.518) * (-940.686) (-945.730) (-940.823) [-944.465] -- 0:00:19
707000 -- (-940.769) [-941.656] (-944.199) (-942.281) * (-944.469) (-943.256) [-941.816] (-942.400) -- 0:00:19
707500 -- (-940.725) (-941.637) [-941.157] (-943.360) * (-941.264) (-942.182) (-940.957) [-941.019] -- 0:00:19
708000 -- (-942.811) [-942.754] (-940.286) (-941.902) * (-940.954) (-945.355) [-940.756] (-942.028) -- 0:00:18
708500 -- (-944.193) [-943.317] (-940.909) (-941.949) * [-943.200] (-941.746) (-943.062) (-945.332) -- 0:00:18
709000 -- [-941.128] (-941.233) (-944.509) (-942.084) * (-945.240) [-942.790] (-946.461) (-941.892) -- 0:00:18
709500 -- (-943.455) (-943.681) [-941.705] (-942.683) * (-947.972) (-942.992) [-944.771] (-941.166) -- 0:00:18
710000 -- (-943.342) [-941.502] (-946.408) (-943.028) * (-945.107) [-940.138] (-942.477) (-940.690) -- 0:00:18
Average standard deviation of split frequencies: 0.011816
710500 -- (-941.427) (-940.189) [-944.972] (-942.123) * (-945.642) (-943.966) (-942.798) [-943.347] -- 0:00:18
711000 -- (-943.284) [-943.494] (-943.092) (-942.617) * [-943.933] (-942.251) (-942.315) (-946.799) -- 0:00:18
711500 -- (-947.162) (-942.666) (-944.198) [-941.528] * (-944.008) [-941.007] (-942.161) (-946.124) -- 0:00:18
712000 -- (-942.381) [-943.548] (-941.406) (-940.928) * (-944.160) (-942.233) [-940.073] (-944.618) -- 0:00:18
712500 -- (-942.757) (-941.291) (-942.901) [-941.002] * (-941.799) (-945.449) [-940.483] (-944.486) -- 0:00:18
713000 -- (-941.152) [-940.563] (-942.990) (-942.370) * (-940.432) (-940.282) [-945.338] (-946.211) -- 0:00:18
713500 -- (-940.918) [-941.881] (-946.061) (-943.498) * (-941.372) (-941.647) [-943.473] (-944.660) -- 0:00:18
714000 -- (-940.065) [-943.315] (-943.212) (-943.303) * [-941.061] (-941.599) (-942.590) (-946.819) -- 0:00:18
714500 -- (-941.235) (-942.625) (-941.666) [-944.125] * (-940.871) (-942.033) (-941.282) [-943.898] -- 0:00:18
715000 -- [-942.238] (-941.879) (-943.700) (-944.547) * (-941.292) (-942.350) [-943.100] (-947.527) -- 0:00:18
Average standard deviation of split frequencies: 0.011316
715500 -- (-942.302) (-940.700) (-945.405) [-944.683] * [-941.745] (-942.976) (-946.536) (-941.943) -- 0:00:18
716000 -- (-940.173) (-940.172) (-947.608) [-942.558] * (-940.864) (-941.071) (-942.925) [-946.237] -- 0:00:18
716500 -- [-940.880] (-942.551) (-947.502) (-944.703) * (-943.432) [-940.780] (-942.015) (-946.132) -- 0:00:18
717000 -- (-940.475) (-941.790) [-944.225] (-944.001) * (-942.269) (-940.245) [-942.671] (-944.330) -- 0:00:18
717500 -- [-940.450] (-940.254) (-941.752) (-946.172) * [-943.080] (-940.421) (-942.680) (-943.548) -- 0:00:18
718000 -- (-942.607) (-941.086) [-942.338] (-941.631) * (-941.574) (-940.604) [-943.700] (-942.934) -- 0:00:18
718500 -- (-944.892) (-941.111) (-942.191) [-942.489] * [-942.721] (-941.097) (-948.586) (-942.478) -- 0:00:18
719000 -- (-947.286) (-941.211) [-944.495] (-941.091) * (-944.299) (-945.445) (-944.212) [-941.863] -- 0:00:18
719500 -- (-942.965) (-942.762) [-941.823] (-941.937) * (-942.847) (-942.763) [-941.765] (-941.648) -- 0:00:18
720000 -- (-942.488) (-944.451) [-945.041] (-942.899) * (-941.437) (-948.223) [-944.130] (-941.616) -- 0:00:18
Average standard deviation of split frequencies: 0.010670
720500 -- (-940.897) [-941.800] (-942.028) (-944.278) * (-940.518) (-942.825) [-942.214] (-943.344) -- 0:00:18
721000 -- (-941.563) (-940.458) (-941.528) [-942.374] * (-940.398) (-940.434) [-941.476] (-941.090) -- 0:00:18
721500 -- (-941.655) (-941.409) [-943.393] (-941.987) * (-942.382) (-941.923) [-941.841] (-942.544) -- 0:00:18
722000 -- (-942.004) (-940.688) [-941.387] (-942.142) * (-943.319) (-940.442) [-942.087] (-941.960) -- 0:00:18
722500 -- (-944.344) [-943.820] (-941.852) (-942.115) * (-940.999) (-940.797) (-941.512) [-941.286] -- 0:00:18
723000 -- (-944.770) (-942.140) [-940.280] (-942.011) * (-942.165) (-941.394) [-944.438] (-941.160) -- 0:00:18
723500 -- (-941.197) (-943.757) (-941.197) [-944.468] * [-942.131] (-941.102) (-945.024) (-941.333) -- 0:00:17
724000 -- [-941.797] (-946.580) (-940.421) (-946.112) * (-943.600) (-940.486) (-945.585) [-945.561] -- 0:00:17
724500 -- (-943.607) [-948.112] (-941.608) (-940.257) * (-945.358) (-941.625) (-942.375) [-945.939] -- 0:00:17
725000 -- (-946.541) [-944.583] (-946.245) (-940.827) * (-945.207) (-940.979) [-940.569] (-943.506) -- 0:00:17
Average standard deviation of split frequencies: 0.011497
725500 -- [-941.213] (-942.705) (-943.372) (-943.770) * [-946.753] (-941.244) (-941.176) (-945.189) -- 0:00:17
726000 -- (-942.194) (-941.771) [-942.374] (-943.545) * [-943.550] (-942.958) (-942.042) (-943.684) -- 0:00:17
726500 -- (-942.399) (-942.226) (-947.357) [-940.747] * (-942.763) [-942.132] (-942.457) (-944.699) -- 0:00:17
727000 -- (-942.076) (-942.419) (-944.790) [-941.861] * (-945.952) (-940.998) (-942.174) [-940.196] -- 0:00:17
727500 -- [-943.071] (-942.508) (-941.920) (-944.943) * (-945.121) (-943.023) (-944.959) [-940.186] -- 0:00:17
728000 -- [-942.590] (-943.748) (-941.394) (-942.308) * (-943.397) (-941.305) [-945.093] (-940.189) -- 0:00:17
728500 -- (-941.713) (-940.819) (-942.938) [-942.854] * (-944.442) (-941.569) (-946.909) [-940.749] -- 0:00:17
729000 -- [-940.339] (-940.200) (-941.569) (-944.161) * (-941.241) (-942.465) (-942.936) [-942.728] -- 0:00:17
729500 -- [-941.689] (-945.131) (-945.763) (-940.844) * [-940.759] (-940.347) (-942.285) (-942.230) -- 0:00:17
730000 -- (-941.871) [-942.612] (-944.094) (-941.591) * [-941.275] (-940.210) (-941.662) (-943.838) -- 0:00:17
Average standard deviation of split frequencies: 0.012299
730500 -- (-944.729) [-942.163] (-940.611) (-941.221) * (-941.248) (-942.451) [-940.247] (-943.530) -- 0:00:17
731000 -- (-949.670) (-940.958) [-940.295] (-941.762) * [-941.833] (-942.947) (-940.706) (-942.527) -- 0:00:17
731500 -- [-941.337] (-945.515) (-941.590) (-942.779) * (-946.021) [-943.029] (-940.565) (-942.250) -- 0:00:17
732000 -- (-944.040) [-940.578] (-940.831) (-942.378) * (-940.971) (-942.353) [-942.628] (-943.481) -- 0:00:17
732500 -- (-940.519) [-940.544] (-943.559) (-942.709) * (-943.379) [-943.856] (-942.990) (-941.709) -- 0:00:17
733000 -- [-941.891] (-940.393) (-940.553) (-940.411) * (-942.950) [-942.586] (-944.267) (-944.177) -- 0:00:17
733500 -- (-944.258) (-942.970) [-940.652] (-942.495) * (-942.943) (-942.709) (-943.341) [-941.040] -- 0:00:17
734000 -- [-945.186] (-942.090) (-940.322) (-940.404) * (-942.859) [-942.050] (-944.607) (-941.393) -- 0:00:17
734500 -- (-943.676) (-948.892) (-943.240) [-941.076] * [-944.754] (-941.238) (-945.545) (-942.550) -- 0:00:17
735000 -- (-946.821) (-941.449) [-943.008] (-941.465) * (-942.729) (-941.866) [-940.539] (-942.195) -- 0:00:17
Average standard deviation of split frequencies: 0.012410
735500 -- (-940.536) [-942.504] (-941.508) (-942.897) * [-942.918] (-942.163) (-941.742) (-940.677) -- 0:00:17
736000 -- [-941.576] (-944.022) (-940.784) (-943.170) * [-939.915] (-940.972) (-945.065) (-940.832) -- 0:00:17
736500 -- (-941.523) [-945.248] (-941.077) (-944.732) * [-941.623] (-943.646) (-942.031) (-942.641) -- 0:00:17
737000 -- [-941.785] (-941.495) (-941.538) (-947.690) * (-942.529) (-941.215) (-940.386) [-942.844] -- 0:00:17
737500 -- [-942.152] (-943.373) (-943.473) (-945.825) * (-946.143) (-943.018) [-940.022] (-947.313) -- 0:00:17
738000 -- (-941.586) [-942.883] (-944.587) (-943.421) * (-944.902) (-942.467) (-941.470) [-941.920] -- 0:00:17
738500 -- (-941.381) [-941.605] (-941.603) (-941.330) * [-944.621] (-940.191) (-941.063) (-941.175) -- 0:00:16
739000 -- (-941.736) (-943.864) (-941.682) [-940.748] * (-944.778) [-940.495] (-942.099) (-943.802) -- 0:00:16
739500 -- (-941.350) (-946.468) (-945.280) [-943.155] * [-942.275] (-940.612) (-940.209) (-941.091) -- 0:00:16
740000 -- (-941.022) (-942.773) (-946.991) [-941.700] * (-941.112) [-941.406] (-940.103) (-940.211) -- 0:00:16
Average standard deviation of split frequencies: 0.012093
740500 -- (-940.310) [-942.297] (-942.926) (-943.666) * [-940.851] (-941.618) (-941.018) (-946.824) -- 0:00:16
741000 -- (-940.141) (-943.695) [-943.741] (-944.266) * (-943.016) (-941.032) [-940.425] (-946.284) -- 0:00:16
741500 -- [-940.250] (-944.885) (-944.481) (-942.882) * [-943.401] (-942.907) (-940.075) (-940.169) -- 0:00:16
742000 -- [-940.452] (-941.026) (-942.726) (-940.496) * (-942.314) [-940.826] (-939.989) (-940.807) -- 0:00:16
742500 -- (-940.717) [-940.493] (-945.314) (-941.065) * (-945.777) [-943.196] (-940.666) (-942.030) -- 0:00:16
743000 -- [-942.036] (-940.719) (-947.010) (-941.503) * [-942.468] (-944.329) (-941.509) (-940.560) -- 0:00:16
743500 -- (-942.261) (-940.909) [-941.959] (-942.675) * (-941.464) [-940.524] (-941.718) (-940.528) -- 0:00:16
744000 -- (-943.966) (-944.150) [-941.852] (-942.971) * (-943.244) (-944.237) [-941.541] (-943.998) -- 0:00:16
744500 -- [-940.034] (-943.314) (-943.950) (-943.599) * (-944.155) [-941.485] (-942.314) (-942.501) -- 0:00:16
745000 -- (-945.059) [-941.717] (-940.605) (-942.241) * (-948.535) [-941.531] (-941.626) (-942.313) -- 0:00:16
Average standard deviation of split frequencies: 0.012155
745500 -- [-945.003] (-943.407) (-940.497) (-942.801) * (-940.916) (-941.468) (-940.802) [-940.945] -- 0:00:16
746000 -- (-944.501) (-941.674) [-944.033] (-942.829) * [-940.932] (-942.799) (-945.503) (-942.018) -- 0:00:16
746500 -- (-951.249) (-940.967) (-943.495) [-941.686] * (-943.847) (-940.508) (-944.823) [-941.415] -- 0:00:16
747000 -- (-940.243) (-943.076) (-941.660) [-941.652] * (-942.174) (-941.698) [-941.802] (-942.656) -- 0:00:16
747500 -- (-941.654) (-942.420) [-941.542] (-941.588) * (-942.169) (-941.509) [-941.494] (-940.899) -- 0:00:16
748000 -- (-947.522) (-941.869) [-941.628] (-945.000) * (-941.254) [-942.595] (-946.708) (-942.791) -- 0:00:16
748500 -- (-944.877) (-943.119) [-941.856] (-946.056) * (-942.376) (-944.554) (-941.967) [-942.139] -- 0:00:16
749000 -- (-941.115) [-942.123] (-940.705) (-946.340) * (-940.932) (-945.453) [-940.665] (-945.729) -- 0:00:16
749500 -- (-940.459) (-941.550) (-941.518) [-942.721] * (-942.010) (-940.743) (-941.630) [-944.602] -- 0:00:16
750000 -- (-940.493) (-940.638) [-940.342] (-942.710) * (-945.528) [-940.950] (-940.733) (-941.667) -- 0:00:16
Average standard deviation of split frequencies: 0.012006
750500 -- (-944.459) (-941.507) (-943.812) [-942.862] * (-942.602) [-941.495] (-943.378) (-945.804) -- 0:00:16
751000 -- (-941.438) [-941.780] (-942.691) (-942.034) * (-941.435) (-941.302) [-942.318] (-942.531) -- 0:00:16
751500 -- [-942.184] (-945.409) (-942.908) (-941.563) * (-942.556) (-940.149) [-945.145] (-941.703) -- 0:00:16
752000 -- [-942.216] (-948.548) (-944.531) (-945.157) * (-942.306) (-940.831) (-940.913) [-943.522] -- 0:00:16
752500 -- [-941.793] (-941.067) (-944.254) (-941.826) * [-941.567] (-941.950) (-940.709) (-942.236) -- 0:00:16
753000 -- (-941.699) (-941.379) (-943.846) [-946.251] * (-946.197) (-943.643) [-942.019] (-943.286) -- 0:00:16
753500 -- (-943.813) (-942.813) (-942.943) [-942.340] * [-940.689] (-941.339) (-944.019) (-943.861) -- 0:00:16
754000 -- (-942.548) [-943.236] (-941.259) (-943.074) * (-940.951) [-940.716] (-943.200) (-942.370) -- 0:00:15
754500 -- (-944.558) (-941.255) [-941.201] (-942.571) * [-940.530] (-941.347) (-944.339) (-946.936) -- 0:00:15
755000 -- (-942.701) (-941.526) [-944.481] (-941.043) * (-941.531) [-942.034] (-943.446) (-941.367) -- 0:00:15
Average standard deviation of split frequencies: 0.011774
755500 -- (-941.113) (-943.550) (-945.229) [-946.412] * (-941.236) (-941.769) (-944.014) [-941.508] -- 0:00:15
756000 -- (-942.198) (-941.224) (-943.581) [-941.609] * (-942.111) [-942.154] (-940.659) (-943.059) -- 0:00:15
756500 -- (-942.525) (-940.182) (-943.932) [-941.640] * [-940.935] (-942.216) (-941.538) (-940.407) -- 0:00:15
757000 -- (-945.311) (-940.481) [-946.603] (-940.395) * (-941.430) (-940.942) (-943.362) [-941.423] -- 0:00:15
