--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:38:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1420/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -481.94 -484.96
2 -482.00 -485.52
--------------------------------------
TOTAL -481.97 -485.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.493803 0.049979 0.098319 0.908808 0.460375 1422.46 1461.73 1.000
r(A<->C){all} 0.164120 0.019562 0.000023 0.450320 0.126580 248.53 318.83 1.003
r(A<->G){all} 0.163431 0.019302 0.000048 0.446966 0.128991 189.08 361.80 1.001
r(A<->T){all} 0.177890 0.023232 0.000032 0.479470 0.134280 281.18 312.63 1.000
r(C<->G){all} 0.169087 0.021450 0.000182 0.465745 0.129519 138.23 288.20 1.000
r(C<->T){all} 0.153732 0.017696 0.000039 0.424237 0.118670 202.68 263.50 1.001
r(G<->T){all} 0.171741 0.020661 0.000174 0.445715 0.134153 126.24 263.56 1.012
pi(A){all} 0.202650 0.000456 0.161798 0.244154 0.202081 1176.33 1338.66 1.000
pi(C){all} 0.279945 0.000561 0.235559 0.327422 0.279044 1101.89 1301.45 1.000
pi(G){all} 0.311842 0.000606 0.267041 0.361533 0.311002 1425.76 1443.77 1.000
pi(T){all} 0.205564 0.000465 0.164795 0.250492 0.205013 1344.52 1345.62 1.000
alpha{1,2} 0.414742 0.231755 0.000284 1.393955 0.242907 1266.71 1348.71 1.000
alpha{3} 0.455360 0.247029 0.000145 1.418264 0.290845 1162.31 1223.88 1.000
pinvar{all} 0.994866 0.000038 0.983631 0.999997 0.996803 1215.45 1295.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -469.079411
Model 2: PositiveSelection -469.079418
Model 0: one-ratio -469.079425
Model 7: beta -469.079413
Model 8: beta&w>1 -469.079422
Model 0 vs 1 2.8000000042993634E-5
Model 2 vs 1 1.3999999964653398E-5
Model 8 vs 7 1.8000000068241206E-5
>C1
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C2
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C3
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C4
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=117
C1 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C2 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C3 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C4 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
**************************************************
C1 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C2 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C3 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C4 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
**************************************************
C1 SHTPCCRYRLYRNKAAQ
C2 SHTPCCRYRLYRNKAAQ
C3 SHTPCCRYRLYRNKAAQ
C4 SHTPCCRYRLYRNKAAQ
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 117 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 117 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1404]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1404]--->[1404]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.358 Mb, Max= 30.529 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C2 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C3 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
C4 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
**************************************************
C1 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C2 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C3 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
C4 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
**************************************************
C1 SHTPCCRYRLYRNKAAQ
C2 SHTPCCRYRLYRNKAAQ
C3 SHTPCCRYRLYRNKAAQ
C4 SHTPCCRYRLYRNKAAQ
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
C2 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
C3 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
C4 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
**************************************************
C1 TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
C2 TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
C3 TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
C4 TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
**************************************************
C1 CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
C2 CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
C3 CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
C4 CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
**************************************************
C1 GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
C2 GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
C3 GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
C4 GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
**************************************************
C1 CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
C2 CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
C3 CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
C4 CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
**************************************************
C1 TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
C2 TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
C3 TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
C4 TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
**************************************************
C1 TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
C2 TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
C3 TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
C4 TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
**************************************************
C1 G
C2 G
C3 G
C4 G
*
>C1
TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
G
>C2
TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
G
>C3
TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
G
>C4
TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA
TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG
CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG
GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT
CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA
TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC
TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA
G
>C1
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C2
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C3
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
>C4
LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
SHTPCCRYRLYRNKAAQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 351 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855070
Setting output file names to "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1693351452
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5412164775
Seed = 732610081
Swapseed = 1579855070
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -655.327756 -- -26.620141
Chain 2 -- -655.327756 -- -26.620141
Chain 3 -- -655.327756 -- -26.620141