757500 -- (-942.104) [-940.310] (-942.357) (-945.323) * (-940.695) [-941.639] (-942.914) (-942.131) -- 0:00:15
758000 -- (-942.134) [-941.278] (-941.508) (-942.160) * [-941.887] (-944.055) (-940.381) (-942.809) -- 0:00:15
758500 -- (-944.244) [-941.725] (-943.477) (-943.277) * (-944.893) (-940.261) [-941.931] (-942.100) -- 0:00:15
759000 -- [-941.456] (-944.478) (-942.426) (-944.815) * (-948.232) (-940.450) [-943.465] (-943.163) -- 0:00:15
759500 -- (-942.824) (-940.216) (-941.926) [-943.337] * (-940.527) [-942.865] (-942.103) (-942.310) -- 0:00:15
760000 -- (-943.542) (-940.741) [-940.259] (-940.826) * (-940.799) [-941.330] (-942.490) (-951.828) -- 0:00:15
Average standard deviation of split frequencies: 0.012162
760500 -- (-945.856) (-941.115) (-946.343) [-940.826] * [-940.690] (-943.382) (-941.783) (-943.948) -- 0:00:15
761000 -- (-944.714) (-940.825) [-940.821] (-940.582) * (-941.832) (-943.264) (-942.465) [-942.044] -- 0:00:15
761500 -- (-942.189) [-941.188] (-943.835) (-940.622) * (-942.140) (-942.944) [-940.428] (-940.377) -- 0:00:15
762000 -- (-941.196) (-943.351) (-945.002) [-941.492] * [-942.585] (-946.824) (-941.472) (-940.747) -- 0:00:15
762500 -- (-941.833) (-941.820) (-942.315) [-941.589] * (-941.691) (-942.611) [-940.557] (-940.303) -- 0:00:15
763000 -- (-942.263) (-944.901) [-943.605] (-941.008) * (-941.004) (-943.536) (-941.210) [-940.667] -- 0:00:15
763500 -- (-942.139) (-942.848) [-945.545] (-941.529) * (-941.498) (-940.438) (-945.522) [-940.870] -- 0:00:15
764000 -- (-941.594) [-942.812] (-943.899) (-942.458) * (-943.326) [-939.944] (-941.975) (-940.425) -- 0:00:15
764500 -- [-941.440] (-943.456) (-942.053) (-940.177) * (-943.466) (-942.936) (-943.063) [-942.612] -- 0:00:15
765000 -- [-944.344] (-944.052) (-941.100) (-941.352) * (-943.298) [-943.547] (-944.373) (-942.631) -- 0:00:15
Average standard deviation of split frequencies: 0.011657
765500 -- (-944.462) (-942.789) [-944.500] (-940.811) * (-942.739) [-942.866] (-943.204) (-943.659) -- 0:00:15
766000 -- (-943.906) [-942.374] (-944.409) (-940.911) * [-942.808] (-946.155) (-940.085) (-940.303) -- 0:00:15
766500 -- [-940.214] (-941.034) (-943.247) (-942.915) * (-945.432) (-944.957) [-941.244] (-940.505) -- 0:00:15
767000 -- (-942.498) (-944.134) (-942.222) [-943.077] * (-942.289) (-940.715) [-939.979] (-941.466) -- 0:00:15
767500 -- (-941.539) [-941.569] (-941.828) (-942.392) * [-942.994] (-941.368) (-940.272) (-941.003) -- 0:00:15
768000 -- (-941.142) (-941.064) (-941.596) [-940.430] * (-945.596) (-941.234) [-940.559] (-943.114) -- 0:00:15
768500 -- (-940.790) (-945.491) [-941.559] (-944.776) * (-944.424) (-941.738) (-944.268) [-943.660] -- 0:00:15
769000 -- (-942.835) [-942.877] (-943.166) (-942.744) * (-945.632) (-941.299) (-940.220) [-941.625] -- 0:00:15
769500 -- (-940.811) [-942.346] (-943.164) (-945.743) * [-941.237] (-942.548) (-943.557) (-943.578) -- 0:00:14
770000 -- (-941.968) (-943.370) [-945.957] (-942.238) * (-941.726) [-942.694] (-941.363) (-941.401) -- 0:00:14
Average standard deviation of split frequencies: 0.012054
770500 -- (-941.750) (-941.867) (-940.990) [-943.218] * (-943.280) [-940.198] (-941.179) (-943.758) -- 0:00:14
771000 -- (-944.679) (-944.840) [-942.226] (-949.517) * [-943.940] (-942.351) (-946.030) (-942.493) -- 0:00:14
771500 -- (-943.853) (-943.493) (-941.866) [-940.337] * (-943.844) (-941.332) [-943.712] (-940.926) -- 0:00:14
772000 -- [-940.651] (-941.124) (-948.501) (-941.391) * (-942.885) (-941.648) (-942.761) [-941.230] -- 0:00:14
772500 -- (-943.987) (-942.226) (-943.354) [-940.927] * [-947.827] (-943.616) (-945.345) (-941.433) -- 0:00:14
773000 -- (-942.172) [-941.109] (-944.524) (-943.168) * [-949.044] (-940.169) (-945.918) (-942.412) -- 0:00:14
773500 -- (-944.636) (-941.981) [-947.935] (-942.583) * (-943.300) (-941.478) [-943.170] (-942.243) -- 0:00:14
774000 -- (-943.643) (-941.583) (-943.020) [-940.974] * (-944.136) (-942.522) [-940.857] (-945.230) -- 0:00:14
774500 -- (-942.921) (-940.583) (-943.067) [-940.735] * [-941.909] (-942.382) (-941.980) (-945.265) -- 0:00:14
775000 -- (-942.922) (-943.256) (-943.468) [-941.815] * [-942.993] (-941.671) (-942.093) (-943.727) -- 0:00:14
Average standard deviation of split frequencies: 0.011757
775500 -- (-940.702) (-941.765) [-942.768] (-941.653) * (-940.220) (-941.860) (-942.092) [-944.221] -- 0:00:14
776000 -- (-942.885) (-941.518) [-945.897] (-940.347) * (-941.695) [-941.640] (-942.427) (-941.408) -- 0:00:14
776500 -- (-945.669) [-941.362] (-941.328) (-942.672) * [-940.525] (-942.286) (-942.881) (-940.839) -- 0:00:14
777000 -- (-947.649) (-943.019) (-940.152) [-942.420] * (-939.893) [-941.033] (-941.211) (-946.352) -- 0:00:14
777500 -- [-943.623] (-943.680) (-942.187) (-942.285) * [-944.284] (-941.450) (-944.334) (-942.217) -- 0:00:14
778000 -- (-942.600) (-943.607) [-940.669] (-941.933) * (-942.097) (-943.869) (-942.252) [-941.559] -- 0:00:14
778500 -- [-941.325] (-943.536) (-940.710) (-941.245) * (-944.382) [-945.444] (-941.933) (-940.853) -- 0:00:14
779000 -- (-941.077) (-943.163) (-944.287) [-940.799] * (-941.494) (-941.488) [-940.790] (-942.617) -- 0:00:14
779500 -- (-940.787) (-942.589) [-942.601] (-941.063) * (-941.160) (-941.859) [-941.882] (-941.480) -- 0:00:14
780000 -- (-941.388) (-941.610) [-944.788] (-944.098) * (-941.857) (-945.417) (-944.664) [-941.737] -- 0:00:14
Average standard deviation of split frequencies: 0.012001
780500 -- [-940.699] (-944.781) (-944.020) (-945.744) * (-942.664) (-940.779) [-940.867] (-943.237) -- 0:00:14
781000 -- (-940.735) [-942.785] (-943.978) (-943.854) * (-944.051) (-945.562) (-942.210) [-940.528] -- 0:00:14
781500 -- (-940.230) (-940.752) (-946.895) [-941.064] * (-942.871) (-942.215) [-943.233] (-940.895) -- 0:00:14
782000 -- (-940.173) (-942.026) (-943.454) [-942.364] * (-942.849) (-942.211) (-943.980) [-941.684] -- 0:00:14
782500 -- (-943.143) (-942.464) (-941.484) [-941.716] * (-940.758) (-942.753) (-943.579) [-942.517] -- 0:00:14
783000 -- (-946.067) (-942.682) (-942.929) [-941.248] * [-941.995] (-943.052) (-942.469) (-940.853) -- 0:00:14
783500 -- (-941.698) (-941.826) (-943.507) [-941.293] * (-945.722) [-941.392] (-942.261) (-941.926) -- 0:00:14
784000 -- (-942.881) (-942.478) (-948.574) [-942.641] * (-942.439) (-940.708) [-942.374] (-946.191) -- 0:00:14
784500 -- (-943.811) (-944.356) (-944.371) [-941.988] * (-947.599) (-943.760) [-941.685] (-941.814) -- 0:00:14
785000 -- (-942.929) (-942.592) [-940.179] (-942.310) * (-943.886) [-942.006] (-942.411) (-943.258) -- 0:00:13
Average standard deviation of split frequencies: 0.011713
785500 -- (-940.632) (-942.511) (-941.507) [-941.413] * (-942.149) (-942.596) (-941.031) [-940.797] -- 0:00:13
786000 -- [-945.673] (-940.570) (-942.817) (-940.619) * (-941.825) (-942.737) (-942.633) [-940.317] -- 0:00:13
786500 -- [-942.086] (-942.091) (-941.934) (-944.157) * (-940.859) [-943.435] (-941.518) (-942.958) -- 0:00:13
787000 -- (-941.693) (-941.772) [-942.628] (-944.132) * (-941.350) (-940.200) [-942.771] (-940.589) -- 0:00:13
787500 -- (-942.502) (-941.602) (-943.356) [-943.187] * (-941.912) (-941.146) (-942.772) [-943.773] -- 0:00:13
788000 -- [-941.868] (-942.549) (-941.064) (-948.532) * (-941.984) (-941.431) (-942.325) [-945.937] -- 0:00:13
788500 -- (-947.395) (-943.320) [-940.429] (-944.147) * (-945.014) [-941.330] (-942.874) (-946.584) -- 0:00:13
789000 -- (-942.201) (-944.010) (-944.776) [-941.930] * (-944.223) (-942.270) (-942.463) [-940.599] -- 0:00:13
789500 -- (-940.741) (-942.190) (-940.655) [-942.707] * (-946.281) (-942.369) (-940.672) [-940.506] -- 0:00:13
790000 -- (-942.138) (-941.696) (-941.417) [-943.091] * (-944.802) (-940.181) (-945.340) [-940.505] -- 0:00:13
Average standard deviation of split frequencies: 0.011924
790500 -- [-943.283] (-942.340) (-943.508) (-944.455) * (-942.854) (-943.516) (-942.604) [-939.972] -- 0:00:13
791000 -- (-941.739) (-940.712) [-944.369] (-945.199) * (-942.417) (-942.902) [-940.740] (-940.324) -- 0:00:13
791500 -- (-940.621) (-941.451) (-942.129) [-940.989] * (-942.717) (-940.487) [-942.398] (-941.134) -- 0:00:13
792000 -- [-942.938] (-942.124) (-945.844) (-942.135) * (-940.320) [-941.626] (-941.855) (-941.670) -- 0:00:13
792500 -- (-941.650) (-942.167) [-942.429] (-944.359) * (-940.320) (-943.406) [-941.405] (-944.829) -- 0:00:13
793000 -- (-942.616) (-940.399) (-944.675) [-941.663] * (-941.064) [-940.740] (-944.034) (-945.321) -- 0:00:13
793500 -- (-942.841) [-940.508] (-943.074) (-944.004) * (-940.496) (-944.013) (-944.004) [-943.425] -- 0:00:13
794000 -- (-941.570) (-940.148) [-940.431] (-943.127) * (-942.547) (-942.724) [-945.810] (-942.385) -- 0:00:13
794500 -- (-941.622) (-941.332) [-942.216] (-942.230) * (-942.231) [-942.733] (-944.534) (-945.400) -- 0:00:13
795000 -- [-943.679] (-941.920) (-944.822) (-940.544) * (-944.051) (-945.532) [-941.625] (-942.281) -- 0:00:13
Average standard deviation of split frequencies: 0.011363
795500 -- (-946.616) (-942.637) [-941.106] (-941.780) * (-941.623) (-942.702) (-943.151) [-943.157] -- 0:00:13
796000 -- [-942.673] (-941.972) (-940.568) (-940.725) * (-941.529) [-941.805] (-945.850) (-944.181) -- 0:00:13
796500 -- (-941.150) (-944.057) (-940.405) [-943.731] * (-943.391) [-943.966] (-949.917) (-943.547) -- 0:00:13
797000 -- [-940.923] (-944.479) (-940.767) (-943.388) * (-942.610) (-940.667) (-941.780) [-943.076] -- 0:00:13
797500 -- [-942.659] (-939.938) (-943.908) (-943.017) * (-944.719) (-943.130) [-943.885] (-941.010) -- 0:00:13
798000 -- (-940.172) [-940.784] (-943.789) (-941.733) * (-947.268) [-941.960] (-947.189) (-946.407) -- 0:00:13
798500 -- (-943.932) (-940.548) [-944.256] (-946.434) * (-944.356) (-943.817) (-947.189) [-942.517] -- 0:00:13
799000 -- (-948.024) [-943.380] (-944.968) (-941.740) * (-943.003) (-944.001) [-942.688] (-944.275) -- 0:00:13
799500 -- (-941.225) [-947.358] (-943.476) (-941.860) * (-941.608) (-942.248) (-942.182) [-944.228] -- 0:00:13
800000 -- [-942.032] (-941.382) (-940.948) (-942.207) * (-942.220) (-943.512) (-941.679) [-940.284] -- 0:00:12
Average standard deviation of split frequencies: 0.011444
800500 -- (-942.204) (-950.638) [-940.749] (-944.445) * (-943.008) (-941.228) [-941.310] (-940.246) -- 0:00:12
801000 -- (-940.058) (-949.710) [-941.248] (-943.748) * [-943.206] (-942.805) (-941.782) (-944.100) -- 0:00:12
801500 -- (-943.061) (-942.229) [-942.127] (-941.692) * (-942.488) [-940.220] (-947.981) (-941.599) -- 0:00:12
802000 -- (-940.512) (-942.453) (-943.442) [-942.447] * (-944.183) (-942.701) [-943.162] (-943.441) -- 0:00:12
802500 -- (-940.629) (-940.992) [-941.637] (-943.323) * [-941.243] (-942.180) (-941.946) (-941.313) -- 0:00:12
803000 -- (-940.576) [-940.673] (-942.294) (-944.068) * (-941.029) [-942.421] (-941.182) (-942.415) -- 0:00:12
803500 -- (-940.481) (-945.051) (-942.157) [-941.085] * (-940.867) (-943.574) (-940.308) [-941.183] -- 0:00:12
804000 -- (-943.060) (-947.591) (-944.539) [-941.795] * (-941.375) (-941.485) [-945.086] (-947.834) -- 0:00:12
804500 -- (-943.015) (-942.744) (-940.497) [-941.855] * (-943.480) [-941.998] (-941.441) (-941.863) -- 0:00:12
805000 -- (-940.269) (-941.757) (-943.060) [-943.253] * (-941.892) [-940.644] (-942.844) (-942.278) -- 0:00:12
Average standard deviation of split frequencies: 0.011624
805500 -- [-944.332] (-941.325) (-941.827) (-942.519) * (-942.596) [-943.232] (-942.697) (-942.116) -- 0:00:12
806000 -- (-941.306) (-943.711) [-941.870] (-940.423) * (-941.005) (-941.701) (-942.194) [-945.569] -- 0:00:12
806500 -- [-940.536] (-944.707) (-942.672) (-942.534) * (-942.433) (-943.421) (-942.941) [-943.303] -- 0:00:12
807000 -- (-943.827) (-940.723) (-941.175) [-942.472] * [-942.443] (-952.907) (-944.264) (-943.146) -- 0:00:12
807500 -- [-941.410] (-943.946) (-944.182) (-945.537) * (-944.186) (-946.384) (-941.957) [-941.352] -- 0:00:12
808000 -- [-940.949] (-940.872) (-943.670) (-945.269) * (-943.260) (-940.883) [-942.137] (-945.679) -- 0:00:12
808500 -- (-942.878) (-941.248) [-942.401] (-940.650) * (-942.238) (-941.110) (-940.319) [-940.722] -- 0:00:12
809000 -- (-944.307) (-942.609) (-940.262) [-942.928] * (-943.170) (-942.613) (-942.071) [-943.580] -- 0:00:12
809500 -- [-942.537] (-944.347) (-942.530) (-942.558) * (-941.113) (-942.879) (-940.524) [-941.773] -- 0:00:12
810000 -- [-941.884] (-949.449) (-941.645) (-947.683) * (-941.320) (-941.421) (-940.927) [-944.377] -- 0:00:12
Average standard deviation of split frequencies: 0.011412
810500 -- (-945.252) [-948.799] (-943.277) (-942.652) * (-942.165) [-945.194] (-941.068) (-946.025) -- 0:00:12
811000 -- (-941.146) (-944.389) [-940.525] (-941.548) * (-940.428) (-944.462) (-941.748) [-941.187] -- 0:00:12
811500 -- (-940.862) [-940.579] (-944.029) (-941.510) * (-942.502) (-944.645) [-942.240] (-941.579) -- 0:00:12
812000 -- [-946.819] (-941.991) (-941.860) (-942.707) * (-947.190) [-940.299] (-942.401) (-941.197) -- 0:00:12
812500 -- (-946.439) (-941.436) [-941.753] (-942.938) * (-944.959) (-940.897) [-942.368] (-942.815) -- 0:00:12
813000 -- (-945.481) (-941.279) [-942.330] (-942.215) * (-941.050) (-940.827) [-944.916] (-940.757) -- 0:00:12
813500 -- (-945.895) (-944.397) (-942.650) [-941.387] * (-940.452) (-943.758) (-945.986) [-942.242] -- 0:00:12
814000 -- (-944.325) (-942.678) (-942.966) [-940.410] * (-942.119) (-941.427) (-947.080) [-941.846] -- 0:00:12
814500 -- [-946.242] (-941.259) (-945.471) (-943.436) * (-945.354) [-941.066] (-943.449) (-942.588) -- 0:00:12
815000 -- (-943.045) (-942.091) [-942.262] (-941.692) * (-943.354) [-944.755] (-943.397) (-940.942) -- 0:00:12
Average standard deviation of split frequencies: 0.011374
815500 -- (-944.042) (-942.084) (-942.739) [-941.051] * (-942.160) [-945.298] (-941.783) (-943.133) -- 0:00:11
816000 -- (-948.914) (-943.386) (-943.011) [-941.351] * (-944.879) (-945.232) [-943.294] (-943.239) -- 0:00:11
816500 -- (-942.465) [-940.932] (-940.965) (-940.825) * (-940.661) (-944.659) (-945.072) [-940.382] -- 0:00:11
817000 -- (-943.795) (-941.441) [-942.333] (-943.518) * (-941.564) (-946.926) (-942.689) [-940.236] -- 0:00:11
817500 -- [-942.878] (-944.067) (-941.666) (-945.333) * (-942.342) (-941.547) [-940.218] (-942.360) -- 0:00:11
818000 -- (-940.807) [-943.730] (-943.721) (-944.093) * (-943.089) (-941.567) (-941.837) [-941.923] -- 0:00:11
818500 -- (-940.824) (-941.843) [-941.004] (-942.744) * (-941.493) (-940.152) [-940.556] (-942.264) -- 0:00:11
819000 -- (-941.276) (-941.663) [-942.452] (-942.901) * (-941.324) (-946.620) [-942.709] (-942.663) -- 0:00:11
819500 -- [-942.779] (-942.907) (-940.397) (-943.540) * [-941.340] (-941.124) (-942.384) (-943.408) -- 0:00:11
820000 -- (-940.854) (-944.585) (-944.016) [-941.507] * [-941.521] (-941.901) (-942.591) (-940.886) -- 0:00:11
Average standard deviation of split frequencies: 0.011524
820500 -- (-940.857) (-942.611) [-940.557] (-946.244) * (-942.076) (-943.142) (-940.698) [-944.286] -- 0:00:11
821000 -- [-943.909] (-943.565) (-946.800) (-945.913) * [-941.877] (-943.364) (-943.410) (-947.303) -- 0:00:11
821500 -- (-944.093) [-942.285] (-941.976) (-947.034) * [-943.036] (-943.787) (-940.039) (-941.639) -- 0:00:11
822000 -- (-939.947) [-942.713] (-940.755) (-941.312) * (-942.899) (-943.056) [-942.036] (-942.232) -- 0:00:11
822500 -- (-943.126) (-943.646) [-941.415] (-943.320) * (-943.885) (-944.456) (-941.344) [-941.793] -- 0:00:11
823000 -- (-946.863) (-947.529) [-940.470] (-941.663) * [-941.179] (-944.027) (-940.527) (-943.883) -- 0:00:11
823500 -- [-941.262] (-941.203) (-944.131) (-945.500) * (-945.918) (-945.713) [-940.366] (-944.024) -- 0:00:11
824000 -- (-943.111) [-944.150] (-942.982) (-942.952) * (-940.945) (-940.570) [-940.628] (-945.068) -- 0:00:11
824500 -- (-941.639) [-945.579] (-944.484) (-943.351) * (-942.043) [-941.415] (-941.117) (-947.245) -- 0:00:11
825000 -- (-944.209) [-942.751] (-943.040) (-943.002) * (-945.241) (-944.000) [-943.225] (-943.089) -- 0:00:11
Average standard deviation of split frequencies: 0.011414
825500 -- (-942.912) (-940.666) [-942.429] (-942.566) * (-941.861) (-940.572) (-942.391) [-940.465] -- 0:00:11
826000 -- (-943.331) (-942.244) [-944.119] (-945.585) * (-945.444) (-940.252) [-942.933] (-941.232) -- 0:00:11
826500 -- (-942.704) (-941.361) [-942.527] (-946.229) * (-944.681) (-940.987) [-941.910] (-941.974) -- 0:00:11
827000 -- (-943.027) [-943.061] (-942.883) (-945.324) * [-942.854] (-943.418) (-942.061) (-941.212) -- 0:00:11
827500 -- [-943.556] (-942.260) (-943.932) (-940.552) * [-942.512] (-941.288) (-943.913) (-942.766) -- 0:00:11
828000 -- (-942.610) (-941.237) [-941.057] (-942.187) * (-940.989) (-941.893) [-941.075] (-943.528) -- 0:00:11
828500 -- (-942.659) (-943.632) (-943.871) [-941.373] * (-940.571) [-941.372] (-941.333) (-943.027) -- 0:00:11
829000 -- (-942.835) (-946.963) [-940.378] (-942.639) * (-941.419) (-944.766) (-941.172) [-940.560] -- 0:00:11
829500 -- (-943.617) [-941.114] (-942.476) (-941.448) * (-942.628) (-944.597) [-940.243] (-940.419) -- 0:00:11
830000 -- (-944.354) [-941.194] (-942.609) (-948.770) * (-942.650) (-942.541) [-944.196] (-940.698) -- 0:00:11
Average standard deviation of split frequencies: 0.011244
830500 -- (-943.319) (-944.250) (-945.527) [-943.430] * (-941.414) [-943.114] (-947.509) (-940.585) -- 0:00:11
831000 -- [-943.334] (-940.705) (-942.734) (-942.133) * (-946.643) (-943.169) [-942.505] (-940.602) -- 0:00:10
831500 -- (-944.802) (-943.004) (-943.314) [-940.499] * (-946.654) (-943.456) (-943.492) [-941.787] -- 0:00:10
832000 -- (-948.667) (-943.943) (-942.751) [-940.019] * (-944.826) (-941.031) [-942.050] (-943.200) -- 0:00:10
832500 -- [-942.315] (-942.106) (-940.985) (-939.994) * (-941.513) (-943.146) [-943.414] (-940.611) -- 0:00:10
833000 -- (-945.209) (-941.620) (-942.107) [-941.402] * (-940.446) (-940.730) [-943.437] (-940.327) -- 0:00:10
833500 -- [-942.326] (-942.716) (-941.030) (-941.733) * (-941.763) (-941.790) (-941.562) [-940.366] -- 0:00:10
834000 -- (-944.464) (-942.974) [-940.904] (-940.757) * (-944.876) (-942.894) (-941.781) [-941.539] -- 0:00:10
834500 -- [-946.661] (-944.067) (-940.335) (-942.927) * (-947.405) [-943.737] (-945.637) (-941.294) -- 0:00:10
835000 -- [-941.704] (-940.545) (-941.115) (-943.043) * [-941.193] (-942.824) (-944.011) (-942.138) -- 0:00:10
Average standard deviation of split frequencies: 0.011454
835500 -- (-945.844) (-942.150) [-941.504] (-943.880) * (-940.752) [-940.109] (-942.385) (-942.438) -- 0:00:10
836000 -- (-947.294) [-941.809] (-941.250) (-946.599) * [-940.358] (-943.587) (-941.778) (-942.225) -- 0:00:10
836500 -- (-946.626) [-940.961] (-944.971) (-944.904) * (-942.473) (-944.019) [-943.641] (-942.433) -- 0:00:10
837000 -- (-945.223) (-941.064) [-943.020] (-944.561) * [-942.948] (-944.861) (-941.825) (-942.808) -- 0:00:10
837500 -- (-944.924) (-940.950) [-940.948] (-940.658) * (-947.012) [-942.396] (-940.659) (-940.898) -- 0:00:10
838000 -- (-942.997) (-940.382) [-941.377] (-943.234) * (-942.534) (-942.182) [-943.016] (-942.684) -- 0:00:10
838500 -- [-940.458] (-943.625) (-946.122) (-941.155) * (-942.755) (-943.739) [-942.086] (-942.580) -- 0:00:10
839000 -- (-940.651) [-942.373] (-942.104) (-941.325) * (-945.251) (-941.472) [-943.643] (-944.691) -- 0:00:10
839500 -- (-943.283) (-941.389) (-941.890) [-941.326] * (-940.346) (-943.347) (-941.745) [-940.956] -- 0:00:10
840000 -- (-943.719) (-941.974) (-942.027) [-941.907] * (-941.016) (-942.419) (-941.469) [-940.295] -- 0:00:10
Average standard deviation of split frequencies: 0.011145
840500 -- (-942.486) (-940.811) (-943.473) [-944.386] * (-940.847) [-941.216] (-944.603) (-942.206) -- 0:00:10
841000 -- [-941.602] (-941.831) (-942.496) (-945.695) * [-944.642] (-941.692) (-940.133) (-940.901) -- 0:00:10
841500 -- [-941.163] (-944.414) (-943.658) (-943.835) * (-947.731) (-943.544) [-940.467] (-941.085) -- 0:00:10
842000 -- (-941.997) (-941.519) (-941.495) [-941.985] * (-941.867) (-944.849) (-947.421) [-942.004] -- 0:00:10
842500 -- (-941.688) [-942.741] (-940.961) (-945.624) * (-944.078) (-943.011) [-943.044] (-941.895) -- 0:00:10
843000 -- (-941.239) (-944.260) (-946.060) [-940.885] * [-942.761] (-941.391) (-944.251) (-941.478) -- 0:00:10
843500 -- [-943.963] (-946.467) (-946.247) (-940.499) * (-944.065) [-940.950] (-942.999) (-941.651) -- 0:00:10
844000 -- (-942.753) (-943.183) [-940.453] (-944.996) * (-943.417) (-941.118) (-942.070) [-941.345] -- 0:00:10
844500 -- (-940.316) (-942.495) (-940.875) [-941.238] * (-940.492) (-940.942) [-941.845] (-941.670) -- 0:00:10
845000 -- (-940.576) [-944.434] (-941.107) (-950.004) * [-948.861] (-947.115) (-942.626) (-941.162) -- 0:00:10
Average standard deviation of split frequencies: 0.011308
845500 -- (-940.193) (-941.549) [-941.627] (-943.272) * (-947.248) (-945.473) (-944.588) [-941.194] -- 0:00:10
846000 -- [-942.371] (-940.671) (-942.700) (-940.369) * (-943.343) (-942.829) (-943.024) [-940.680] -- 0:00:10
846500 -- (-941.193) (-945.024) [-943.229] (-942.968) * (-944.858) (-942.479) [-945.418] (-942.235) -- 0:00:10
847000 -- (-943.576) (-941.500) [-941.678] (-941.252) * [-944.882] (-943.382) (-942.618) (-941.816) -- 0:00:10
847500 -- [-943.353] (-942.252) (-943.424) (-946.576) * (-945.794) (-945.122) [-941.805] (-941.168) -- 0:00:10
848000 -- (-941.975) (-942.174) (-942.484) [-945.292] * (-941.330) (-941.840) [-941.284] (-941.453) -- 0:00:10
848500 -- [-940.727] (-944.270) (-947.441) (-943.679) * (-943.633) (-943.158) (-942.159) [-941.203] -- 0:00:09
849000 -- [-943.221] (-941.639) (-941.995) (-941.746) * (-943.004) (-943.626) (-944.906) [-943.870] -- 0:00:09
849500 -- (-943.417) (-943.988) (-943.911) [-941.805] * (-940.835) [-946.642] (-940.672) (-941.995) -- 0:00:09
850000 -- (-943.946) (-945.134) (-940.380) [-943.340] * [-941.369] (-944.743) (-941.680) (-942.397) -- 0:00:09
Average standard deviation of split frequencies: 0.011670
850500 -- (-944.400) (-944.972) [-941.818] (-940.769) * (-943.902) (-941.991) (-945.504) [-942.253] -- 0:00:09
851000 -- (-942.339) (-941.612) (-940.862) [-941.336] * (-941.798) (-941.293) (-945.803) [-945.241] -- 0:00:09
851500 -- (-941.458) (-940.593) [-941.943] (-944.761) * [-941.647] (-940.987) (-941.701) (-940.829) -- 0:00:09
852000 -- (-943.286) (-942.503) [-942.540] (-940.987) * [-941.752] (-943.164) (-940.876) (-942.954) -- 0:00:09
852500 -- (-941.237) (-941.998) (-943.907) [-941.207] * [-944.424] (-944.964) (-944.054) (-942.718) -- 0:00:09
853000 -- [-942.995] (-941.057) (-940.950) (-942.716) * (-949.237) (-946.096) [-942.837] (-941.461) -- 0:00:09
853500 -- (-944.632) (-941.859) [-943.978] (-942.631) * [-941.644] (-942.298) (-945.090) (-943.530) -- 0:00:09
854000 -- (-941.590) (-940.645) (-940.662) [-940.994] * [-944.151] (-942.252) (-947.809) (-942.612) -- 0:00:09
854500 -- [-941.712] (-946.214) (-941.228) (-943.060) * (-941.238) (-943.721) (-952.029) [-942.190] -- 0:00:09
855000 -- (-945.785) [-941.619] (-942.411) (-942.932) * [-941.028] (-953.832) (-945.281) (-941.725) -- 0:00:09
Average standard deviation of split frequencies: 0.011694
855500 -- (-944.537) (-943.120) [-942.130] (-944.023) * (-942.714) [-944.741] (-941.662) (-945.986) -- 0:00:09
856000 -- (-942.931) [-944.183] (-941.626) (-942.225) * (-949.229) [-941.063] (-943.614) (-941.551) -- 0:00:09
856500 -- (-944.997) (-944.845) (-942.222) [-943.643] * [-950.393] (-942.370) (-942.661) (-945.171) -- 0:00:09
857000 -- (-943.493) (-945.521) (-944.360) [-941.569] * (-942.529) (-941.887) (-942.596) [-943.723] -- 0:00:09
857500 -- (-942.098) (-948.363) (-943.687) [-940.915] * [-940.717] (-942.786) (-946.947) (-943.204) -- 0:00:09
858000 -- [-942.356] (-946.569) (-941.947) (-944.385) * [-946.073] (-940.358) (-943.778) (-945.735) -- 0:00:09
858500 -- (-944.372) (-946.357) (-939.917) [-943.819] * [-942.622] (-940.624) (-941.694) (-940.193) -- 0:00:09
859000 -- [-942.894] (-941.386) (-940.982) (-943.748) * (-941.822) [-941.588] (-941.491) (-941.439) -- 0:00:09