Chain 4 -- -655.327756 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -655.327756 -- -26.620141
Chain 2 -- -655.327756 -- -26.620141
Chain 3 -- -655.327756 -- -26.620141
Chain 4 -- -655.327756 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-655.328] (-655.328) (-655.328) (-655.328) * [-655.328] (-655.328) (-655.328) (-655.328)
500 -- (-492.425) (-487.182) (-489.338) [-488.737] * [-486.529] (-492.162) (-497.433) (-488.570) -- 0:00:00
1000 -- [-487.016] (-487.111) (-490.070) (-487.839) * [-486.235] (-487.919) (-484.241) (-490.035) -- 0:00:00
1500 -- [-487.713] (-492.934) (-486.310) (-489.802) * [-486.329] (-485.912) (-489.033) (-484.230) -- 0:00:00
2000 -- (-489.612) (-487.039) (-489.723) [-484.002] * (-489.602) (-487.811) [-486.379] (-498.421) -- 0:00:00
2500 -- [-486.322] (-487.856) (-490.601) (-484.062) * (-484.394) (-489.275) (-491.124) [-482.988] -- 0:00:00
3000 -- [-483.125] (-492.540) (-495.835) (-484.165) * [-487.299] (-490.449) (-489.540) (-487.700) -- 0:00:00
3500 -- [-488.748] (-485.677) (-489.922) (-488.787) * (-491.390) [-489.179] (-485.203) (-487.483) -- 0:00:00
4000 -- (-490.591) (-498.300) [-484.757] (-489.381) * (-486.698) (-486.503) [-488.573] (-490.902) -- 0:00:00
4500 -- (-485.263) (-488.605) [-488.534] (-490.647) * (-488.139) [-483.659] (-483.419) (-488.259) -- 0:00:00
5000 -- (-490.984) (-490.929) [-485.385] (-488.463) * (-487.861) (-485.189) [-488.286] (-487.054) -- 0:00:00
Average standard deviation of split frequencies: 0.261891
5500 -- (-487.936) (-489.809) [-486.478] (-484.870) * (-484.749) (-484.680) (-488.406) [-484.598] -- 0:00:00
6000 -- (-487.662) (-490.445) (-488.540) [-487.150] * (-487.944) (-489.218) [-486.842] (-489.199) -- 0:00:00
6500 -- (-484.534) (-491.391) [-483.345] (-488.901) * (-482.950) (-490.921) (-487.758) [-487.085] -- 0:00:00
7000 -- (-487.836) (-488.742) [-487.552] (-486.342) * (-485.292) (-482.352) [-489.184] (-482.700) -- 0:00:00
7500 -- [-490.612] (-485.647) (-484.190) (-484.993) * [-483.427] (-491.745) (-487.360) (-488.652) -- 0:00:00
8000 -- (-486.287) [-484.865] (-489.424) (-484.649) * (-490.264) [-482.481] (-485.281) (-488.438) -- 0:00:00
8500 -- (-483.533) (-486.259) (-486.587) [-488.655] * (-490.616) [-486.012] (-486.887) (-493.380) -- 0:00:00
9000 -- (-491.261) [-482.337] (-486.393) (-494.177) * (-491.909) [-492.096] (-487.226) (-488.652) -- 0:00:00
9500 -- (-492.464) [-487.471] (-488.319) (-484.299) * (-497.516) (-488.364) (-486.888) [-483.796] -- 0:00:00
10000 -- (-491.309) [-485.943] (-483.257) (-486.036) * [-484.155] (-490.893) (-487.209) (-489.677) -- 0:00:00
Average standard deviation of split frequencies: 0.088388
10500 -- (-486.910) [-482.859] (-492.420) (-485.308) * (-482.941) (-496.804) [-489.079] (-486.805) -- 0:00:00
11000 -- (-491.353) [-489.341] (-492.089) (-482.938) * [-483.288] (-483.522) (-487.682) (-490.133) -- 0:00:00
11500 -- (-485.187) (-487.522) [-489.378] (-487.893) * (-481.245) [-487.083] (-490.498) (-483.767) -- 0:00:00
12000 -- (-489.187) [-487.215] (-486.709) (-493.485) * (-481.791) [-485.785] (-490.930) (-487.064) -- 0:00:00
12500 -- (-485.385) (-485.323) (-484.527) [-490.788] * (-482.390) [-482.209] (-490.535) (-486.285) -- 0:00:00
13000 -- (-485.091) (-487.273) [-487.253] (-489.120) * (-481.114) [-483.291] (-482.368) (-489.449) -- 0:00:00
13500 -- (-485.307) (-485.761) [-489.257] (-488.292) * [-481.182] (-482.601) (-484.244) (-499.436) -- 0:00:00
14000 -- (-487.962) (-487.653) [-489.020] (-495.762) * (-484.639) (-483.222) [-481.482] (-487.925) -- 0:00:00
14500 -- (-488.626) (-484.715) (-492.087) [-489.887] * (-484.564) [-483.576] (-485.475) (-487.756) -- 0:00:00
15000 -- [-484.570] (-485.457) (-483.656) (-489.745) * (-482.079) (-482.228) [-484.437] (-486.951) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-488.071) (-489.952) (-484.513) [-484.997] * (-480.821) [-481.379] (-482.515) (-487.240) -- 0:01:03
16000 -- (-486.960) (-488.807) (-490.780) [-486.868] * (-481.538) (-484.525) [-481.439] (-489.322) -- 0:01:01
16500 -- (-497.704) [-485.556] (-484.271) (-485.388) * [-482.063] (-480.472) (-482.131) (-485.057) -- 0:00:59
17000 -- [-485.179] (-485.796) (-484.255) (-483.808) * (-481.313) (-482.482) [-484.074] (-485.869) -- 0:00:57
17500 -- (-481.772) (-487.385) [-484.811] (-488.983) * (-485.573) (-482.077) (-482.618) [-488.956] -- 0:00:56
18000 -- [-481.480] (-494.684) (-492.818) (-484.844) * (-482.223) [-482.590] (-485.348) (-485.994) -- 0:00:54
18500 -- (-482.613) [-486.375] (-484.571) (-484.865) * [-482.893] (-482.668) (-484.169) (-489.727) -- 0:00:53
19000 -- (-487.338) (-488.820) (-486.550) [-485.643] * [-481.591] (-483.795) (-480.488) (-487.860) -- 0:00:51
19500 -- (-486.119) (-482.041) [-489.445] (-486.016) * (-484.662) [-483.007] (-481.036) (-485.551) -- 0:00:50
20000 -- (-484.097) [-485.666] (-487.963) (-488.356) * (-483.850) (-488.261) [-480.824] (-484.228) -- 0:00:49
Average standard deviation of split frequencies: 0.106446
20500 -- (-482.860) [-486.323] (-482.142) (-491.116) * (-483.758) (-482.588) [-483.292] (-488.143) -- 0:00:47
21000 -- [-482.277] (-492.929) (-496.179) (-485.196) * (-485.703) (-482.310) (-482.658) [-484.940] -- 0:00:46
21500 -- (-483.691) (-487.309) (-482.872) [-492.248] * (-483.527) [-485.539] (-481.297) (-487.097) -- 0:00:45
22000 -- (-482.634) (-483.008) [-482.986] (-487.844) * (-484.307) [-483.006] (-483.411) (-484.316) -- 0:00:44
22500 -- (-485.357) (-483.260) (-483.526) [-484.686] * (-483.786) (-480.620) [-483.513] (-487.838) -- 0:00:43
23000 -- (-481.404) (-486.233) (-481.360) [-485.473] * (-483.009) (-482.342) (-485.973) [-489.321] -- 0:00:42
23500 -- (-481.212) (-485.809) (-483.593) [-488.658] * [-483.273] (-481.748) (-483.421) (-484.773) -- 0:00:41
24000 -- (-481.291) (-488.069) [-482.668] (-491.685) * (-483.210) (-480.305) (-482.104) [-490.011] -- 0:00:40
24500 -- [-482.100] (-486.292) (-483.930) (-486.600) * (-483.517) (-481.061) (-481.963) [-483.221] -- 0:00:39
25000 -- [-485.080] (-487.859) (-483.231) (-484.882) * (-481.431) (-482.267) [-484.608] (-488.017) -- 0:00:39
Average standard deviation of split frequencies: 0.096698
25500 -- (-485.054) (-483.730) (-483.475) [-490.354] * (-483.320) (-482.074) [-482.952] (-484.832) -- 0:00:38
26000 -- (-485.724) (-489.817) (-483.378) [-491.450] * [-482.995] (-482.522) (-486.502) (-488.519) -- 0:00:37
26500 -- [-482.287] (-487.765) (-482.006) (-486.003) * (-489.027) (-482.243) (-481.609) [-487.095] -- 0:00:36
27000 -- (-483.794) [-486.476] (-482.605) (-486.654) * (-481.341) (-484.066) (-482.398) [-486.069] -- 0:00:36
27500 -- [-482.642] (-489.743) (-482.249) (-484.902) * (-481.701) (-483.966) [-483.906] (-486.295) -- 0:00:35
28000 -- (-481.129) (-490.006) [-484.104] (-492.791) * [-485.101] (-485.169) (-481.947) (-482.878) -- 0:00:34
28500 -- [-483.394] (-487.077) (-483.801) (-487.268) * (-482.688) (-480.993) (-481.319) [-485.908] -- 0:00:34