859500 -- (-943.112) [-941.378] (-943.658) (-940.145) * (-941.635) (-944.308) (-941.547) [-941.398] -- 0:00:09
860000 -- [-940.923] (-942.405) (-940.242) (-940.728) * [-943.988] (-945.045) (-940.932) (-941.382) -- 0:00:09
Average standard deviation of split frequencies: 0.011083
860500 -- (-942.446) (-943.402) [-942.523] (-941.193) * [-945.091] (-950.584) (-940.648) (-943.595) -- 0:00:09
861000 -- (-941.193) [-941.190] (-943.106) (-941.628) * (-949.529) [-940.646] (-943.929) (-942.592) -- 0:00:09
861500 -- (-942.519) (-942.298) [-943.616] (-943.232) * (-947.014) (-941.502) (-943.795) [-941.828] -- 0:00:09
862000 -- [-941.207] (-944.333) (-946.373) (-941.314) * (-944.041) (-944.408) [-941.188] (-943.074) -- 0:00:09
862500 -- (-942.094) [-940.666] (-943.084) (-944.870) * (-942.229) (-944.650) [-943.302] (-940.879) -- 0:00:09
863000 -- (-940.638) (-940.767) (-946.074) [-942.078] * (-942.979) [-943.061] (-944.258) (-941.011) -- 0:00:09
863500 -- (-943.755) [-943.310] (-943.547) (-945.525) * (-941.133) (-942.657) [-942.710] (-940.597) -- 0:00:09
864000 -- (-940.122) (-940.457) (-943.566) [-943.202] * (-942.715) (-945.448) [-943.795] (-941.238) -- 0:00:09
864500 -- [-940.207] (-944.315) (-941.754) (-943.071) * (-943.414) [-945.839] (-943.425) (-940.425) -- 0:00:09
865000 -- (-944.281) (-944.936) [-943.317] (-941.942) * (-949.971) [-943.919] (-941.502) (-940.728) -- 0:00:09
Average standard deviation of split frequencies: 0.010791
865500 -- (-940.378) (-945.487) (-941.177) [-941.347] * (-941.083) (-947.894) (-944.749) [-941.826] -- 0:00:09
866000 -- [-941.244] (-942.747) (-940.458) (-941.302) * (-940.699) (-946.068) [-943.632] (-942.366) -- 0:00:08
866500 -- (-944.939) (-942.065) [-942.073] (-940.203) * [-941.518] (-943.938) (-944.957) (-944.051) -- 0:00:08
867000 -- (-942.971) (-942.248) [-940.784] (-943.651) * [-940.601] (-941.602) (-941.878) (-948.695) -- 0:00:08
867500 -- [-940.785] (-942.548) (-943.102) (-942.358) * (-942.030) [-942.001] (-943.650) (-942.648) -- 0:00:08
868000 -- (-941.875) (-941.059) (-944.024) [-941.298] * (-943.492) [-942.558] (-942.239) (-940.940) -- 0:00:08
868500 -- (-946.935) [-942.501] (-940.778) (-944.099) * (-944.801) [-946.567] (-941.133) (-940.768) -- 0:00:08
869000 -- (-943.389) [-942.514] (-943.044) (-944.022) * [-941.268] (-942.271) (-942.925) (-941.524) -- 0:00:08
869500 -- (-945.437) [-947.535] (-946.488) (-942.616) * [-941.965] (-941.996) (-941.684) (-944.191) -- 0:00:08
870000 -- [-941.448] (-944.535) (-944.197) (-942.233) * (-942.147) [-943.292] (-943.577) (-942.324) -- 0:00:08
Average standard deviation of split frequencies: 0.010287
870500 -- (-941.471) [-940.475] (-951.710) (-943.120) * (-941.736) [-942.371] (-943.399) (-942.102) -- 0:00:08
871000 -- (-941.746) (-940.492) [-942.549] (-941.727) * (-943.184) (-940.768) (-942.406) [-941.128] -- 0:00:08
871500 -- (-942.604) [-943.533] (-943.262) (-945.360) * [-944.776] (-940.271) (-942.244) (-940.086) -- 0:00:08
872000 -- (-942.475) (-945.177) [-942.229] (-944.430) * (-948.396) (-941.738) [-942.291] (-941.021) -- 0:00:08
872500 -- [-941.065] (-943.387) (-941.765) (-941.060) * (-941.133) (-941.603) [-944.439] (-942.119) -- 0:00:08
873000 -- (-941.993) [-943.853] (-942.454) (-940.879) * (-941.147) [-942.136] (-942.601) (-941.421) -- 0:00:08
873500 -- (-942.526) (-942.441) (-947.571) [-942.482] * (-943.734) [-942.379] (-944.568) (-943.067) -- 0:00:08
874000 -- (-942.317) (-941.521) (-943.817) [-943.415] * (-942.150) (-940.557) (-941.989) [-944.679] -- 0:00:08
874500 -- [-942.669] (-945.212) (-941.780) (-944.908) * (-943.687) (-940.431) (-942.129) [-942.299] -- 0:00:08
875000 -- [-943.302] (-943.390) (-940.413) (-943.294) * [-940.930] (-948.110) (-942.934) (-939.971) -- 0:00:08
Average standard deviation of split frequencies: 0.010124
875500 -- (-941.215) [-942.588] (-940.710) (-942.282) * [-940.781] (-942.790) (-945.417) (-939.939) -- 0:00:08
876000 -- (-940.414) [-940.240] (-940.206) (-942.210) * [-943.468] (-942.767) (-944.960) (-943.205) -- 0:00:08
876500 -- (-940.933) (-940.288) [-941.180] (-946.456) * (-945.350) [-941.778] (-946.164) (-940.057) -- 0:00:08
877000 -- (-943.910) [-944.922] (-941.265) (-943.170) * (-941.873) (-941.534) (-943.268) [-941.077] -- 0:00:08
877500 -- [-944.518] (-943.149) (-940.596) (-943.306) * [-941.593] (-944.591) (-943.628) (-942.981) -- 0:00:08
878000 -- [-941.036] (-940.825) (-940.737) (-940.634) * (-944.209) (-944.165) [-940.689] (-942.254) -- 0:00:08
878500 -- [-941.804] (-941.670) (-941.433) (-943.440) * (-941.385) (-941.140) [-941.917] (-942.876) -- 0:00:08
879000 -- (-943.172) (-941.406) (-940.048) [-941.720] * [-942.877] (-943.927) (-943.448) (-943.666) -- 0:00:08
879500 -- (-947.368) (-941.696) (-942.197) [-942.782] * (-942.201) (-944.012) [-941.849] (-940.999) -- 0:00:08
880000 -- [-942.725] (-942.095) (-941.438) (-941.907) * [-944.380] (-941.731) (-941.213) (-944.307) -- 0:00:08
Average standard deviation of split frequencies: 0.010371
880500 -- [-944.839] (-940.722) (-941.993) (-944.378) * (-944.570) [-941.857] (-940.432) (-943.229) -- 0:00:08
881000 -- (-942.418) (-940.574) [-945.813] (-940.824) * [-942.956] (-941.267) (-940.656) (-942.472) -- 0:00:07
881500 -- (-940.450) (-942.145) [-940.840] (-940.171) * [-942.593] (-940.649) (-940.621) (-943.823) -- 0:00:07
882000 -- [-944.101] (-942.739) (-943.612) (-942.476) * (-941.479) (-941.590) (-944.236) [-945.502] -- 0:00:07
882500 -- (-940.227) [-943.711] (-942.471) (-946.368) * (-943.646) (-944.928) [-942.231] (-940.895) -- 0:00:07
883000 -- [-941.168] (-945.594) (-940.466) (-945.957) * (-941.679) [-944.905] (-941.915) (-941.208) -- 0:00:07
883500 -- [-941.736] (-943.015) (-943.274) (-941.655) * (-940.638) [-940.103] (-941.705) (-941.426) -- 0:00:07
884000 -- [-946.267] (-942.325) (-940.551) (-943.594) * (-943.373) [-941.255] (-943.677) (-942.439) -- 0:00:07
884500 -- (-941.232) (-943.747) (-940.714) [-941.191] * (-941.464) [-942.596] (-941.785) (-943.603) -- 0:00:07
885000 -- (-942.521) (-941.889) (-948.854) [-941.278] * (-945.225) (-940.510) (-941.249) [-940.153] -- 0:00:07
Average standard deviation of split frequencies: 0.010275
885500 -- (-943.643) (-941.092) [-941.729] (-941.226) * (-942.659) [-942.202] (-940.701) (-942.119) -- 0:00:07
886000 -- [-943.428] (-940.076) (-944.391) (-944.720) * [-940.699] (-941.107) (-942.321) (-942.707) -- 0:00:07
886500 -- (-943.986) (-940.398) (-940.864) [-946.325] * (-945.558) (-943.169) (-941.177) [-945.463] -- 0:00:07
887000 -- (-943.640) [-940.387] (-940.419) (-945.107) * (-948.755) [-942.408] (-941.115) (-944.056) -- 0:00:07
887500 -- (-943.719) [-941.211] (-940.504) (-952.732) * (-941.313) (-946.647) [-945.022] (-941.576) -- 0:00:07
888000 -- (-941.063) (-941.601) [-940.712] (-950.754) * (-941.646) (-943.590) (-946.309) [-941.114] -- 0:00:07
888500 -- (-940.107) [-941.742] (-946.109) (-946.904) * [-941.517] (-942.943) (-943.755) (-943.011) -- 0:00:07
889000 -- (-946.433) [-943.924] (-946.670) (-942.371) * (-943.018) [-940.807] (-943.444) (-941.674) -- 0:00:07
889500 -- (-941.922) [-941.784] (-947.347) (-942.810) * (-941.570) [-941.880] (-944.692) (-941.531) -- 0:00:07
890000 -- (-946.362) (-947.603) [-941.706] (-940.663) * [-940.283] (-943.674) (-946.335) (-942.940) -- 0:00:07
Average standard deviation of split frequencies: 0.010420
890500 -- (-941.683) (-949.792) (-943.990) [-940.897] * (-942.427) (-940.663) [-941.820] (-942.594) -- 0:00:07
891000 -- (-943.169) (-946.009) (-941.356) [-940.555] * [-943.880] (-940.917) (-943.980) (-942.510) -- 0:00:07
891500 -- (-943.045) (-942.089) [-941.031] (-941.111) * (-942.991) (-943.017) (-944.737) [-947.598] -- 0:00:07
892000 -- (-943.041) (-942.390) (-944.419) [-940.356] * (-944.150) (-941.983) (-944.386) [-941.058] -- 0:00:07
892500 -- (-943.165) [-941.918] (-942.665) (-941.652) * [-940.836] (-941.163) (-940.503) (-942.027) -- 0:00:07
893000 -- (-940.600) [-942.616] (-943.701) (-944.189) * (-948.231) [-941.050] (-940.433) (-944.925) -- 0:00:07
893500 -- (-940.686) (-940.989) [-944.293] (-941.757) * (-945.004) (-942.216) [-940.319] (-945.138) -- 0:00:07
894000 -- (-943.226) [-941.920] (-953.841) (-941.765) * (-941.183) (-942.428) [-942.279] (-949.520) -- 0:00:07
894500 -- [-941.614] (-942.649) (-942.112) (-943.774) * (-942.962) (-941.869) [-942.556] (-940.771) -- 0:00:07
895000 -- (-947.470) (-944.692) (-943.763) [-946.230] * (-944.495) (-944.351) (-941.275) [-940.769] -- 0:00:07
Average standard deviation of split frequencies: 0.010894
895500 -- (-942.264) [-942.240] (-942.106) (-943.055) * (-941.504) [-941.378] (-941.845) (-940.565) -- 0:00:07
896000 -- [-940.842] (-941.136) (-942.911) (-943.385) * [-943.732] (-941.825) (-942.063) (-943.382) -- 0:00:06
896500 -- (-940.856) (-941.095) (-941.324) [-941.667] * [-943.341] (-941.289) (-945.705) (-943.775) -- 0:00:06
897000 -- [-942.053] (-940.998) (-944.708) (-941.561) * (-943.668) [-941.307] (-942.472) (-945.540) -- 0:00:06
897500 -- (-944.988) [-940.699] (-948.218) (-940.913) * (-940.978) (-945.862) [-944.944] (-945.307) -- 0:00:06
898000 -- [-943.865] (-941.973) (-945.563) (-944.486) * (-940.261) (-945.349) (-943.925) [-940.956] -- 0:00:06
898500 -- (-943.663) (-942.011) (-943.085) [-942.752] * (-940.006) (-942.162) [-941.778] (-943.295) -- 0:00:06
899000 -- (-942.069) (-941.149) (-941.178) [-942.090] * (-943.113) (-942.127) (-942.331) [-941.972] -- 0:00:06
899500 -- [-943.467] (-942.243) (-947.189) (-941.061) * [-940.607] (-940.939) (-942.464) (-941.453) -- 0:00:06
900000 -- [-941.205] (-944.295) (-942.851) (-941.497) * (-941.072) (-943.414) (-945.752) [-942.429] -- 0:00:06
Average standard deviation of split frequencies: 0.010337
900500 -- (-941.248) [-942.329] (-943.545) (-942.728) * (-942.423) (-943.131) (-941.880) [-941.843] -- 0:00:06
901000 -- (-940.021) (-942.635) (-946.114) [-943.375] * (-942.475) (-941.336) [-943.043] (-941.460) -- 0:00:06
901500 -- (-942.237) (-941.303) [-940.110] (-946.327) * (-940.174) (-942.958) [-945.048] (-940.534) -- 0:00:06
902000 -- (-942.748) (-942.546) (-941.675) [-942.432] * (-942.031) (-940.171) [-941.952] (-941.238) -- 0:00:06
902500 -- (-942.368) (-943.594) [-943.573] (-944.085) * (-942.501) (-941.562) [-943.231] (-941.068) -- 0:00:06
903000 -- [-942.619] (-946.306) (-941.600) (-940.078) * [-941.982] (-941.841) (-942.329) (-942.922) -- 0:00:06
903500 -- (-942.655) (-942.042) [-942.290] (-942.366) * [-941.043] (-942.450) (-943.041) (-944.044) -- 0:00:06
904000 -- (-940.924) [-943.336] (-942.234) (-943.536) * (-940.822) (-946.232) (-942.039) [-944.076] -- 0:00:06
904500 -- (-942.544) (-942.568) (-945.283) [-941.556] * (-944.637) (-942.631) (-944.075) [-942.580] -- 0:00:06
905000 -- [-942.676] (-942.951) (-943.913) (-942.035) * (-941.438) (-943.022) (-940.941) [-940.713] -- 0:00:06
Average standard deviation of split frequencies: 0.010988
905500 -- (-941.433) [-943.181] (-941.308) (-941.280) * (-944.136) (-940.935) [-942.452] (-940.962) -- 0:00:06
906000 -- (-942.801) (-942.453) (-942.304) [-942.966] * (-942.311) [-942.233] (-943.116) (-940.484) -- 0:00:06
906500 -- [-943.078] (-942.844) (-940.621) (-941.624) * (-941.212) (-944.095) (-940.897) [-942.050] -- 0:00:06
907000 -- (-940.884) (-947.530) (-940.479) [-941.091] * (-942.128) (-942.998) [-942.414] (-941.859) -- 0:00:06
907500 -- (-945.023) [-941.287] (-943.072) (-942.466) * (-945.550) (-941.988) (-940.572) [-942.608] -- 0:00:06
908000 -- (-943.907) (-943.115) (-940.871) [-940.333] * (-940.764) (-942.008) (-940.234) [-943.980] -- 0:00:06
908500 -- [-944.851] (-943.920) (-940.915) (-941.610) * (-941.642) (-942.930) [-940.783] (-942.519) -- 0:00:06
909000 -- (-943.600) (-941.232) (-941.333) [-941.444] * (-941.407) [-943.892] (-941.469) (-951.127) -- 0:00:06
909500 -- [-944.123] (-940.705) (-943.080) (-941.849) * [-942.677] (-940.810) (-945.987) (-950.144) -- 0:00:06
910000 -- [-943.731] (-940.513) (-941.145) (-940.134) * (-941.185) [-941.921] (-940.908) (-941.807) -- 0:00:06
Average standard deviation of split frequencies: 0.010077
910500 -- (-942.899) (-941.084) [-940.613] (-940.902) * (-942.576) (-943.559) (-941.492) [-941.233] -- 0:00:05
911000 -- (-941.609) (-943.551) [-941.428] (-941.366) * (-942.021) (-941.787) (-942.124) [-941.226] -- 0:00:05
911500 -- (-944.204) (-942.348) [-942.943] (-942.516) * (-941.795) (-943.507) [-942.029] (-943.534) -- 0:00:05
912000 -- (-943.259) [-942.946] (-942.151) (-954.835) * [-941.092] (-942.568) (-942.023) (-941.355) -- 0:00:05
912500 -- (-943.611) (-942.169) [-942.441] (-942.076) * (-942.146) (-942.959) (-944.497) [-942.898] -- 0:00:05
913000 -- (-942.928) (-940.828) [-941.790] (-945.434) * [-940.185] (-941.191) (-944.825) (-943.820) -- 0:00:05
913500 -- (-944.490) (-941.592) (-944.891) [-946.927] * [-942.782] (-940.924) (-944.697) (-943.435) -- 0:00:05
914000 -- (-941.967) (-941.219) [-943.948] (-945.580) * [-942.051] (-947.906) (-940.520) (-944.713) -- 0:00:05
914500 -- [-940.595] (-941.715) (-947.068) (-942.322) * (-941.033) (-942.459) [-940.091] (-941.050) -- 0:00:05
915000 -- (-943.245) [-942.155] (-942.321) (-942.037) * (-941.420) [-946.304] (-944.819) (-942.624) -- 0:00:05
Average standard deviation of split frequencies: 0.009875
915500 -- (-941.454) (-943.524) [-940.469] (-940.947) * (-945.098) [-942.622] (-943.302) (-944.133) -- 0:00:05
916000 -- [-943.205] (-944.286) (-940.945) (-940.663) * (-941.806) (-948.527) (-949.001) [-948.458] -- 0:00:05
916500 -- (-943.182) [-946.855] (-940.715) (-940.781) * (-940.977) (-941.495) (-946.244) [-945.335] -- 0:00:05
917000 -- (-942.504) (-944.332) (-943.988) [-941.027] * (-942.814) [-941.348] (-942.247) (-943.985) -- 0:00:05
917500 -- (-940.941) (-943.926) [-943.957] (-940.195) * (-940.527) [-943.276] (-943.117) (-941.211) -- 0:00:05
918000 -- [-941.234] (-941.060) (-944.157) (-940.609) * (-942.043) (-941.084) (-944.779) [-942.080] -- 0:00:05
918500 -- (-942.174) (-941.815) (-943.095) [-940.569] * [-942.008] (-940.989) (-948.464) (-948.276) -- 0:00:05
919000 -- (-942.831) (-943.195) (-941.738) [-940.270] * (-943.917) (-941.286) [-941.076] (-940.871) -- 0:00:05
919500 -- [-943.259] (-942.467) (-944.401) (-942.574) * (-944.616) (-941.270) [-941.085] (-940.449) -- 0:00:05
920000 -- [-944.382] (-940.734) (-940.872) (-940.962) * (-943.517) (-941.743) [-942.855] (-941.652) -- 0:00:05
Average standard deviation of split frequencies: 0.010305
920500 -- (-944.817) [-943.590] (-943.375) (-940.922) * [-946.138] (-942.480) (-940.919) (-941.648) -- 0:00:05
921000 -- (-945.773) [-942.419] (-945.606) (-941.012) * (-942.533) (-943.326) [-943.471] (-941.333) -- 0:00:05
921500 -- (-944.346) [-944.957] (-943.091) (-941.776) * (-942.880) (-941.365) [-942.168] (-942.030) -- 0:00:05
922000 -- [-942.165] (-942.682) (-944.393) (-944.784) * (-943.116) [-943.304] (-947.213) (-941.045) -- 0:00:05
922500 -- (-943.986) (-940.894) (-943.202) [-940.330] * [-943.553] (-943.533) (-946.521) (-941.485) -- 0:00:05
923000 -- (-942.681) (-943.219) (-946.221) [-940.805] * (-940.478) [-941.860] (-944.556) (-940.736) -- 0:00:05
923500 -- (-942.583) (-946.363) (-945.785) [-944.161] * [-940.427] (-943.388) (-943.084) (-942.165) -- 0:00:05
924000 -- (-941.582) (-940.542) [-941.338] (-941.127) * (-941.742) (-948.102) [-943.825] (-942.819) -- 0:00:05
924500 -- (-941.620) (-942.367) [-940.173] (-943.176) * [-940.645] (-942.331) (-942.100) (-943.556) -- 0:00:05
925000 -- [-940.639] (-940.619) (-946.607) (-945.979) * [-940.785] (-940.619) (-942.875) (-943.266) -- 0:00:05
Average standard deviation of split frequencies: 0.010541
925500 -- [-941.355] (-940.814) (-943.617) (-943.245) * (-941.074) [-941.664] (-941.498) (-945.555) -- 0:00:05
926000 -- (-940.812) [-940.464] (-942.953) (-944.891) * (-942.936) [-940.906] (-944.848) (-941.910) -- 0:00:05
926500 -- (-942.947) [-942.802] (-943.466) (-942.814) * (-941.695) [-940.880] (-940.911) (-941.691) -- 0:00:04
927000 -- (-941.169) [-940.713] (-941.366) (-943.239) * (-944.659) (-941.707) (-943.171) [-944.799] -- 0:00:04
927500 -- [-940.479] (-941.770) (-942.378) (-945.233) * (-946.631) [-940.942] (-944.608) (-944.082) -- 0:00:04
928000 -- (-942.156) (-940.233) [-943.014] (-946.394) * (-942.264) [-944.316] (-942.419) (-942.574) -- 0:00:04
928500 -- (-942.879) (-944.156) (-949.955) [-941.069] * (-945.396) (-943.847) (-942.355) [-941.541] -- 0:00:04
929000 -- (-942.331) [-944.997] (-943.774) (-944.243) * [-944.454] (-941.687) (-941.449) (-940.624) -- 0:00:04
929500 -- (-945.559) [-945.349] (-944.813) (-944.735) * [-942.058] (-940.881) (-945.827) (-942.714) -- 0:00:04
930000 -- (-940.537) (-942.609) (-943.726) [-944.787] * (-944.051) (-940.197) [-945.986] (-941.675) -- 0:00:04
Average standard deviation of split frequencies: 0.010548
930500 -- [-941.977] (-944.011) (-941.991) (-944.835) * (-943.833) (-942.855) (-941.833) [-942.754] -- 0:00:04
931000 -- (-946.434) (-943.624) [-941.408] (-942.327) * (-947.209) (-943.937) (-942.218) [-942.129] -- 0:00:04
931500 -- (-943.706) [-942.773] (-944.134) (-945.366) * (-946.300) (-943.760) [-940.966] (-940.276) -- 0:00:04
932000 -- (-941.910) (-941.274) [-943.594] (-946.261) * [-940.019] (-940.077) (-940.159) (-942.031) -- 0:00:04
932500 -- (-945.166) [-941.120] (-941.535) (-946.701) * [-940.338] (-942.342) (-941.786) (-942.411) -- 0:00:04
933000 -- (-940.177) (-943.138) [-942.522] (-942.046) * (-943.836) [-941.968] (-944.487) (-943.870) -- 0:00:04
933500 -- (-941.805) (-943.923) [-941.049] (-940.738) * [-941.119] (-942.511) (-941.156) (-944.465) -- 0:00:04
934000 -- (-940.740) (-941.773) (-942.216) [-942.344] * (-942.562) (-947.614) [-940.833] (-941.416) -- 0:00:04
934500 -- (-941.848) [-942.686] (-941.787) (-941.375) * (-942.573) [-941.359] (-941.231) (-946.361) -- 0:00:04
935000 -- (-942.428) [-943.574] (-941.467) (-943.081) * (-941.040) (-945.714) (-942.039) [-940.998] -- 0:00:04
Average standard deviation of split frequencies: 0.010488
935500 -- (-944.944) [-942.858] (-947.527) (-944.482) * (-940.500) [-944.311] (-942.084) (-943.966) -- 0:00:04
936000 -- (-941.840) (-940.802) [-943.418] (-944.643) * (-941.561) (-956.169) [-942.260] (-941.356) -- 0:00:04
936500 -- (-943.348) (-941.431) (-942.518) [-942.151] * (-941.528) (-946.886) [-942.290] (-941.508) -- 0:00:04
937000 -- (-945.575) (-942.775) (-944.948) [-942.281] * [-941.224] (-945.770) (-943.241) (-945.427) -- 0:00:04
937500 -- (-947.616) (-940.921) [-940.982] (-944.138) * (-945.894) (-941.525) (-944.985) [-940.964] -- 0:00:04
938000 -- (-942.482) [-941.160] (-942.517) (-943.677) * [-942.451] (-941.914) (-942.275) (-945.662) -- 0:00:04
938500 -- [-945.337] (-941.307) (-941.619) (-943.853) * (-943.333) (-942.188) (-942.095) [-943.035] -- 0:00:04
939000 -- (-942.350) [-941.105] (-941.267) (-944.271) * (-940.811) (-943.319) (-940.578) [-941.155] -- 0:00:04
939500 -- [-943.772] (-940.973) (-946.672) (-946.956) * [-941.828] (-941.776) (-941.082) (-941.699) -- 0:00:04
940000 -- (-946.352) [-943.279] (-943.717) (-943.286) * (-943.222) (-942.488) [-940.390] (-942.168) -- 0:00:04
Average standard deviation of split frequencies: 0.010649
940500 -- (-944.209) (-944.382) (-944.544) [-941.859] * [-942.629] (-944.334) (-942.751) (-942.887) -- 0:00:04
941000 -- (-942.383) (-941.269) (-946.019) [-941.810] * (-941.932) (-942.367) (-940.677) [-941.656] -- 0:00:04
941500 -- (-940.427) (-943.962) (-945.912) [-941.208] * (-941.598) (-941.738) [-940.737] (-942.368) -- 0:00:03
942000 -- (-941.497) (-944.176) (-945.576) [-940.920] * (-945.176) (-941.214) (-940.626) [-940.799] -- 0:00:03
942500 -- (-941.729) (-943.803) (-942.135) [-942.057] * (-942.544) [-941.229] (-940.758) (-941.649) -- 0:00:03
943000 -- [-943.149] (-941.135) (-940.960) (-943.926) * (-945.510) (-940.926) (-942.458) [-943.670] -- 0:00:03
943500 -- (-943.016) (-945.314) (-941.570) [-943.088] * [-942.167] (-942.763) (-942.657) (-946.226) -- 0:00:03
944000 -- (-942.114) (-945.762) (-942.978) [-940.629] * (-941.526) (-942.240) [-941.474] (-941.150) -- 0:00:03
944500 -- [-943.367] (-943.958) (-941.009) (-940.167) * (-944.233) [-942.606] (-944.910) (-940.463) -- 0:00:03
945000 -- (-944.303) (-945.021) (-945.795) [-940.071] * (-942.927) [-943.063] (-943.228) (-941.631) -- 0:00:03
Average standard deviation of split frequencies: 0.010640
945500 -- (-942.206) (-946.500) [-940.181] (-942.329) * (-943.608) (-944.923) [-942.368] (-941.352) -- 0:00:03
946000 -- (-944.171) (-945.309) (-940.837) [-940.762] * [-944.987] (-941.027) (-942.057) (-945.903) -- 0:00:03
946500 -- (-948.856) (-941.909) (-944.665) [-943.719] * (-945.228) [-945.396] (-943.105) (-942.438) -- 0:00:03
947000 -- (-942.964) [-940.945] (-940.977) (-940.899) * (-942.698) [-943.381] (-943.028) (-943.349) -- 0:00:03
947500 -- (-941.185) [-943.285] (-942.960) (-940.419) * (-942.453) [-941.230] (-943.230) (-942.233) -- 0:00:03
948000 -- [-941.573] (-945.783) (-943.981) (-943.088) * (-941.056) (-944.882) (-944.632) [-941.592] -- 0:00:03
948500 -- (-942.231) [-940.700] (-942.561) (-941.957) * (-943.748) (-943.377) (-942.456) [-945.291] -- 0:00:03
949000 -- (-941.089) (-945.824) (-945.450) [-941.234] * (-946.097) [-940.514] (-942.954) (-943.422) -- 0:00:03
949500 -- (-941.878) (-941.191) (-944.063) [-942.392] * [-944.539] (-942.668) (-940.505) (-942.697) -- 0:00:03
950000 -- (-941.694) [-941.258] (-941.611) (-945.272) * (-941.006) (-943.089) (-941.315) [-942.839] -- 0:00:03
Average standard deviation of split frequencies: 0.010754
950500 -- (-942.469) [-941.894] (-942.746) (-943.510) * (-944.216) (-941.906) (-944.266) [-943.676] -- 0:00:03
951000 -- (-943.478) (-946.057) [-941.286] (-945.497) * (-941.106) [-941.004] (-948.567) (-941.016) -- 0:00:03
951500 -- (-944.403) (-942.290) (-942.667) [-942.051] * (-941.154) (-942.411) [-942.364] (-943.882) -- 0:00:03
952000 -- (-943.911) [-944.181] (-940.998) (-941.923) * (-940.807) (-942.108) (-941.279) [-940.635] -- 0:00:03
952500 -- [-944.068] (-940.922) (-941.878) (-943.970) * [-941.940] (-941.420) (-941.504) (-943.055) -- 0:00:03
953000 -- [-941.279] (-941.895) (-940.646) (-943.957) * (-944.655) (-942.801) [-941.420] (-941.975) -- 0:00:03
953500 -- (-945.085) [-940.703] (-941.335) (-943.597) * [-942.703] (-943.953) (-940.550) (-944.558) -- 0:00:03
954000 -- [-940.278] (-940.490) (-940.370) (-941.694) * (-943.881) (-942.418) (-941.201) [-945.545] -- 0:00:03
954500 -- (-943.170) (-942.655) [-940.956] (-944.282) * [-941.788] (-943.549) (-942.792) (-942.178) -- 0:00:03
955000 -- (-942.021) [-943.695] (-945.370) (-942.617) * (-941.928) (-943.473) (-940.431) [-942.313] -- 0:00:03
Average standard deviation of split frequencies: 0.010448
955500 -- [-942.313] (-945.255) (-943.200) (-942.426) * (-940.002) (-946.749) [-941.188] (-941.004) -- 0:00:03
956000 -- (-950.379) (-940.985) [-946.392] (-942.305) * [-941.763] (-944.674) (-941.458) (-941.586) -- 0:00:02
956500 -- [-943.169] (-940.285) (-945.482) (-941.195) * (-942.018) (-941.977) [-941.229] (-943.649) -- 0:00:02
957000 -- (-942.984) (-943.311) (-941.892) [-941.550] * (-947.071) [-943.868] (-947.466) (-944.645) -- 0:00:02
957500 -- [-942.422] (-943.630) (-947.225) (-940.326) * (-940.865) (-941.740) (-942.780) [-943.036] -- 0:00:02
958000 -- (-943.691) (-940.735) (-949.081) [-940.793] * (-942.942) [-944.031] (-941.103) (-947.133) -- 0:00:02
958500 -- [-941.001] (-942.641) (-941.280) (-942.295) * (-941.485) [-942.709] (-943.163) (-947.159) -- 0:00:02
959000 -- (-940.298) [-941.436] (-941.811) (-941.278) * (-940.918) [-944.438] (-944.728) (-943.223) -- 0:00:02
959500 -- (-940.997) (-943.135) [-941.145] (-940.381) * [-944.579] (-942.000) (-946.453) (-947.515) -- 0:00:02
960000 -- (-943.416) (-942.335) (-943.235) [-941.609] * [-942.771] (-942.577) (-940.853) (-942.976) -- 0:00:02
Average standard deviation of split frequencies: 0.010366
960500 -- [-942.066] (-944.163) (-941.111) (-942.462) * [-943.501] (-941.917) (-944.558) (-943.492) -- 0:00:02