29000 -- (-482.811) (-490.444) [-482.381] (-484.698) * (-481.883) (-481.599) (-483.825) [-487.035] -- 0:00:33
29500 -- (-483.520) [-485.961] (-481.360) (-488.817) * (-482.636) (-482.893) [-484.168] (-492.753) -- 0:00:32
30000 -- (-481.276) [-485.667] (-480.741) (-495.065) * (-481.844) (-480.341) (-480.760) [-486.795] -- 0:00:32
Average standard deviation of split frequencies: 0.092231
30500 -- (-483.242) [-487.747] (-487.091) (-484.229) * [-480.757] (-482.064) (-485.010) (-489.836) -- 0:00:31
31000 -- (-481.979) (-488.210) [-483.516] (-486.092) * (-483.890) (-482.983) (-482.769) [-488.040] -- 0:00:31
31500 -- (-482.680) (-484.545) (-487.571) [-485.602] * (-481.627) (-484.919) [-481.243] (-486.865) -- 0:00:30
32000 -- (-483.767) (-487.996) (-484.253) [-484.717] * (-484.902) (-482.305) [-482.440] (-485.881) -- 0:00:30
32500 -- (-482.402) (-488.919) (-486.624) [-491.758] * (-482.645) [-485.471] (-486.815) (-489.122) -- 0:00:29
33000 -- (-482.052) [-481.959] (-481.741) (-491.902) * (-486.140) (-482.529) (-489.138) [-488.845] -- 0:00:29
33500 -- (-481.219) [-483.506] (-482.989) (-488.564) * (-484.520) (-480.662) (-486.378) [-490.288] -- 0:00:57
34000 -- (-480.997) [-483.279] (-481.780) (-487.865) * (-481.747) (-482.419) [-484.259] (-486.489) -- 0:00:56
34500 -- (-484.897) (-490.008) (-483.388) [-484.061] * (-482.119) (-482.003) (-483.103) [-493.470] -- 0:00:55
35000 -- (-483.908) (-488.972) (-480.932) [-485.677] * (-482.562) (-484.061) (-482.480) [-486.834] -- 0:00:55
Average standard deviation of split frequencies: 0.052378
35500 -- (-486.030) (-485.712) [-484.681] (-492.950) * [-482.493] (-485.641) (-481.586) (-491.752) -- 0:00:54
36000 -- (-485.055) [-484.324] (-485.720) (-486.981) * (-482.788) (-485.355) (-483.636) [-486.921] -- 0:00:53
36500 -- (-485.352) (-488.418) [-485.152] (-488.136) * (-483.505) [-480.928] (-482.957) (-492.454) -- 0:00:52
37000 -- (-483.180) (-491.966) [-484.092] (-487.768) * (-481.753) (-482.275) [-484.271] (-490.138) -- 0:00:52
37500 -- [-481.841] (-490.857) (-489.192) (-484.753) * [-482.175] (-482.915) (-483.440) (-489.840) -- 0:00:51
38000 -- (-482.332) (-489.077) (-482.624) [-483.075] * (-481.707) (-482.822) (-482.420) [-489.783] -- 0:00:50
38500 -- (-480.955) (-485.113) [-484.608] (-490.026) * (-481.119) (-482.872) (-485.975) [-486.293] -- 0:00:49
39000 -- (-483.717) [-486.884] (-482.795) (-491.427) * (-480.977) [-481.562] (-481.025) (-489.838) -- 0:00:49
39500 -- (-485.092) (-493.400) (-480.674) [-485.490] * (-481.555) (-481.760) [-483.818] (-491.715) -- 0:00:48
40000 -- [-482.718] (-497.126) (-483.639) (-486.752) * [-484.804] (-481.531) (-483.360) (-484.126) -- 0:00:48
Average standard deviation of split frequencies: 0.077279
40500 -- (-481.543) [-483.246] (-485.167) (-488.973) * [-481.962] (-480.605) (-482.440) (-492.783) -- 0:00:47
41000 -- (-482.622) (-480.742) (-483.054) [-484.634] * [-482.653] (-481.608) (-485.527) (-485.379) -- 0:00:46
41500 -- (-484.772) (-481.407) [-482.590] (-483.473) * [-483.461] (-482.111) (-481.111) (-481.593) -- 0:00:46
42000 -- [-484.148] (-484.282) (-483.310) (-488.201) * (-483.022) (-481.217) [-482.692] (-484.804) -- 0:00:45
42500 -- (-482.924) (-487.285) (-483.252) [-487.780] * [-482.913] (-481.060) (-482.297) (-483.435) -- 0:00:45
43000 -- (-483.682) [-484.244] (-481.168) (-485.548) * (-482.629) (-480.718) [-484.091] (-485.233) -- 0:00:44
43500 -- (-480.753) (-482.431) [-481.380] (-487.055) * (-481.967) (-481.918) (-486.037) [-480.996] -- 0:00:43
44000 -- (-484.492) (-481.972) [-482.847] (-497.761) * (-483.341) [-483.297] (-483.600) (-482.128) -- 0:00:43
44500 -- (-487.955) (-482.078) [-481.603] (-489.608) * (-481.869) (-482.709) [-482.461] (-482.312) -- 0:00:42
45000 -- (-484.337) (-487.299) (-481.224) [-486.098] * (-481.205) [-483.380] (-484.910) (-484.103) -- 0:00:42
Average standard deviation of split frequencies: 0.040992
45500 -- [-483.100] (-482.315) (-481.610) (-489.217) * (-481.345) (-482.247) (-483.338) [-485.530] -- 0:00:41
46000 -- (-482.953) [-484.675] (-482.618) (-490.870) * (-483.360) (-482.186) (-486.634) [-481.713] -- 0:00:41
46500 -- (-486.203) (-485.328) [-484.308] (-486.500) * [-486.241] (-481.883) (-482.758) (-481.247) -- 0:00:41
47000 -- [-483.678] (-484.104) (-481.889) (-494.239) * [-481.239] (-483.550) (-481.951) (-482.609) -- 0:00:40
47500 -- (-483.043) [-481.845] (-482.050) (-486.204) * (-481.786) [-483.357] (-480.493) (-484.072) -- 0:00:40
48000 -- (-483.363) [-482.086] (-481.393) (-484.875) * (-481.717) (-483.434) [-481.312] (-483.028) -- 0:00:39
48500 -- (-482.045) [-483.667] (-484.822) (-490.369) * (-482.198) [-483.005] (-483.290) (-481.341) -- 0:00:39
49000 -- (-485.266) [-484.971] (-482.703) (-494.603) * [-481.817] (-481.404) (-481.100) (-483.279) -- 0:00:38
49500 -- (-487.338) [-481.847] (-481.246) (-487.082) * (-481.220) [-480.991] (-481.971) (-481.620) -- 0:00:38
50000 -- (-481.150) (-483.432) [-481.394] (-495.199) * [-481.283] (-488.207) (-483.121) (-483.486) -- 0:00:38
Average standard deviation of split frequencies: 0.037216
50500 -- (-485.013) [-487.219] (-481.320) (-487.990) * (-482.127) (-485.525) (-482.151) [-483.270] -- 0:00:37
51000 -- (-484.329) (-480.466) [-481.000] (-487.398) * (-485.583) (-482.758) (-483.341) [-483.088] -- 0:00:37
51500 -- (-485.873) [-482.290] (-482.178) (-487.021) * [-481.223] (-485.967) (-482.471) (-481.317) -- 0:00:36
52000 -- (-482.577) (-482.117) [-488.820] (-486.679) * (-482.273) (-481.123) (-482.210) [-482.656] -- 0:00:36
52500 -- [-482.671] (-481.896) (-483.268) (-487.227) * [-484.948] (-482.245) (-485.201) (-482.088) -- 0:00:36
53000 -- (-481.799) (-481.570) (-483.293) [-485.115] * (-485.516) (-482.237) (-482.191) [-482.977] -- 0:00:35
53500 -- [-481.744] (-484.519) (-482.317) (-487.514) * (-480.502) [-487.878] (-481.650) (-482.462) -- 0:00:53
54000 -- (-480.770) (-485.647) [-482.960] (-488.547) * (-481.984) (-481.433) (-481.036) [-483.772] -- 0:00:52
54500 -- (-488.807) (-488.609) [-481.862] (-483.295) * (-482.390) (-481.122) (-484.134) [-483.693] -- 0:00:52
55000 -- (-483.469) (-484.860) (-481.522) [-481.615] * [-481.651] (-481.404) (-483.249) (-481.570) -- 0:00:51
Average standard deviation of split frequencies: 0.039284
55500 -- [-482.355] (-485.450) (-483.077) (-483.481) * (-480.444) [-484.278] (-485.117) (-486.297) -- 0:00:51
56000 -- (-480.985) (-483.170) [-484.705] (-483.280) * [-482.280] (-481.644) (-484.749) (-483.311) -- 0:00:50
56500 -- (-484.399) [-481.094] (-483.506) (-480.730) * [-481.566] (-482.094) (-481.287) (-483.457) -- 0:00:50
57000 -- (-487.169) [-484.148] (-481.290) (-483.050) * (-480.822) [-481.393] (-481.590) (-483.456) -- 0:00:49
57500 -- [-482.119] (-483.223) (-484.137) (-482.193) * (-480.981) [-485.576] (-480.987) (-481.658) -- 0:00:49
58000 -- (-482.399) (-482.144) [-483.260] (-482.219) * (-483.028) [-481.763] (-482.558) (-482.305) -- 0:00:48
58500 -- (-485.618) (-481.727) [-481.762] (-484.744) * [-480.982] (-482.215) (-485.477) (-482.819) -- 0:00:48
59000 -- (-483.640) (-484.498) [-481.913] (-484.038) * (-482.003) (-482.144) (-486.179) [-480.735] -- 0:00:47
59500 -- (-484.583) (-481.529) [-481.966] (-483.130) * (-485.229) (-484.325) [-481.334] (-480.979) -- 0:00:47
60000 -- [-481.327] (-482.823) (-482.213) (-483.354) * (-482.380) (-482.129) [-481.444] (-484.057) -- 0:00:47
Average standard deviation of split frequencies: 0.020721
60500 -- [-481.003] (-483.821) (-483.892) (-481.487) * (-484.443) [-482.294] (-482.635) (-481.734) -- 0:00:46
61000 -- (-484.362) (-484.116) (-482.624) [-483.502] * (-483.107) [-481.146] (-486.975) (-483.197) -- 0:00:46
61500 -- [-480.894] (-481.676) (-481.355) (-482.944) * (-480.834) (-482.556) (-482.383) [-484.451] -- 0:00:45
62000 -- [-481.550] (-482.546) (-484.829) (-482.357) * [-480.795] (-481.244) (-480.696) (-482.159) -- 0:00:45
62500 -- (-483.330) [-481.448] (-485.237) (-483.520) * (-481.784) [-484.510] (-480.834) (-484.043) -- 0:00:45
63000 -- (-481.892) (-481.742) [-481.784] (-483.901) * [-481.817] (-482.694) (-482.206) (-490.751) -- 0:00:44
63500 -- [-485.314] (-484.594) (-480.742) (-483.403) * (-482.794) (-480.947) [-481.745] (-486.456) -- 0:00:44
64000 -- (-483.288) (-481.859) (-480.285) [-482.730] * [-481.187] (-483.741) (-482.931) (-480.820) -- 0:00:43
64500 -- (-482.835) (-483.416) (-485.207) [-482.989] * (-481.155) (-482.669) [-483.541] (-482.406) -- 0:00:43
65000 -- [-482.022] (-483.987) (-485.063) (-482.606) * (-481.976) [-483.009] (-484.144) (-482.358) -- 0:00:43
Average standard deviation of split frequencies: 0.019047
65500 -- (-481.165) (-485.514) [-482.008] (-486.025) * (-480.793) [-481.246] (-483.833) (-480.561) -- 0:00:42
66000 -- [-481.176] (-481.230) (-483.947) (-486.768) * [-482.938] (-482.414) (-481.680) (-484.727) -- 0:00:42
66500 -- (-482.598) (-484.248) [-484.070] (-482.217) * [-486.923] (-483.495) (-480.475) (-482.137) -- 0:00:42
67000 -- (-482.362) (-491.530) (-485.382) [-481.266] * (-483.729) [-485.186] (-482.999) (-482.955) -- 0:00:41
67500 -- (-483.720) [-481.536] (-481.742) (-483.343) * (-485.963) (-483.497) (-483.004) [-482.378] -- 0:00:41
68000 -- [-482.842] (-482.926) (-481.012) (-482.621) * (-482.451) [-483.639] (-483.110) (-483.974) -- 0:00:41
68500 -- (-481.500) [-482.722] (-481.537) (-486.537) * (-483.908) (-489.399) [-482.407] (-485.726) -- 0:00:40
69000 -- (-487.188) [-482.399] (-481.081) (-482.597) * (-484.470) (-485.633) (-480.918) [-483.583] -- 0:00:40
69500 -- (-483.612) (-483.374) [-481.292] (-481.325) * (-481.226) (-486.066) (-481.047) [-480.790] -- 0:00:40
70000 -- (-480.548) (-482.892) [-482.985] (-483.656) * (-483.173) (-481.355) (-481.767) [-480.884] -- 0:00:39
Average standard deviation of split frequencies: 0.008894
70500 -- (-481.389) (-483.091) [-484.178] (-480.532) * (-483.130) (-481.265) (-480.673) [-482.793] -- 0:00:39
71000 -- [-481.183] (-483.308) (-482.789) (-482.244) * (-485.194) [-482.127] (-481.509) (-483.130) -- 0:00:39
71500 -- (-483.878) (-481.986) (-485.858) [-481.751] * [-482.033] (-483.249) (-481.576) (-485.055) -- 0:00:38
72000 -- [-484.566] (-482.924) (-481.487) (-481.562) * [-487.059] (-481.112) (-484.903) (-482.711) -- 0:00:38
72500 -- [-483.769] (-483.372) (-481.229) (-483.466) * (-480.859) (-480.774) (-482.362) [-482.570] -- 0:00:38
73000 -- (-483.223) [-483.104] (-481.967) (-489.489) * (-481.044) (-482.234) [-484.006] (-485.040) -- 0:00:50
73500 -- (-480.824) [-481.943] (-482.029) (-481.323) * (-482.949) (-480.876) (-483.161) [-483.409] -- 0:00:50
74000 -- (-481.096) [-483.142] (-482.442) (-481.320) * [-482.930] (-481.509) (-482.063) (-484.790) -- 0:00:50
74500 -- (-482.572) (-483.069) [-483.564] (-486.249) * [-481.053] (-482.066) (-483.317) (-482.421) -- 0:00:49
75000 -- (-486.262) (-483.889) [-481.112] (-483.393) * (-484.832) [-482.639] (-482.676) (-483.427) -- 0:00:49
Average standard deviation of split frequencies: 0.012405
75500 -- (-483.140) (-480.381) [-482.435] (-484.460) * (-482.817) [-481.201] (-481.520) (-481.481) -- 0:00:48
76000 -- (-481.389) (-481.514) (-484.002) [-485.393] * (-481.760) (-484.747) (-483.390) [-483.308] -- 0:00:48
76500 -- (-480.858) (-480.822) (-481.505) [-481.575] * [-480.992] (-481.824) (-482.572) (-482.476) -- 0:00:48
77000 -- (-481.903) (-483.657) [-480.863] (-481.383) * (-485.140) (-482.629) [-482.663] (-481.644) -- 0:00:47
77500 -- [-482.791] (-484.232) (-482.065) (-482.383) * (-482.123) (-481.863) (-487.392) [-486.032] -- 0:00:47
78000 -- (-483.364) (-483.737) (-481.428) [-484.346] * (-484.419) [-483.969] (-483.446) (-485.841) -- 0:00:47
78500 -- (-481.684) [-485.638] (-481.984) (-480.829) * (-481.244) [-487.171] (-481.914) (-488.303) -- 0:00:46
79000 -- (-483.354) [-481.612] (-482.280) (-485.122) * [-482.410] (-485.395) (-481.530) (-484.789) -- 0:00:46
79500 -- (-481.788) (-483.940) [-481.149] (-494.789) * (-481.708) (-486.659) [-482.834] (-482.880) -- 0:00:46
80000 -- (-482.244) (-484.463) (-481.386) [-481.720] * (-481.848) (-485.329) (-482.817) [-482.059] -- 0:00:46
Average standard deviation of split frequencies: 0.011688
80500 -- (-482.982) [-483.877] (-484.783) (-482.028) * (-485.794) (-483.033) (-482.262) [-482.898] -- 0:00:45
81000 -- (-484.083) (-480.621) [-481.521] (-481.429) * (-481.666) (-482.443) (-485.777) [-484.627] -- 0:00:45
81500 -- (-484.349) [-481.513] (-483.199) (-482.777) * (-483.564) [-481.716] (-481.719) (-488.480) -- 0:00:45
82000 -- (-481.140) (-481.176) [-482.410] (-486.191) * [-483.550] (-485.875) (-482.890) (-481.390) -- 0:00:44
82500 -- (-483.595) [-484.849] (-483.112) (-480.609) * (-489.315) [-482.076] (-484.830) (-481.086) -- 0:00:44
83000 -- (-482.800) [-482.225] (-483.233) (-482.695) * (-482.384) (-483.870) (-482.754) [-481.558] -- 0:00:44
83500 -- [-481.253] (-482.296) (-482.337) (-481.182) * (-483.627) (-482.293) (-482.045) [-483.984] -- 0:00:43
84000 -- (-482.605) (-482.561) (-481.201) [-483.681] * (-482.201) [-482.209] (-480.802) (-482.381) -- 0:00:43
84500 -- [-481.630] (-484.123) (-480.759) (-483.094) * [-482.204] (-490.384) (-481.030) (-490.047) -- 0:00:43
85000 -- (-483.493) (-488.200) (-482.973) [-482.740] * (-483.033) [-482.560] (-483.732) (-490.836) -- 0:00:43
Average standard deviation of split frequencies: 0.014617
85500 -- (-484.545) [-482.845] (-483.666) (-482.345) * (-484.913) (-484.703) (-485.285) [-482.206] -- 0:00:42
86000 -- (-482.272) (-481.531) [-485.023] (-484.805) * (-483.186) [-484.014] (-483.954) (-483.392) -- 0:00:42
86500 -- [-482.556] (-484.456) (-487.314) (-482.770) * [-485.657] (-480.993) (-484.477) (-483.775) -- 0:00:42
87000 -- (-483.283) (-481.618) (-486.902) [-481.077] * (-480.572) [-481.690] (-487.380) (-482.772) -- 0:00:41