961000 -- (-945.200) (-945.733) [-941.952] (-944.742) * (-942.981) [-942.991] (-942.547) (-944.880) -- 0:00:02
961500 -- (-945.684) (-945.501) [-941.442] (-941.185) * (-942.839) (-942.100) (-943.521) [-942.403] -- 0:00:02
962000 -- [-943.808] (-944.094) (-943.849) (-942.742) * [-942.278] (-942.021) (-940.912) (-942.359) -- 0:00:02
962500 -- (-941.860) (-942.159) (-941.881) [-941.253] * (-946.733) (-941.973) (-943.577) [-943.782] -- 0:00:02
963000 -- (-941.411) (-941.233) [-941.737] (-942.230) * [-942.117] (-941.911) (-941.724) (-942.990) -- 0:00:02
963500 -- (-943.878) (-941.483) [-942.802] (-940.726) * (-945.046) [-941.925] (-943.298) (-949.260) -- 0:00:02
964000 -- [-943.550] (-941.692) (-942.951) (-942.986) * (-942.899) (-944.785) [-941.437] (-947.280) -- 0:00:02
964500 -- (-942.000) [-946.945] (-940.778) (-942.440) * [-942.899] (-946.728) (-943.232) (-940.940) -- 0:00:02
965000 -- (-944.202) (-942.963) (-941.508) [-942.503] * [-941.914] (-943.406) (-940.263) (-941.108) -- 0:00:02
Average standard deviation of split frequencies: 0.010621
965500 -- (-940.919) (-941.229) [-941.500] (-942.127) * (-940.101) (-944.625) (-941.828) [-940.879] -- 0:00:02
966000 -- (-941.406) [-941.004] (-940.286) (-943.109) * (-940.051) (-947.541) (-940.498) [-944.202] -- 0:00:02
966500 -- [-940.536] (-942.488) (-942.937) (-940.948) * (-940.612) [-947.221] (-940.539) (-943.796) -- 0:00:02
967000 -- (-941.684) (-942.297) (-944.167) [-941.795] * (-941.287) (-949.068) (-941.997) [-942.903] -- 0:00:02
967500 -- (-944.063) (-943.978) (-942.889) [-942.460] * (-941.526) (-941.138) (-942.407) [-942.063] -- 0:00:02
968000 -- [-941.198] (-943.497) (-946.511) (-943.056) * [-941.070] (-942.518) (-940.667) (-942.155) -- 0:00:02
968500 -- (-941.976) (-942.783) [-940.548] (-941.685) * (-942.135) (-946.572) (-941.647) [-944.156] -- 0:00:02
969000 -- (-941.492) (-942.741) [-941.418] (-943.471) * (-940.069) (-945.778) (-942.032) [-942.952] -- 0:00:02
969500 -- [-940.928] (-941.832) (-943.162) (-943.112) * [-941.097] (-942.457) (-940.544) (-943.506) -- 0:00:02
970000 -- [-940.555] (-942.095) (-944.939) (-940.612) * [-941.308] (-942.792) (-941.642) (-942.443) -- 0:00:02
Average standard deviation of split frequencies: 0.009986
970500 -- (-943.800) [-942.695] (-943.856) (-941.762) * (-941.400) (-941.723) (-941.727) [-941.280] -- 0:00:02
971000 -- (-944.513) (-946.910) [-940.549] (-944.057) * [-942.468] (-943.922) (-941.667) (-941.952) -- 0:00:01
971500 -- [-942.071] (-940.845) (-945.055) (-940.484) * (-941.811) (-942.403) [-940.532] (-942.642) -- 0:00:01
972000 -- [-943.118] (-940.919) (-944.455) (-942.390) * (-941.205) (-942.192) (-949.197) [-941.295] -- 0:00:01
972500 -- (-943.953) [-941.094] (-943.513) (-941.149) * (-944.554) (-940.406) (-944.479) [-943.718] -- 0:00:01
973000 -- (-943.459) [-944.202] (-941.915) (-943.374) * (-943.501) [-940.166] (-948.619) (-941.723) -- 0:00:01
973500 -- (-944.651) [-943.994] (-942.286) (-942.983) * [-941.878] (-942.213) (-944.419) (-941.498) -- 0:00:01
974000 -- [-941.971] (-941.842) (-942.344) (-941.204) * (-942.529) (-942.852) (-941.806) [-941.871] -- 0:00:01
974500 -- [-941.204] (-943.560) (-943.223) (-940.339) * (-943.072) [-941.654] (-942.298) (-942.114) -- 0:00:01
975000 -- (-940.833) [-942.586] (-947.189) (-941.095) * (-941.548) (-942.180) (-940.450) [-943.948] -- 0:00:01
Average standard deviation of split frequencies: 0.009871
975500 -- (-940.627) [-942.018] (-943.679) (-943.474) * [-944.160] (-943.660) (-940.642) (-942.466) -- 0:00:01
976000 -- [-942.431] (-943.316) (-940.780) (-941.192) * (-944.223) (-943.139) [-943.125] (-940.699) -- 0:00:01
976500 -- (-940.674) (-946.505) [-941.126] (-942.760) * (-942.572) [-948.832] (-942.083) (-943.607) -- 0:00:01
977000 -- (-940.531) (-941.807) [-941.079] (-943.710) * (-943.779) (-941.828) [-943.151] (-941.908) -- 0:00:01
977500 -- (-941.495) [-940.618] (-944.281) (-941.455) * (-942.891) (-943.046) (-942.024) [-945.003] -- 0:00:01
978000 -- (-942.294) [-942.977] (-942.250) (-941.485) * (-942.805) [-945.266] (-943.272) (-947.503) -- 0:00:01
978500 -- (-945.980) (-943.877) (-941.806) [-940.330] * (-941.714) [-942.809] (-946.570) (-941.311) -- 0:00:01
979000 -- [-942.721] (-941.166) (-942.142) (-941.986) * (-941.406) [-941.828] (-945.207) (-943.645) -- 0:00:01
979500 -- (-940.837) (-941.107) [-940.677] (-946.729) * (-942.196) (-945.034) (-944.984) [-946.069] -- 0:00:01
980000 -- (-943.774) (-940.968) [-941.122] (-943.274) * (-944.310) [-941.038] (-940.610) (-943.055) -- 0:00:01
Average standard deviation of split frequencies: 0.010095
980500 -- (-944.347) [-943.066] (-941.223) (-946.859) * (-940.719) [-941.080] (-945.581) (-943.807) -- 0:00:01
981000 -- (-943.389) (-943.124) [-942.400] (-944.233) * (-943.292) (-942.792) (-940.606) [-943.726] -- 0:00:01
981500 -- (-942.092) (-941.967) (-942.218) [-943.985] * [-941.749] (-941.110) (-942.878) (-944.047) -- 0:00:01
982000 -- [-943.259] (-945.474) (-942.786) (-941.032) * [-941.207] (-941.633) (-942.736) (-944.893) -- 0:00:01
982500 -- [-943.194] (-941.381) (-947.108) (-944.638) * (-941.111) (-941.013) (-945.077) [-943.863] -- 0:00:01
983000 -- (-942.184) [-941.325] (-940.913) (-947.931) * [-940.898] (-942.593) (-945.037) (-941.424) -- 0:00:01
983500 -- (-945.390) (-941.360) [-941.976] (-944.197) * (-950.348) (-941.780) [-946.287] (-941.849) -- 0:00:01
984000 -- (-942.444) (-941.018) (-942.535) [-947.603] * (-942.265) (-942.654) [-942.492] (-941.018) -- 0:00:01
984500 -- (-945.651) (-942.287) (-941.100) [-943.690] * [-941.484] (-941.335) (-942.777) (-940.896) -- 0:00:01
985000 -- (-943.408) [-942.171] (-941.677) (-943.274) * (-943.271) (-940.913) [-940.614] (-942.187) -- 0:00:01
Average standard deviation of split frequencies: 0.010010
985500 -- (-942.282) (-940.817) [-942.300] (-942.803) * (-943.883) (-943.591) [-940.510] (-940.255) -- 0:00:00
986000 -- (-942.274) (-942.938) [-940.939] (-944.417) * (-942.338) (-940.495) (-941.123) [-941.247] -- 0:00:00
986500 -- (-942.452) (-941.039) (-943.734) [-943.383] * (-943.314) (-943.448) (-940.345) [-942.637] -- 0:00:00
987000 -- (-941.787) (-940.574) (-942.496) [-942.441] * (-941.472) (-941.073) [-941.171] (-946.008) -- 0:00:00
987500 -- [-941.258] (-942.823) (-942.615) (-941.815) * (-941.794) (-946.407) (-940.824) [-946.070] -- 0:00:00
988000 -- (-949.644) [-942.342] (-940.424) (-942.510) * (-940.721) [-940.453] (-943.209) (-942.471) -- 0:00:00
988500 -- (-945.277) (-941.600) [-941.890] (-943.377) * (-940.359) (-946.067) [-941.678] (-942.734) -- 0:00:00
989000 -- (-941.381) (-941.650) (-941.683) [-943.485] * (-943.450) [-945.917] (-940.431) (-942.871) -- 0:00:00
989500 -- (-941.328) [-942.867] (-941.760) (-943.400) * (-941.474) (-941.229) (-942.502) [-942.154] -- 0:00:00
990000 -- (-942.758) [-943.462] (-940.836) (-946.523) * (-941.887) (-943.566) (-941.109) [-942.239] -- 0:00:00
Average standard deviation of split frequencies: 0.010469
990500 -- [-942.626] (-942.398) (-942.037) (-940.741) * [-942.802] (-946.369) (-943.414) (-941.480) -- 0:00:00
991000 -- (-943.243) (-941.429) [-945.149] (-940.913) * (-944.966) (-942.546) (-943.998) [-942.948] -- 0:00:00
991500 -- (-940.824) (-941.945) [-942.057] (-941.558) * (-941.138) (-943.372) (-941.094) [-940.589] -- 0:00:00
992000 -- (-945.161) [-942.418] (-943.119) (-942.540) * (-943.323) (-945.296) [-950.384] (-945.795) -- 0:00:00
992500 -- (-945.587) [-941.775] (-943.597) (-943.109) * [-943.025] (-942.595) (-948.254) (-942.109) -- 0:00:00
993000 -- (-941.555) [-940.561] (-944.312) (-944.352) * (-943.804) (-946.770) [-942.916] (-940.385) -- 0:00:00
993500 -- (-944.137) (-944.581) (-943.040) [-940.951] * [-941.281] (-942.509) (-941.053) (-941.273) -- 0:00:00
994000 -- (-941.489) [-942.243] (-942.797) (-947.294) * (-943.540) (-943.017) (-943.746) [-942.551] -- 0:00:00
994500 -- [-940.547] (-940.536) (-941.963) (-945.523) * (-940.723) (-942.878) [-940.730] (-943.763) -- 0:00:00
995000 -- [-942.938] (-941.819) (-942.580) (-944.325) * (-943.099) (-946.821) [-940.819] (-941.870) -- 0:00:00
Average standard deviation of split frequencies: 0.010768
995500 -- (-944.545) (-940.121) [-942.691] (-945.818) * (-941.317) [-941.062] (-941.694) (-945.822) -- 0:00:00
996000 -- (-945.182) (-942.355) [-942.672] (-942.191) * (-940.924) [-941.097] (-942.912) (-942.591) -- 0:00:00
996500 -- (-947.787) [-941.976] (-941.255) (-946.111) * (-941.893) (-941.762) (-943.781) [-942.067] -- 0:00:00
997000 -- (-943.652) (-941.043) (-943.796) [-941.062] * [-941.421] (-941.599) (-941.840) (-941.131) -- 0:00:00
997500 -- [-943.498] (-941.720) (-942.495) (-940.332) * (-942.656) (-941.171) (-941.143) [-943.361] -- 0:00:00
998000 -- (-943.110) [-941.739] (-942.426) (-941.007) * (-943.162) [-944.318] (-940.478) (-942.394) -- 0:00:00
998500 -- (-943.148) [-943.335] (-946.068) (-944.052) * (-942.493) (-942.554) (-942.859) [-940.263] -- 0:00:00
999000 -- [-942.430] (-945.180) (-941.602) (-941.440) * [-941.476] (-943.062) (-948.981) (-942.914) -- 0:00:00
999500 -- (-940.063) (-944.686) (-944.469) [-943.442] * (-940.785) [-941.727] (-942.022) (-944.034) -- 0:00:00
1000000 -- [-940.143] (-941.729) (-943.293) (-942.372) * (-940.319) [-940.575] (-940.403) (-940.942) -- 0:00:00
Average standard deviation of split frequencies: 0.010423
Analysis completed in 1 mins 8 seconds
Analysis used 66.94 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -939.85
Likelihood of best state for "cold" chain of run 2 was -939.85
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.2 % ( 28 %) Dirichlet(Pi{all})
29.4 % ( 33 %) Slider(Pi{all})
78.5 % ( 57 %) Multiplier(Alpha{1,2})
77.8 % ( 59 %) Multiplier(Alpha{3})
20.7 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 96 %) ExtSPR(Tau{all},V{all})
70.5 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.7 % ( 27 %) Dirichlet(Pi{all})
29.7 % ( 23 %) Slider(Pi{all})
78.0 % ( 49 %) Multiplier(Alpha{1,2})
77.6 % ( 50 %) Multiplier(Alpha{3})
20.2 % ( 26 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 98 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166567 0.82 0.66
3 | 166890 166756 0.84
4 | 166160 166592 167035
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166115 0.82 0.67
3 | 166489 167197 0.84
4 | 166496 166824 166879
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -941.53
| 2 |
| 2 2 2 2 |
|2 2 1 1 2 |
| 2 1 2 1 |
| 2 2 2 212 2 1 11 2 22 2 1 |
| 11 1 2 11 * 1 |
| 12 * 1 21 2 11 1 11 112 2 1|
|1 11 11 1 2 1 2 12 2 * 12 1 |
| 1 11 11 2 1 1 * 1 2|
| 2 2 1 2 1 2 |
| 2 2 2 1 2 2 2 2 |
| * 2 1 1 21 1 1 1 2 |
| 2 2 2 2 2 2 |
| 1 2 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -943.19
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.59 -944.19
2 -941.55 -945.00
--------------------------------------
TOTAL -941.57 -944.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898633 0.090044 0.369331 1.477656 0.864189 1501.00 1501.00 1.000
r(A<->C){all} 0.163370 0.019185 0.000108 0.444501 0.127415 111.77 141.68 1.000
r(A<->G){all} 0.186540 0.022880 0.000018 0.499533 0.149421 127.36 199.90 1.001
r(A<->T){all} 0.161611 0.018690 0.000025 0.435915 0.127294 245.82 287.42 1.000
r(C<->G){all} 0.159448 0.018673 0.000225 0.439473 0.122466 294.70 333.31 1.000
r(C<->T){all} 0.160188 0.017473 0.000197 0.433794 0.128456 187.53 213.20 1.001
r(G<->T){all} 0.168843 0.019482 0.000023 0.450528 0.135072 234.90 280.15 1.000
pi(A){all} 0.191934 0.000223 0.162569 0.220639 0.191953 1079.47 1136.86 1.000
pi(C){all} 0.325191 0.000296 0.293771 0.360587 0.324377 1130.05 1228.52 1.000
pi(G){all} 0.305891 0.000287 0.273584 0.340063 0.305684 1366.21 1378.33 1.000
pi(T){all} 0.176984 0.000207 0.148432 0.204857 0.176696 1290.50 1358.99 1.000
alpha{1,2} 0.423492 0.231512 0.000191 1.358642 0.256990 1220.72 1263.91 1.000
alpha{3} 0.462183 0.240420 0.000169 1.469697 0.302169 1268.04 1306.05 1.000
pinvar{all} 0.997759 0.000007 0.992821 0.999999 0.998620 1104.67 1198.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- ..**..