87500 -- [-481.911] (-487.464) (-484.233) (-482.170) * (-483.567) [-481.824] (-485.411) (-483.966) -- 0:00:41
88000 -- [-483.899] (-483.320) (-484.421) (-481.848) * (-483.425) [-480.572] (-481.745) (-482.970) -- 0:00:41
88500 -- (-482.455) (-482.162) (-481.947) [-481.542] * (-482.175) (-482.656) [-483.581] (-485.839) -- 0:00:41
89000 -- (-483.393) [-483.916] (-483.610) (-482.588) * (-485.485) (-487.453) [-486.113] (-483.432) -- 0:00:40
89500 -- [-482.263] (-485.773) (-482.507) (-483.346) * [-484.234] (-482.812) (-486.139) (-482.038) -- 0:00:40
90000 -- (-488.192) [-484.341] (-483.257) (-482.240) * (-482.934) (-483.727) [-483.651] (-481.423) -- 0:00:40
Average standard deviation of split frequencies: 0.010399
90500 -- [-486.389] (-483.241) (-486.531) (-483.296) * [-483.031] (-484.534) (-482.161) (-481.703) -- 0:00:40
91000 -- (-483.619) (-482.249) [-487.089] (-483.026) * (-483.077) (-485.910) [-486.491] (-482.763) -- 0:00:39
91500 -- (-481.227) (-481.173) (-484.515) [-482.309] * (-481.102) (-482.394) [-482.454] (-480.707) -- 0:00:39
92000 -- (-484.472) [-482.252] (-481.773) (-484.208) * (-482.598) (-484.177) [-481.996] (-484.610) -- 0:00:39
92500 -- (-484.470) (-488.424) (-487.074) [-481.344] * (-482.110) (-484.651) (-481.000) [-484.017] -- 0:00:39
93000 -- (-487.875) (-482.956) [-481.991] (-483.872) * (-483.575) [-482.115] (-482.078) (-484.984) -- 0:00:39
93500 -- (-484.739) (-485.057) (-481.909) [-482.496] * (-484.466) [-482.968] (-483.279) (-483.461) -- 0:00:48
94000 -- [-480.859] (-481.600) (-481.055) (-482.581) * (-482.719) (-482.557) (-483.474) [-481.408] -- 0:00:48
94500 -- (-480.707) [-481.254] (-480.660) (-481.194) * (-480.892) [-481.072] (-483.071) (-484.700) -- 0:00:47
95000 -- [-482.191] (-481.398) (-482.453) (-480.805) * (-483.289) (-482.124) (-485.707) [-485.058] -- 0:00:47
Average standard deviation of split frequencies: 0.006547
95500 -- (-481.272) (-481.594) [-485.677] (-483.693) * (-486.899) [-480.852] (-485.915) (-484.953) -- 0:00:47
96000 -- [-481.297] (-487.637) (-481.869) (-482.005) * (-481.078) [-480.571] (-481.263) (-484.171) -- 0:00:47
96500 -- (-482.159) (-494.154) [-483.623] (-482.796) * [-483.403] (-481.535) (-481.664) (-484.346) -- 0:00:46
97000 -- (-483.917) (-481.438) (-481.829) [-480.752] * (-481.452) [-485.459] (-481.545) (-486.351) -- 0:00:46
97500 -- [-481.704] (-483.882) (-482.027) (-481.718) * (-484.153) [-484.856] (-482.052) (-482.078) -- 0:00:46
98000 -- [-480.961] (-480.970) (-480.737) (-482.735) * (-485.494) (-482.309) [-481.429] (-480.780) -- 0:00:46
98500 -- (-483.054) [-485.308] (-484.509) (-482.769) * (-484.795) (-486.095) [-481.530] (-481.036) -- 0:00:45
99000 -- (-482.607) (-481.746) (-482.137) [-485.560] * (-480.764) [-483.335] (-482.326) (-481.140) -- 0:00:45
99500 -- (-488.027) [-483.195] (-487.887) (-483.230) * (-481.995) (-482.410) [-483.002] (-481.510) -- 0:00:45
100000 -- (-483.444) (-481.278) (-488.072) [-482.563] * [-481.695] (-482.073) (-482.663) (-485.241) -- 0:00:45
Average standard deviation of split frequencies: 0.003122
100500 -- (-482.644) (-482.461) [-481.881] (-482.966) * (-484.414) [-483.949] (-481.512) (-482.610) -- 0:00:44
101000 -- (-481.170) (-483.034) [-480.946] (-482.713) * [-484.028] (-482.860) (-483.130) (-485.258) -- 0:00:44
101500 -- [-481.791] (-482.599) (-485.067) (-481.913) * [-482.842] (-482.572) (-482.196) (-481.480) -- 0:00:44
102000 -- [-483.438] (-484.777) (-482.191) (-481.463) * (-486.193) [-483.286] (-482.092) (-486.265) -- 0:00:44
102500 -- (-485.657) [-483.394] (-481.577) (-482.058) * (-485.239) (-487.218) [-483.770] (-480.808) -- 0:00:43
103000 -- [-484.541] (-482.180) (-486.524) (-481.895) * (-483.516) (-482.833) (-483.170) [-481.859] -- 0:00:43
103500 -- (-487.002) (-485.097) [-481.838] (-484.682) * (-484.329) (-486.935) (-481.587) [-481.559] -- 0:00:43
104000 -- (-485.628) [-481.185] (-482.758) (-482.660) * (-482.017) (-484.977) [-483.195] (-481.406) -- 0:00:43
104500 -- (-484.412) (-483.089) (-481.904) [-480.320] * [-481.664] (-484.757) (-482.139) (-481.046) -- 0:00:42
105000 -- [-481.250] (-482.439) (-481.642) (-482.182) * (-481.306) (-484.694) (-482.138) [-482.057] -- 0:00:42
Average standard deviation of split frequencies: 0.011859
105500 -- (-480.600) [-481.963] (-482.079) (-481.241) * (-485.794) (-482.652) (-480.905) [-481.178] -- 0:00:42
106000 -- [-481.041] (-481.031) (-484.842) (-485.108) * (-481.030) [-485.454] (-484.914) (-483.383) -- 0:00:42
106500 -- (-481.751) (-486.921) (-482.124) [-482.865] * (-480.512) (-481.944) (-484.094) [-482.009] -- 0:00:41
107000 -- (-482.771) (-483.870) [-483.624] (-481.434) * (-482.588) (-483.271) [-483.279] (-481.747) -- 0:00:41
107500 -- (-482.006) (-482.640) (-484.465) [-481.590] * (-480.790) [-482.308] (-482.640) (-483.531) -- 0:00:41
108000 -- [-481.094] (-484.992) (-482.179) (-481.265) * (-481.727) (-484.773) [-482.005] (-481.444) -- 0:00:41
108500 -- [-482.381] (-480.888) (-483.803) (-481.788) * (-484.406) (-484.463) (-480.926) [-483.206] -- 0:00:41
109000 -- (-484.939) [-481.113] (-481.767) (-484.327) * (-483.866) [-483.634] (-482.486) (-481.555) -- 0:00:40
109500 -- [-484.426] (-482.031) (-481.713) (-480.538) * (-483.212) [-483.165] (-482.731) (-482.794) -- 0:00:40
110000 -- (-485.449) [-482.008] (-482.660) (-480.872) * [-492.003] (-483.531) (-481.448) (-483.764) -- 0:00:40
Average standard deviation of split frequencies: 0.025558
110500 -- (-482.898) (-481.739) (-482.902) [-480.595] * (-492.361) (-481.527) (-480.868) [-481.782] -- 0:00:40
111000 -- (-480.955) [-480.949] (-480.619) (-483.269) * (-482.734) (-483.313) [-481.225] (-483.082) -- 0:00:40
111500 -- [-482.427] (-480.645) (-482.526) (-481.845) * [-484.440] (-481.184) (-482.200) (-484.361) -- 0:00:39
112000 -- (-486.081) (-484.264) [-486.433] (-483.175) * (-484.848) (-485.982) [-481.212] (-486.488) -- 0:00:39
112500 -- (-483.215) (-486.819) (-483.014) [-482.284] * [-480.944] (-481.299) (-481.982) (-483.940) -- 0:00:39
113000 -- (-487.042) [-482.532] (-486.162) (-482.633) * (-480.737) (-483.791) [-485.233] (-486.061) -- 0:00:39
113500 -- [-481.187] (-485.590) (-485.636) (-481.239) * (-482.217) (-484.285) [-482.856] (-482.893) -- 0:00:39
114000 -- [-481.374] (-485.471) (-483.753) (-485.925) * (-483.066) (-482.287) [-483.046] (-482.531) -- 0:00:46
114500 -- [-482.542] (-482.303) (-483.803) (-481.203) * [-482.092] (-485.205) (-482.311) (-481.902) -- 0:00:46
115000 -- [-480.286] (-484.264) (-482.643) (-488.141) * (-486.343) [-482.263] (-483.884) (-487.676) -- 0:00:46
Average standard deviation of split frequencies: 0.018965
115500 -- (-482.874) [-484.011] (-483.338) (-482.840) * (-482.196) (-485.443) [-487.498] (-484.588) -- 0:00:45
116000 -- (-481.683) (-481.203) (-481.599) [-482.050] * (-480.250) (-483.122) (-482.433) [-482.315] -- 0:00:45
116500 -- (-482.552) (-480.932) (-485.029) [-482.531] * [-481.903] (-481.922) (-482.225) (-483.640) -- 0:00:45
117000 -- [-483.355] (-485.688) (-485.998) (-481.555) * (-482.937) (-481.188) (-482.244) [-482.808] -- 0:00:45
117500 -- [-480.549] (-483.127) (-480.974) (-484.211) * (-487.465) (-481.020) (-483.335) [-483.082] -- 0:00:45
118000 -- (-482.828) (-487.714) (-482.180) [-483.268] * (-484.211) [-483.027] (-486.728) (-491.152) -- 0:00:44
118500 -- (-483.206) (-483.701) (-482.640) [-483.655] * (-481.686) [-482.204] (-483.033) (-485.017) -- 0:00:44
119000 -- [-483.779] (-483.620) (-482.421) (-484.305) * [-482.033] (-486.196) (-484.072) (-485.923) -- 0:00:44
119500 -- [-481.153] (-485.769) (-481.296) (-481.673) * [-482.505] (-482.038) (-481.861) (-480.868) -- 0:00:44
120000 -- [-482.618] (-480.792) (-482.535) (-483.498) * (-480.721) (-486.195) (-483.554) [-481.116] -- 0:00:44
Average standard deviation of split frequencies: 0.026044
120500 -- [-481.876] (-482.462) (-482.336) (-482.054) * [-482.228] (-482.625) (-482.677) (-481.859) -- 0:00:43
121000 -- (-484.593) [-483.777] (-481.100) (-482.539) * (-482.387) [-481.553] (-483.152) (-481.107) -- 0:00:43
121500 -- (-485.560) (-482.070) (-481.851) [-481.394] * [-481.081] (-481.532) (-484.072) (-481.421) -- 0:00:43
122000 -- (-483.883) (-487.456) [-481.235] (-481.863) * [-481.451] (-481.845) (-484.815) (-481.162) -- 0:00:43
122500 -- (-484.162) (-481.403) (-483.571) [-481.550] * (-482.631) [-483.914] (-484.553) (-484.142) -- 0:00:42
123000 -- (-483.897) (-480.626) [-481.590] (-481.100) * (-480.511) (-483.770) [-485.913] (-484.477) -- 0:00:42
123500 -- (-484.899) (-481.197) (-480.694) [-482.775] * (-482.471) (-483.707) (-482.541) [-480.752] -- 0:00:42
124000 -- (-483.922) [-481.680] (-480.445) (-481.617) * (-483.392) (-482.599) [-483.171] (-484.731) -- 0:00:42
124500 -- (-485.016) (-483.684) (-481.263) [-481.703] * (-484.286) [-480.565] (-481.597) (-485.788) -- 0:00:42
125000 -- (-489.830) [-481.055] (-482.681) (-480.722) * (-481.955) [-480.681] (-483.634) (-481.367) -- 0:00:42
Average standard deviation of split frequencies: 0.029930
125500 -- (-482.154) (-482.459) [-480.409] (-481.306) * (-483.271) [-480.827] (-484.614) (-487.118) -- 0:00:41
126000 -- (-482.204) [-483.185] (-483.590) (-487.194) * (-484.356) [-481.512] (-481.582) (-482.180) -- 0:00:41
126500 -- (-482.171) (-487.004) (-482.647) [-482.795] * (-482.472) (-484.521) (-481.017) [-482.770] -- 0:00:41
127000 -- (-481.881) (-488.297) [-480.953] (-482.376) * (-483.159) (-484.671) (-483.111) [-481.883] -- 0:00:41
127500 -- (-482.119) (-482.090) [-483.803] (-481.172) * [-483.438] (-481.875) (-484.665) (-483.340) -- 0:00:41
128000 -- (-483.515) [-481.911] (-482.134) (-482.514) * [-484.624] (-484.903) (-484.103) (-480.965) -- 0:00:40
128500 -- [-481.749] (-480.952) (-485.231) (-481.748) * [-481.476] (-483.378) (-483.400) (-485.445) -- 0:00:40
129000 -- [-484.358] (-482.059) (-481.319) (-484.366) * (-480.807) [-480.553] (-481.817) (-482.243) -- 0:00:40
129500 -- (-480.985) (-483.823) [-481.594] (-481.155) * (-483.684) (-481.224) (-482.654) [-482.493] -- 0:00:40
130000 -- (-483.805) [-483.821] (-485.553) (-483.471) * (-484.375) (-481.509) (-484.548) [-484.681] -- 0:00:40
Average standard deviation of split frequencies: 0.019241
130500 -- (-485.487) (-484.188) (-482.302) [-484.261] * (-482.980) (-482.761) [-482.208] (-485.602) -- 0:00:39
131000 -- [-483.793] (-486.889) (-482.642) (-481.738) * [-482.185] (-483.209) (-480.556) (-482.128) -- 0:00:39
131500 -- (-483.464) [-482.662] (-484.175) (-483.169) * (-483.650) (-482.692) [-481.674] (-483.312) -- 0:00:39
132000 -- (-481.441) [-482.247] (-485.647) (-482.260) * (-481.551) (-480.856) (-485.335) [-481.118] -- 0:00:39
132500 -- (-484.498) (-482.054) (-482.401) [-485.585] * [-486.807] (-482.985) (-481.731) (-481.755) -- 0:00:39
133000 -- (-481.532) (-488.001) (-481.465) [-482.830] * (-485.393) [-482.233] (-483.084) (-482.646) -- 0:00:39
133500 -- (-491.239) (-482.524) [-484.222] (-481.618) * (-482.618) [-482.269] (-484.180) (-483.841) -- 0:00:45
134000 -- (-481.528) (-483.693) [-484.771] (-484.567) * [-481.248] (-482.114) (-486.013) (-486.121) -- 0:00:45
134500 -- (-485.505) (-485.857) [-480.576] (-481.907) * [-480.966] (-482.180) (-483.376) (-481.079) -- 0:00:45
135000 -- [-483.192] (-487.314) (-485.256) (-481.122) * (-483.767) (-482.734) (-481.632) [-482.482] -- 0:00:44
Average standard deviation of split frequencies: 0.018486
135500 -- (-484.847) (-483.581) [-485.519] (-484.486) * (-481.853) (-480.862) [-483.446] (-481.546) -- 0:00:44
136000 -- (-482.368) (-481.624) (-482.960) [-486.330] * (-481.342) (-481.547) (-481.334) [-481.981] -- 0:00:44
136500 -- (-485.447) [-483.313] (-482.481) (-486.028) * (-483.508) (-482.363) [-481.914] (-486.379) -- 0:00:44
137000 -- (-481.886) (-482.160) (-482.449) [-483.732] * (-483.656) [-481.233] (-483.892) (-484.274) -- 0:00:44
137500 -- [-484.686] (-484.733) (-487.390) (-480.901) * (-481.115) (-482.736) (-488.522) [-484.484] -- 0:00:43
138000 -- (-483.294) (-483.322) [-483.216] (-482.501) * (-481.823) (-483.071) [-485.505] (-481.479) -- 0:00:43
138500 -- (-481.096) [-485.259] (-482.541) (-484.874) * (-487.852) (-483.486) (-487.063) [-481.045] -- 0:00:43
139000 -- (-481.257) [-481.703] (-482.633) (-484.325) * (-483.698) [-482.586] (-480.717) (-483.168) -- 0:00:43
139500 -- (-480.389) (-485.149) (-484.228) [-482.433] * [-481.967] (-482.683) (-481.081) (-481.482) -- 0:00:43
140000 -- (-484.309) (-481.741) [-482.536] (-483.506) * [-482.227] (-481.797) (-481.935) (-483.818) -- 0:00:43
Average standard deviation of split frequencies: 0.020107
140500 -- [-483.724] (-483.885) (-481.959) (-481.098) * (-481.027) (-480.718) (-484.476) [-482.207] -- 0:00:42
141000 -- (-485.580) [-482.258] (-482.752) (-484.500) * (-483.280) (-482.041) [-480.893] (-481.593) -- 0:00:42
141500 -- (-483.183) [-483.432] (-481.703) (-486.038) * [-484.086] (-484.975) (-482.290) (-481.419) -- 0:00:42
142000 -- (-486.218) [-484.637] (-481.445) (-484.101) * [-488.097] (-484.766) (-483.292) (-480.411) -- 0:00:42
142500 -- (-481.986) (-481.680) [-483.071] (-483.890) * (-485.212) [-481.080] (-485.072) (-483.572) -- 0:00:42
143000 -- (-481.691) (-483.759) (-483.220) [-484.269] * (-483.161) [-482.976] (-483.262) (-482.312) -- 0:00:41
143500 -- [-483.880] (-481.530) (-488.356) (-484.494) * (-482.903) (-489.045) (-482.492) [-480.820] -- 0:00:41
144000 -- (-482.296) [-483.198] (-483.083) (-482.172) * (-484.054) (-483.126) [-481.137] (-483.313) -- 0:00:41
144500 -- (-483.166) (-484.199) (-481.833) [-481.838] * (-483.757) (-482.866) (-481.003) [-484.919] -- 0:00:41
145000 -- [-481.434] (-483.806) (-481.187) (-481.851) * [-483.567] (-480.707) (-481.630) (-483.716) -- 0:00:41
Average standard deviation of split frequencies: 0.019373