10 -- .**...
11 -- .*.***
12 -- ....**
13 -- ..*.*.
14 -- ..****
15 -- ..*..*
16 -- .*...*
17 -- ...**.
18 -- .**.**
19 -- .***.*
20 -- .****.
21 -- .*.*..
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 482 0.160560 0.000942 0.159893 0.161226 2
8 450 0.149900 0.022612 0.133911 0.165889 2
9 447 0.148901 0.024968 0.131246 0.166556 2
10 443 0.147568 0.003298 0.145237 0.149900 2
11 440 0.146569 0.001884 0.145237 0.147901 2
12 435 0.144903 0.011777 0.136576 0.153231 2
13 434 0.144570 0.000000 0.144570 0.144570 2
14 432 0.143904 0.016017 0.132578 0.155230 2
15 422 0.140573 0.008480 0.134577 0.146569 2
16 421 0.140240 0.015546 0.129247 0.151233 2
17 417 0.138907 0.002355 0.137242 0.140573 2
18 413 0.137575 0.008009 0.131912 0.143238 2
19 409 0.136243 0.006124 0.131912 0.140573 2
20 396 0.131912 0.003769 0.129247 0.134577 2
21 393 0.130913 0.024968 0.113258 0.148568 2
22 276 0.091939 0.016017 0.080613 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098639 0.010073 0.000041 0.297696 0.068431 1.000 2
length{all}[2] 0.099367 0.009367 0.000065 0.289866 0.070581 1.000 2
length{all}[3] 0.098858 0.009646 0.000091 0.292298 0.067509 1.000 2
length{all}[4] 0.099437 0.009431 0.000075 0.288217 0.069488 1.001 2
length{all}[5] 0.101985 0.010172 0.000008 0.300877 0.070898 1.000 2
length{all}[6] 0.101961 0.010262 0.000083 0.306515 0.070576 1.000 2
length{all}[7] 0.090383 0.007639 0.000097 0.281655 0.063749 1.000 2
length{all}[8] 0.094095 0.007479 0.000331 0.277760 0.069508 1.001 2
length{all}[9] 0.099913 0.010174 0.000171 0.296452 0.072282 0.998 2
length{all}[10] 0.098248 0.009113 0.000704 0.294183 0.069201 1.001 2
length{all}[11] 0.098838 0.011553 0.000309 0.300853 0.065120 0.998 2
length{all}[12] 0.096388 0.010244 0.000118 0.269993 0.070946 1.008 2
length{all}[13] 0.108544 0.010021 0.000890 0.286181 0.081207 0.999 2
length{all}[14] 0.099132 0.011063 0.000196 0.311773 0.068263 0.998 2
length{all}[15] 0.095983 0.009795 0.000377 0.278662 0.066962 0.998 2
length{all}[16] 0.100286 0.008944 0.000102 0.300775 0.075436 0.998 2
length{all}[17] 0.103555 0.010178 0.000050 0.325427 0.068176 0.999 2
length{all}[18] 0.107956 0.011682 0.000480 0.336826 0.073027 0.998 2
length{all}[19] 0.095489 0.010087 0.000115 0.276240 0.063924 0.998 2
length{all}[20] 0.101648 0.009204 0.000186 0.291825 0.072463 0.999 2
length{all}[21] 0.101038 0.009237 0.000497 0.300689 0.076906 1.004 2
length{all}[22] 0.103592 0.010817 0.000079 0.288283 0.073282 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010423
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 232 / 232 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 232 / 232 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066750 0.085002 0.054496 0.013493 0.086114 0.023766 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -981.144297
Iterating by ming2
Initial: fx= 981.144297
x= 0.06675 0.08500 0.05450 0.01349 0.08611 0.02377 0.30000 1.30000
1 h-m-p 0.0000 0.0001 559.6054 ++ 962.778060 m 0.0001 13 | 1/8
2 h-m-p 0.0012 0.0582 24.8000 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 511.3545 ++ 951.079987 m 0.0000 44 | 2/8
4 h-m-p 0.0010 0.0688 21.2963 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 457.3976 ++ 922.856810 m 0.0001 75 | 3/8
6 h-m-p 0.0028 0.0819 19.1999 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 398.0076 ++ 914.330066 m 0.0001 107 | 4/8
8 h-m-p 0.0010 0.1024 18.0413 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 325.3487 ++ 905.807809 m 0.0001 138 | 5/8
10 h-m-p 0.0013 0.1478 13.8495 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 230.8495 ++ 905.546903 m 0.0000 169 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546903 m 8.0000 207 | 6/8
14 h-m-p 0.0002 0.1167 3.2067 ----------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546903 m 8.0000 242 | 6/8
16 h-m-p 0.0323 8.0000 0.0084 --------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546903 m 8.0000 283 | 6/8
18 h-m-p 0.0062 3.0953 0.7028 ++++Y 905.546874 0 1.9625 300 | 6/8
19 h-m-p 0.5055 2.5277 0.3149 C 905.546874 0 0.5553 313 | 6/8
20 h-m-p 1.6000 8.0000 0.0470 Y 905.546874 0 0.8186 326 | 6/8
21 h-m-p 1.6000 8.0000 0.0008 ++ 905.546874 m 8.0000 339 | 6/8
22 h-m-p 1.4940 8.0000 0.0044 +Y 905.546874 0 6.7912 353 | 6/8
23 h-m-p 1.6000 8.0000 0.0018 ++ 905.546873 m 8.0000 366 | 6/8
24 h-m-p 0.0686 8.0000 0.2127 ---------C 905.546873 0 0.0000 388 | 6/8
25 h-m-p 0.0005 0.2729 1.1440 +++++ 905.546866 m 0.2729 404 | 7/8
26 h-m-p 0.7653 8.0000 0.0357 ++ 905.546849 m 8.0000 415 | 7/8
27 h-m-p 0.1416 8.0000 2.0178 -------------Y 905.546849 0 0.0000 440 | 7/8
28 h-m-p 0.0161 8.0000 0.0000 -----C 905.546849 0 0.0000 456 | 7/8
29 h-m-p 0.0164 8.0000 0.0000 -----Y 905.546849 0 0.0000 473
Out..
lnL = -905.546849
474 lfun, 474 eigenQcodon, 2844 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097755 0.058939 0.104338 0.052280 0.070378 0.050225 1.341335 0.811441 0.230539
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.539924
np = 9
lnL0 = -1000.069474
Iterating by ming2
Initial: fx= 1000.069474
x= 0.09775 0.05894 0.10434 0.05228 0.07038 0.05022 1.34133 0.81144 0.23054
1 h-m-p 0.0000 0.0002 509.9145 +++ 935.715660 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 427.9500 ++ 933.390410 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 2661.0276 ++ 926.935562 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 5417.6042 ++ 918.979485 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 3037.7773 ++ 906.875156 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 1999.0925 ++ 905.546869 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 905.546869 m 8.0000 87 | 6/9
8 h-m-p 0.0152 3.1347 0.0172 ++++ 905.546866 m 3.1347 104 | 7/9
9 h-m-p 0.2171 3.4346 0.2465 -----------Y 905.546866 0 0.0000 130 | 7/9
10 h-m-p 0.0160 8.0000 0.0015 +++++ 905.546866 m 8.0000 147 | 7/9
11 h-m-p 0.0508 3.9531 0.2413 --------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 905.546866 m 8.0000 190 | 7/9
13 h-m-p 0.0073 3.6460 0.2345 -------------.. | 7/9
14 h-m-p 0.0160 8.0000 0.0001 +++++ 905.546866 m 8.0000 232 | 7/9
15 h-m-p 0.0075 3.7603 0.2275 ---------C 905.546866 0 0.0000 255 | 7/9
16 h-m-p 0.0160 8.0000 0.0018 +++++ 905.546865 m 8.0000 272 | 7/9
17 h-m-p 0.0602 3.9838 0.2398 ----------Y 905.546865 0 0.0000 296 | 7/9
18 h-m-p 0.0160 8.0000 0.0001 ----N 905.546865 0 0.0000 314 | 7/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546865 m 8.0000 331 | 7/9
20 h-m-p 0.0081 4.0678 0.2455 -----------C 905.546865 0 0.0000 356 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546865 m 8.0000 373 | 7/9
22 h-m-p 0.0056 2.7873 0.2814 ------------.. | 7/9
23 h-m-p 0.0160 8.0000 0.0001 +++++ 905.546865 m 8.0000 414 | 7/9
24 h-m-p 0.0073 3.6599 0.2374 ------------Y 905.546865 0 0.0000 440 | 7/9
25 h-m-p 0.0160 8.0000 0.0023 +++++ 905.546864 m 8.0000 457 | 7/9
26 h-m-p 0.0772 3.5256 0.2373 -------------Y 905.546864 0 0.0000 484 | 7/9
27 h-m-p 0.0160 8.0000 0.0000 -----Y 905.546864 0 0.0000 503 | 7/9
28 h-m-p 0.0160 8.0000 0.0000 ------------Y 905.546864 0 0.0000 529
Out..
lnL = -905.546864
530 lfun, 1590 eigenQcodon, 6360 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.050120 0.024266 0.050024 0.037047 0.094353 0.084978 1.292947 1.527885 0.233306 0.332853 2.537269
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.087233
np = 11
lnL0 = -976.752997
Iterating by ming2
Initial: fx= 976.752997
x= 0.05012 0.02427 0.05002 0.03705 0.09435 0.08498 1.29295 1.52788 0.23331 0.33285 2.53727
1 h-m-p 0.0000 0.0001 471.1272 ++ 948.028911 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 160.5370 ++ 933.261863 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 13406.9388 ++ 922.119405 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 1542.2160 ++ 922.052333 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 6957.1671 ++ 911.430727 m 0.0000 72 | 5/11
6 h-m-p 0.0030 0.0148 7.1305 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 312.2131 ++ 907.448195 m 0.0000 110 | 6/11
8 h-m-p 0.0160 8.0000 2.5664 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 226.4362 ++ 905.546875 m 0.0000 149 | 7/11
10 h-m-p 0.0701 8.0000 0.0000 ++++ 905.546875 m 8.0000 165 | 7/11
11 h-m-p 0.0186 8.0000 0.0023 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 215 | 7/11
13 h-m-p 0.0160 8.0000 0.4593 -----------Y 905.546875 0 0.0000 244 | 7/11
14 h-m-p 0.0160 8.0000 0.0074 +++++ 905.546875 m 8.0000 265 | 7/11
15 h-m-p 0.0675 8.0000 0.8715 --------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 316 | 7/11
17 h-m-p 0.0160 8.0000 0.1648 ------------Y 905.546875 0 0.0000 346 | 7/11
18 h-m-p 0.0160 8.0000 0.0006 +++++ 905.546875 m 8.0000 367 | 7/11
19 h-m-p 0.0160 8.0000 0.5359 --------C 905.546875 0 0.0000 393 | 7/11
20 h-m-p 0.0160 8.0000 0.0008 -----N 905.546875 0 0.0000 416 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 437 | 7/11
22 h-m-p 0.0160 8.0000 5.5007 ----------Y 905.546875 0 0.0000 465 | 7/11
23 h-m-p 0.0160 8.0000 0.0010 +++++ 905.546875 m 8.0000 482 | 7/11
24 h-m-p 0.0160 8.0000 0.5494 --------Y 905.546875 0 0.0000 508 | 7/11
25 h-m-p 0.0160 8.0000 0.0002 +++++ 905.546875 m 8.0000 529 | 7/11
26 h-m-p 0.0160 8.0000 0.4782 -------Y 905.546875 0 0.0000 554 | 7/11
27 h-m-p 0.0160 8.0000 0.0006 +++++ 905.546875 m 8.0000 575 | 7/11
28 h-m-p 0.0160 8.0000 0.5990 ----------C 905.546875 0 0.0000 603 | 7/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 624 | 7/11
30 h-m-p 0.0160 8.0000 0.5711 --------C 905.546875 0 0.0000 650 | 7/11
31 h-m-p 0.0160 8.0000 0.0002 +++++ 905.546875 m 8.0000 671 | 7/11
32 h-m-p 0.0160 8.0000 0.6880 -------------.. | 7/11
33 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 721 | 7/11
34 h-m-p 0.0160 8.0000 0.1617 --------C 905.546875 0 0.0000 747 | 7/11
35 h-m-p 0.0160 8.0000 0.0001 ----C 905.546875 0 0.0000 769 | 7/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 790 | 7/11
37 h-m-p 0.0160 8.0000 0.4364 -------------.. | 7/11
38 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546875 m 8.0000 840 | 7/11
39 h-m-p 0.0116 5.7922 0.7338 +++++ 905.546707 m 5.7922 861 | 8/11
40 h-m-p 0.0540 1.5151 75.0780 --------------.. | 8/11
41 h-m-p 0.0160 8.0000 0.0000 +++++ 905.546707 m 8.0000 908 | 8/11
42 h-m-p 0.0389 8.0000 0.0019 ++++ 905.546707 m 8.0000 927 | 8/11
43 h-m-p 0.0157 0.3743 0.9623 +++ 905.546704 m 0.3743 945 | 9/11
44 h-m-p 0.5071 8.0000 0.6189 ++ 905.546699 m 8.0000 962 | 9/11
45 h-m-p 1.6000 8.0000 0.0363 ++ 905.546699 m 8.0000 978 | 9/11
46 h-m-p 0.3325 8.0000 0.8733 +++ 905.546699 m 8.0000 995 | 9/11
47 h-m-p 1.6000 8.0000 0.0581 ++ 905.546699 m 8.0000 1011 | 9/11
48 h-m-p 1.6000 8.0000 0.1721 ------Y 905.546699 0 0.0001 1033 | 9/11
49 h-m-p 0.0060 2.9948 29.6844 +++Y 905.546699 0 0.3833 1052 | 9/11
50 h-m-p 1.6000 8.0000 0.0000 N 905.546699 0 1.6000 1066 | 9/11
51 h-m-p 0.0160 8.0000 0.0000 Y 905.546699 0 0.0160 1082
Out..