145500 -- [-482.615] (-483.668) (-485.969) (-486.157) * (-483.038) (-481.240) [-480.798] (-482.835) -- 0:00:41
146000 -- (-486.629) (-481.554) (-483.565) [-483.027] * (-482.909) (-483.654) [-481.883] (-482.062) -- 0:00:40
146500 -- (-486.345) (-484.048) [-483.953] (-480.787) * (-483.634) [-481.452] (-484.006) (-482.026) -- 0:00:40
147000 -- [-482.734] (-482.542) (-481.223) (-482.989) * (-481.503) (-482.081) (-488.354) [-487.001] -- 0:00:40
147500 -- [-483.392] (-482.437) (-480.810) (-482.822) * (-482.438) (-481.289) (-485.280) [-484.405] -- 0:00:40
148000 -- [-481.416] (-483.208) (-482.222) (-481.456) * (-484.761) (-484.774) [-481.088] (-483.172) -- 0:00:40
148500 -- [-481.058] (-483.148) (-483.498) (-482.342) * (-487.602) [-485.469] (-486.546) (-482.914) -- 0:00:40
149000 -- (-481.192) (-480.370) [-484.312] (-483.917) * [-485.070] (-482.965) (-482.704) (-480.560) -- 0:00:39
149500 -- (-480.676) (-482.300) [-482.427] (-484.742) * (-481.121) (-486.667) (-482.782) [-481.977] -- 0:00:39
150000 -- (-481.617) (-482.707) [-485.268] (-481.716) * (-482.740) (-487.827) [-489.511] (-483.367) -- 0:00:39
Average standard deviation of split frequencies: 0.020859
150500 -- [-486.297] (-482.281) (-485.453) (-481.735) * (-482.101) (-480.998) (-483.000) [-483.873] -- 0:00:39
151000 -- (-484.960) (-484.425) [-484.858] (-482.964) * [-482.533] (-482.382) (-480.918) (-481.696) -- 0:00:39
151500 -- [-481.733] (-482.808) (-488.144) (-483.449) * (-487.110) [-481.996] (-484.292) (-480.817) -- 0:00:39
152000 -- [-486.073] (-484.988) (-484.603) (-484.688) * [-481.454] (-484.316) (-486.854) (-482.846) -- 0:00:39
152500 -- (-483.195) [-481.207] (-480.895) (-485.047) * (-481.523) (-481.055) [-484.344] (-484.843) -- 0:00:38
153000 -- [-482.731] (-482.255) (-483.958) (-483.116) * (-481.907) [-481.142] (-482.130) (-484.860) -- 0:00:44
153500 -- (-483.828) [-483.379] (-483.242) (-480.998) * (-481.074) (-484.874) (-481.733) [-482.558] -- 0:00:44
154000 -- (-481.522) [-482.321] (-482.171) (-484.968) * (-483.073) (-486.476) (-482.811) [-480.789] -- 0:00:43
154500 -- (-483.096) [-480.733] (-482.256) (-481.574) * [-483.174] (-484.983) (-482.568) (-484.681) -- 0:00:43
155000 -- (-486.112) [-483.253] (-483.406) (-481.714) * (-486.120) (-481.925) [-483.890] (-484.191) -- 0:00:43
Average standard deviation of split frequencies: 0.018131
155500 -- (-483.729) (-481.943) [-483.260] (-482.868) * (-480.776) [-481.432] (-484.604) (-482.310) -- 0:00:43
156000 -- (-482.666) (-484.688) [-482.223] (-482.083) * (-480.491) (-481.669) (-482.798) [-482.635] -- 0:00:43
156500 -- (-482.336) (-483.487) [-487.854] (-481.485) * (-481.909) (-484.347) (-485.480) [-484.372] -- 0:00:43
157000 -- [-483.644] (-482.636) (-486.643) (-483.227) * (-485.308) (-484.976) (-482.450) [-481.952] -- 0:00:42
157500 -- (-482.930) (-481.401) [-482.215] (-480.972) * (-483.303) (-481.931) (-482.031) [-482.601] -- 0:00:42
158000 -- (-482.761) [-482.941] (-482.918) (-484.717) * [-482.667] (-481.272) (-483.584) (-481.046) -- 0:00:42
158500 -- (-483.837) [-481.042] (-483.870) (-484.815) * (-484.026) (-481.934) (-482.913) [-483.742] -- 0:00:42
159000 -- (-482.287) [-482.659] (-484.127) (-483.970) * [-487.608] (-481.689) (-482.885) (-482.363) -- 0:00:42
159500 -- (-482.506) (-480.560) (-481.571) [-481.977] * (-482.656) (-482.290) [-482.691] (-481.536) -- 0:00:42
160000 -- (-483.725) (-482.533) [-481.079] (-482.847) * (-484.756) (-480.668) [-481.890] (-480.540) -- 0:00:42
Average standard deviation of split frequencies: 0.017604
160500 -- (-482.929) (-480.765) [-482.523] (-482.088) * (-484.679) [-482.033] (-481.001) (-480.518) -- 0:00:41
161000 -- (-481.771) (-483.584) [-482.395] (-484.693) * [-483.243] (-484.175) (-487.869) (-482.390) -- 0:00:41
161500 -- (-485.646) (-481.141) [-480.554] (-483.056) * [-480.741] (-484.708) (-483.525) (-482.444) -- 0:00:41
162000 -- (-486.543) [-481.104] (-481.184) (-485.428) * (-485.627) (-480.649) (-480.862) [-484.148] -- 0:00:41
162500 -- (-485.723) (-481.456) (-483.426) [-485.433] * (-483.876) (-482.038) [-480.815] (-485.461) -- 0:00:41
163000 -- (-482.602) (-481.458) [-481.658] (-480.751) * (-484.232) [-486.202] (-480.722) (-485.487) -- 0:00:41
163500 -- (-483.832) [-485.672] (-481.933) (-484.696) * (-483.837) (-480.683) [-481.202] (-484.693) -- 0:00:40
164000 -- (-484.969) [-482.760] (-481.850) (-482.928) * (-482.582) (-483.831) (-483.647) [-481.176] -- 0:00:40
164500 -- (-484.809) [-482.932] (-484.531) (-483.460) * [-481.317] (-484.018) (-483.395) (-486.107) -- 0:00:40
165000 -- (-482.007) (-482.112) (-485.482) [-480.746] * (-484.128) (-485.083) [-484.230] (-483.331) -- 0:00:40
Average standard deviation of split frequencies: 0.015146
165500 -- (-484.101) (-483.271) (-482.483) [-484.921] * (-483.540) [-483.072] (-481.092) (-480.520) -- 0:00:40
166000 -- [-483.140] (-482.970) (-482.525) (-480.960) * (-481.640) [-482.731] (-482.737) (-482.113) -- 0:00:40
166500 -- (-481.098) [-480.891] (-484.987) (-481.259) * (-483.129) (-483.942) (-482.343) [-480.747] -- 0:00:40
167000 -- (-482.588) [-483.811] (-485.739) (-485.279) * (-481.548) [-482.124] (-483.622) (-483.228) -- 0:00:39
167500 -- [-483.927] (-481.003) (-481.280) (-485.672) * (-481.673) [-484.644] (-482.701) (-483.107) -- 0:00:39
168000 -- (-485.296) (-488.625) [-481.184] (-486.479) * [-483.753] (-484.796) (-483.496) (-482.651) -- 0:00:39
168500 -- (-483.406) [-482.914] (-484.334) (-484.226) * (-481.220) (-482.460) [-486.430] (-485.773) -- 0:00:39
169000 -- (-486.878) (-481.980) [-484.253] (-481.196) * [-482.721] (-483.668) (-482.346) (-481.569) -- 0:00:39
169500 -- (-484.976) (-483.112) [-482.230] (-481.191) * (-481.580) (-483.304) (-484.589) [-481.216] -- 0:00:39
170000 -- (-483.535) [-480.811] (-481.317) (-483.529) * (-485.514) (-480.714) [-484.145] (-482.093) -- 0:00:39
Average standard deviation of split frequencies: 0.018414
170500 -- (-487.119) (-487.690) (-485.521) [-483.562] * (-485.959) (-483.170) (-483.510) [-481.013] -- 0:00:43
171000 -- [-482.584] (-481.212) (-483.583) (-483.053) * (-482.602) (-483.775) (-482.572) [-484.244] -- 0:00:43
171500 -- (-481.468) (-485.250) [-483.025] (-482.850) * (-481.895) (-482.336) [-483.341] (-481.293) -- 0:00:43
172000 -- (-493.600) (-486.674) [-482.016] (-483.399) * (-483.307) [-480.995] (-481.390) (-481.932) -- 0:00:43
172500 -- (-481.612) [-481.504] (-483.077) (-484.625) * (-481.140) (-481.982) (-481.912) [-480.666] -- 0:00:43
173000 -- (-483.712) (-481.625) [-482.652] (-484.624) * (-486.377) (-480.795) [-482.572] (-482.495) -- 0:00:43
173500 -- (-483.043) (-482.440) [-482.990] (-484.374) * (-482.296) [-481.840] (-486.039) (-482.011) -- 0:00:42
174000 -- [-481.492] (-482.173) (-482.311) (-483.850) * [-481.549] (-481.633) (-484.470) (-480.589) -- 0:00:42
174500 -- (-483.077) (-483.219) (-483.171) [-483.284] * (-482.678) [-483.694] (-481.728) (-484.518) -- 0:00:42