lnL = -905.546699
1083 lfun, 4332 eigenQcodon, 19494 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -905.597379 S = -905.547725 -0.019182
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:07
did 20 / 56 patterns 0:07
did 30 / 56 patterns 0:07
did 40 / 56 patterns 0:07
did 50 / 56 patterns 0:07
did 56 / 56 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069869 0.109752 0.061363 0.030509 0.067026 0.011791 0.000100 0.506502 1.800514
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.160715
np = 9
lnL0 = -980.667016
Iterating by ming2
Initial: fx= 980.667016
x= 0.06987 0.10975 0.06136 0.03051 0.06703 0.01179 0.00011 0.50650 1.80051
1 h-m-p 0.0000 0.0000 500.3362 ++ 980.240306 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0074 50.4455 +++++ 967.189650 m 0.0074 29 | 2/9
3 h-m-p 0.0001 0.0003 135.8413 ++ 953.499520 m 0.0003 41 | 3/9
4 h-m-p 0.0003 0.0013 99.6813 ++ 943.987787 m 0.0013 53 | 4/9
5 h-m-p 0.0000 0.0000 11776.5993 ++ 923.093555 m 0.0000 65 | 5/9
6 h-m-p 0.0001 0.0007 80.5232 ++ 916.851745 m 0.0007 77 | 6/9
7 h-m-p 0.0001 0.0012 297.2450 ++ 905.546805 m 0.0012 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 -------C 905.546805 0 0.0000 108 | 7/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 905.546805 m 8.0000 125 | 7/9
10 h-m-p 0.0063 3.1392 0.7230 -----------Y 905.546805 0 0.0000 150 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 ---C 905.546805 0 0.0001 167 | 7/9
12 h-m-p 0.0160 8.0000 0.0001 ----C 905.546805 0 0.0000 185
Out..
lnL = -905.546805
186 lfun, 2046 eigenQcodon, 11160 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.077940 0.075167 0.025230 0.104519 0.026266 0.063040 0.000100 0.900000 0.558578 1.613750 2.076945
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.595171
np = 11
lnL0 = -979.534869
Iterating by ming2
Initial: fx= 979.534869
x= 0.07794 0.07517 0.02523 0.10452 0.02627 0.06304 0.00011 0.90000 0.55858 1.61375 2.07694
1 h-m-p 0.0000 0.0000 434.7775 ++ 979.184382 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 470.5860 +++ 950.962070 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 774.0895 ++ 949.984414 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0084 69.7268 ++++ 912.621760 m 0.0084 61 | 4/11
5 h-m-p 0.0000 0.0000 1684.0804 ++ 911.015048 m 0.0000 75 | 5/11
6 h-m-p 0.0002 0.0010 10.0935 ++ 910.961344 m 0.0010 89 | 6/11
7 h-m-p 0.0000 0.0000 121.0291 ++ 910.398657 m 0.0000 103 | 7/11
8 h-m-p 0.0000 0.0145 19.1099 +++++ 905.546764 m 0.0145 120 | 8/11
9 h-m-p 1.6000 8.0000 0.0008 ++ 905.546755 m 8.0000 134 | 8/11
10 h-m-p 0.0866 8.0000 0.0783 ------------C 905.546755 0 0.0000 163 | 8/11
11 h-m-p 0.0012 0.6001 0.0542 +++++ 905.546699 m 0.6001 183 | 9/11
12 h-m-p 1.6000 8.0000 0.0000 ----Y 905.546699 0 0.0016 204
Out..
lnL = -905.546699
205 lfun, 2460 eigenQcodon, 13530 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -905.612271 S = -905.547724 -0.028719
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:14
did 20 / 56 patterns 0:14
did 30 / 56 patterns 0:14
did 40 / 56 patterns 0:14
did 50 / 56 patterns 0:15
did 56 / 56 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
NC_002677_1_NP_301989_1_861_ML1391 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT
**************************************************
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
NC_002677_1_NP_301989_1_861_ML1391 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG
**************************************************
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
NC_002677_1_NP_301989_1_861_ML1391 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA
**************************************************
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
NC_002677_1_NP_301989_1_861_ML1391 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV
**************************************************
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
NC_002677_1_NP_301989_1_861_ML1391 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
********************************
>NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG >NC_002677_1_NP_301989_1_861_ML1391 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG >NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG >NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG >NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG >NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 ATGACAGCCTCGATCGATCCCGTCAACGACTACACCGGGCACGTTGACCC GGGTACCGCGGCCCGCCGGGCCCTACCCGGCGCCACAATCCTGAAGGTGT CGGTAGGCCCGATGGACAACAACGCCTACCTGGTGACGTGTTCGGCTACC GGAGAAACACTTCTGATTGACGCTGCCAATGATGCCGAGGTGCTTATCGA TCTGGTCCAACGCTACGCCCCGAAGCTGTCGTTGATTGTGACCAGCCATC AGCACTTTGATCACTGGCAGGCACTGGAAGCGGTGGTCGCGGCCACCGGT GCGCCAACCGCCGTGCATGAGCTCGACGCCGAACCGCTGCCGGTCAGGCC GGACCGTTTGTTGACCAATGGTGACTGCGTGCAGATTGGGGAGCTGACGT TCGACGTTATTCACCTGCGCGGGCACACGCCCGGATCAATCGCGCTGGCG CTCGACGGAGCCACCTCTGGCCCAAAAACTGGGAGAGTCACGCAGTTGTT CACTGGCGACTGCCTGTTCCCCGGGGGCGTTGGCAAGACGTGGCAGCGCA GTGACTTCACCCAACTGCTCGACGACGTCACCACCCGAGTGTTCGATGTG TACGCGGACACTACAGCCATCTACCCCGGCCACGGCGACGACACAGTACT CGGCGCCGAGCGTCCCAGCCTGGCAGAATGGCGTGAGCGTGGCTGG
>NC_011896_1_WP_010908310_1_1470_MLBR_RS06950 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW >NC_002677_1_NP_301989_1_861_ML1391 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW >NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW >NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW >NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW >NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780 MTASIDPVNDYTGHVDPGTAARRALPGATILKVSVGPMDNNAYLVTCSAT GETLLIDAANDAEVLIDLVQRYAPKLSLIVTSHQHFDHWQALEAVVAATG APTAVHELDAEPLPVRPDRLLTNGDCVQIGELTFDVIHLRGHTPGSIALA LDGATSGPKTGRVTQLFTGDCLFPGGVGKTWQRSDFTQLLDDVTTRVFDV YADTTAIYPGHGDDTVLGAERPSLAEWRERGW
#NEXUS
[ID: 5195715323]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908310_1_1470_MLBR_RS06950
NC_002677_1_NP_301989_1_861_ML1391
NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105
NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655
NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600
NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908310_1_1470_MLBR_RS06950,
2 NC_002677_1_NP_301989_1_861_ML1391,
3 NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105,
4 NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655,
5 NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600,
6 NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06843092,2:0.07058065,3:0.06750893,4:0.06948795,5:0.07089773,6:0.0705761);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06843092,2:0.07058065,3:0.06750893,4:0.06948795,5:0.07089773,6:0.0705761);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.59 -944.19
2 -941.55 -945.00
--------------------------------------
TOTAL -941.57 -944.68
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898633 0.090044 0.369331 1.477656 0.864189 1501.00 1501.00 1.000
r(A<->C){all} 0.163370 0.019185 0.000108 0.444501 0.127415 111.77 141.68 1.000
r(A<->G){all} 0.186540 0.022880 0.000018 0.499533 0.149421 127.36 199.90 1.001
r(A<->T){all} 0.161611 0.018690 0.000025 0.435915 0.127294 245.82 287.42 1.000
r(C<->G){all} 0.159448 0.018673 0.000225 0.439473 0.122466 294.70 333.31 1.000
r(C<->T){all} 0.160188 0.017473 0.000197 0.433794 0.128456 187.53 213.20 1.001
r(G<->T){all} 0.168843 0.019482 0.000023 0.450528 0.135072 234.90 280.15 1.000
pi(A){all} 0.191934 0.000223 0.162569 0.220639 0.191953 1079.47 1136.86 1.000
pi(C){all} 0.325191 0.000296 0.293771 0.360587 0.324377 1130.05 1228.52 1.000
pi(G){all} 0.305891 0.000287 0.273584 0.340063 0.305684 1366.21 1378.33 1.000
pi(T){all} 0.176984 0.000207 0.148432 0.204857 0.176696 1290.50 1358.99 1.000
alpha{1,2} 0.423492 0.231512 0.000191 1.358642 0.256990 1220.72 1263.91 1.000
alpha{3} 0.462183 0.240420 0.000169 1.469697 0.302169 1268.04 1306.05 1.000
pinvar{all} 0.997759 0.000007 0.992821 0.999999 0.998620 1104.67 1198.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1391/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 232
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 0 0 0 0 0 0 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 4 4 4 4 4 4 | CCC 6 6 6 6 6 6 | CAC 6 6 6 6 6 6 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 13 13 13 13 13 13 | CCG 6 6 6 6 6 6 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 3 3 3 3 3 3 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 11 11 11 11 11 11 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 5 5 5 5 5 5 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 5 5 5 5 5 5 | Gly GGT 3 3 3 3 3 3
GTC 6 6 6 6 6 6 | GCC 14 14 14 14 14 14 | GAC 16 16 16 16 16 16 | GGC 10 10 10 10 10 10
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 9 9 9 9 9 9 | GCG 7 7 7 7 7 7 | GAG 5 5 5 5 5 5 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908310_1_1470_MLBR_RS06950
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
#2: NC_002677_1_NP_301989_1_861_ML1391
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
#3: NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
#4: NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
#5: NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
#6: NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 6
TTC 30 | TCC 0 | TAC 30 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 24
CTC 24 | CCC 36 | CAC 36 | CGC 24
CTA 6 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 78 | CCG 36 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 18 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 66 | AAC 18 | AGC 12
ATA 0 | ACA 30 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 12 | ACG 30 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 30 | Gly G GGT 18
GTC 36 | GCC 84 | GAC 96 | GGC 60
GTA 12 | GCA 12 | Glu E GAA 24 | GGA 18
GTG 54 | GCG 42 | GAG 30 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12069 C:0.25431 A:0.21121 G:0.41379
position 2: T:0.26293 C:0.29741 A:0.25431 G:0.18534
position 3: T:0.14655 C:0.42672 A:0.10776 G:0.31897
Average T:0.17672 C:0.32615 A:0.19109 G:0.30603
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -905.546849 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.341335 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908310_1_1470_MLBR_RS06950: 0.000004, NC_002677_1_NP_301989_1_861_ML1391: 0.000004, NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105: 0.000004, NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655: 0.000004, NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600: 0.000004, NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.34133
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 533.8 162.2 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -905.546864 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.292947 0.802277 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908310_1_1470_MLBR_RS06950: 0.000004, NC_002677_1_NP_301989_1_861_ML1391: 0.000004, NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105: 0.000004, NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655: 0.000004, NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600: 0.000004, NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.29295
MLEs of dN/dS (w) for site classes (K=2)
p: 0.80228 0.19772
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
7..2 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
7..3 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
7..4 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
7..5 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
7..6 0.000 534.1 161.9 0.1977 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -905.546699 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908310_1_1470_MLBR_RS06950: 0.000004, NC_002677_1_NP_301989_1_861_ML1391: 0.000004, NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105: 0.000004, NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655: 0.000004, NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600: 0.000004, NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908310_1_1470_MLBR_RS06950)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -905.546805 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.410624 1.720317
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908310_1_1470_MLBR_RS06950: 0.000004, NC_002677_1_NP_301989_1_861_ML1391: 0.000004, NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105: 0.000004, NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655: 0.000004, NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600: 0.000004, NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.41062 q = 1.72032
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00035 0.00509 0.01777 0.04081 0.07668 0.12848 0.20073 0.30100 0.44491 0.68223
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
7..2 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
7..3 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
7..4 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
7..5 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
7..6 0.000 546.8 149.2 0.1898 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -905.546699 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.779910 2.389563
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908310_1_1470_MLBR_RS06950: 0.000004, NC_002677_1_NP_301989_1_861_ML1391: 0.000004, NZ_LVXE01000004_1_WP_010908310_1_1795_A3216_RS03105: 0.000004, NZ_LYPH01000077_1_WP_010908310_1_2628_A8144_RS12655: 0.000004, NZ_CP029543_1_WP_010908310_1_1492_DIJ64_RS07600: 0.000004, NZ_AP014567_1_WP_010908310_1_1528_JK2ML_RS07780: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.77991
(p1 = 0.00001) w = 2.38956
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.38956
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 546.8 149.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908310_1_1470_MLBR_RS06950)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.101 0.100 0.099 0.098 0.097 0.097 0.096
Time used: 0:15
Model 1: NearlyNeutral -905.546864 Model 2: PositiveSelection -905.546699 Model 0: one-ratio -905.546849 Model 7: beta -905.546805 Model 8: beta&w>1 -905.546699 Model 0 vs 1 3.0000000151630957E-5 Model 2 vs 1 3.300000000763248E-4 Model 8 vs 7 2.119999999194988E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