175000 -- (-480.952) [-486.857] (-481.227) (-483.558) * (-483.453) [-486.640] (-485.286) (-481.912) -- 0:00:42
Average standard deviation of split frequencies: 0.019642
175500 -- (-488.313) (-482.921) [-482.153] (-482.283) * (-482.845) (-481.618) [-483.975] (-482.292) -- 0:00:42
176000 -- (-488.457) (-481.972) (-481.833) [-482.213] * (-482.408) (-481.453) [-481.707] (-481.059) -- 0:00:42
176500 -- [-482.356] (-480.756) (-483.055) (-484.361) * [-481.955] (-483.641) (-483.168) (-481.657) -- 0:00:41
177000 -- (-481.198) (-480.716) [-480.780] (-484.280) * (-483.443) [-481.394] (-481.793) (-481.468) -- 0:00:41
177500 -- (-483.714) (-481.375) [-481.523] (-483.245) * (-483.356) [-481.018] (-485.171) (-484.313) -- 0:00:41
178000 -- (-482.852) (-481.484) [-483.967] (-481.772) * (-487.408) (-484.978) [-482.448] (-484.052) -- 0:00:41
178500 -- (-483.088) (-482.741) (-487.659) [-483.379] * (-485.287) (-485.112) [-482.486] (-485.374) -- 0:00:41
179000 -- (-482.257) [-486.614] (-485.934) (-482.333) * [-481.639] (-481.951) (-482.499) (-486.281) -- 0:00:41
179500 -- (-491.320) (-481.248) [-481.473] (-481.110) * [-482.679] (-480.948) (-487.103) (-483.430) -- 0:00:41
180000 -- (-490.402) (-488.035) (-483.264) [-484.391] * (-482.128) [-481.000] (-486.236) (-482.089) -- 0:00:41
Average standard deviation of split frequencies: 0.017395
180500 -- (-482.726) (-481.047) (-482.006) [-483.331] * (-483.227) (-483.253) (-486.501) [-480.747] -- 0:00:40
181000 -- [-483.463] (-485.423) (-482.569) (-483.153) * (-481.607) (-482.842) (-483.792) [-482.695] -- 0:00:40
181500 -- (-484.449) (-484.793) (-482.137) [-481.362] * [-481.587] (-483.884) (-483.376) (-481.234) -- 0:00:40
182000 -- (-483.808) (-482.110) [-481.842] (-482.299) * (-481.952) (-483.706) [-480.759] (-481.921) -- 0:00:40
182500 -- (-481.043) (-483.313) (-482.982) [-482.582] * (-485.832) (-482.965) [-482.748] (-480.672) -- 0:00:40
183000 -- (-483.862) (-482.344) (-486.087) [-481.778] * [-480.864] (-483.557) (-483.501) (-481.306) -- 0:00:40
183500 -- (-481.519) (-482.421) [-481.071] (-480.407) * [-484.278] (-481.639) (-481.100) (-482.684) -- 0:00:40
184000 -- (-484.687) [-482.222] (-482.326) (-481.524) * (-488.552) (-481.663) (-482.002) [-482.475] -- 0:00:39
184500 -- (-483.147) (-480.360) (-482.615) [-483.777] * [-483.168] (-482.113) (-483.246) (-482.258) -- 0:00:39
185000 -- (-485.135) (-480.652) (-483.106) [-480.578] * (-482.097) (-483.511) (-484.929) [-482.823] -- 0:00:39
Average standard deviation of split frequencies: 0.016896
185500 -- (-481.117) (-480.306) (-483.634) [-483.577] * (-481.893) (-483.020) [-483.695] (-483.180) -- 0:00:39
186000 -- (-482.980) (-482.447) (-482.316) [-485.122] * (-482.767) (-481.748) (-481.511) [-483.999] -- 0:00:39
186500 -- (-482.181) [-482.056] (-481.955) (-482.285) * [-481.121] (-481.654) (-483.668) (-482.886) -- 0:00:39
187000 -- (-481.788) (-481.771) [-482.586] (-482.320) * [-483.566] (-482.458) (-481.847) (-482.801) -- 0:00:39
187500 -- (-483.071) [-482.737] (-483.701) (-481.085) * (-482.222) (-485.181) [-481.451] (-485.381) -- 0:00:39
188000 -- (-485.598) (-481.273) (-482.480) [-480.909] * (-488.226) [-481.224] (-483.156) (-481.850) -- 0:00:38
188500 -- [-482.508] (-482.249) (-483.601) (-483.364) * (-482.081) (-482.371) (-481.692) [-482.038] -- 0:00:38
189000 -- [-481.207] (-483.475) (-483.122) (-481.838) * (-482.082) (-481.807) (-483.311) [-482.029] -- 0:00:38
189500 -- (-486.799) [-485.278] (-480.965) (-481.458) * (-481.028) (-481.632) [-483.464] (-486.005) -- 0:00:42
190000 -- (-485.287) (-482.133) [-481.615] (-480.711) * (-484.812) [-485.612] (-485.769) (-482.419) -- 0:00:42
Average standard deviation of split frequencies: 0.014834
190500 -- (-482.762) (-480.886) (-480.985) [-481.266] * (-482.014) [-482.566] (-483.805) (-481.807) -- 0:00:42
191000 -- (-481.198) (-482.607) (-481.928) [-481.508] * (-484.589) (-483.761) [-481.102] (-483.542) -- 0:00:42
191500 -- (-480.841) [-481.691] (-482.862) (-488.170) * (-480.868) (-484.871) (-482.458) [-481.434] -- 0:00:42
192000 -- (-481.503) [-484.509] (-485.416) (-487.535) * (-482.492) (-485.466) [-484.799] (-483.676) -- 0:00:42
192500 -- (-481.309) (-481.883) (-482.598) [-482.826] * (-482.163) (-483.107) [-485.295] (-481.268) -- 0:00:41
193000 -- (-482.259) (-481.913) [-483.585] (-483.898) * (-481.860) (-483.951) (-488.892) [-481.682] -- 0:00:41
193500 -- (-480.865) (-481.697) [-481.826] (-484.307) * (-480.763) (-484.111) (-489.409) [-481.523] -- 0:00:41
194000 -- (-484.918) [-483.183] (-484.896) (-480.450) * (-486.354) (-483.442) [-480.876] (-482.857) -- 0:00:41
194500 -- (-483.350) [-482.818] (-482.287) (-485.460) * (-481.805) [-483.366] (-481.555) (-480.778) -- 0:00:41
195000 -- (-480.740) [-483.463] (-481.308) (-483.093) * [-482.152] (-486.300) (-485.639) (-481.451) -- 0:00:41
Average standard deviation of split frequencies: 0.017638
195500 -- (-481.089) [-481.908] (-482.084) (-485.239) * (-485.118) (-480.517) (-484.226) [-483.918] -- 0:00:41
196000 -- (-482.897) (-482.349) [-483.509] (-480.920) * (-485.143) (-482.763) [-482.264] (-480.661) -- 0:00:41
196500 -- (-485.074) (-483.740) (-490.278) [-485.292] * (-481.956) (-483.943) (-481.368) [-488.586] -- 0:00:40
197000 -- (-487.295) (-482.096) (-483.956) [-482.574] * [-484.094] (-480.702) (-481.825) (-481.798) -- 0:00:40
197500 -- (-482.545) (-480.891) [-481.577] (-487.087) * [-481.903] (-481.612) (-484.609) (-486.501) -- 0:00:40
198000 -- (-487.095) (-484.114) (-481.694) [-483.167] * (-482.562) (-483.319) (-480.876) [-483.100] -- 0:00:40
198500 -- (-481.678) (-483.028) [-482.412] (-484.145) * (-481.037) (-483.684) (-483.114) [-482.254] -- 0:00:40
199000 -- (-484.827) [-483.526] (-484.078) (-483.335) * (-482.836) (-485.460) [-481.590] (-483.823) -- 0:00:40
199500 -- (-484.287) [-481.582] (-486.059) (-486.458) * (-482.543) [-483.124] (-484.972) (-481.977) -- 0:00:40
200000 -- (-485.327) [-481.504] (-481.417) (-484.536) * [-481.848] (-480.586) (-484.451) (-484.725) -- 0:00:40
Average standard deviation of split frequencies: 0.021926
200500 -- (-485.372) (-483.089) [-483.902] (-481.376) * (-484.431) [-480.376] (-480.504) (-480.656) -- 0:00:39
201000 -- (-481.677) (-481.368) [-483.134] (-483.392) * (-484.324) (-484.988) [-484.759] (-482.686) -- 0:00:39
201500 -- (-491.653) (-482.103) [-485.185] (-483.077) * (-484.460) (-483.476) (-482.218) [-480.982] -- 0:00:39
202000 -- (-481.184) [-481.770] (-481.953) (-486.818) * (-483.729) [-483.820] (-485.994) (-484.805) -- 0:00:39
202500 -- (-481.042) (-481.777) [-483.097] (-485.186) * [-483.464] (-481.350) (-481.875) (-484.342) -- 0:00:39
203000 -- (-484.865) [-481.172] (-480.953) (-483.114) * (-484.103) (-480.865) (-485.086) [-483.925] -- 0:00:39
203500 -- [-482.022] (-482.446) (-485.525) (-481.257) * [-481.331] (-484.720) (-486.983) (-482.255) -- 0:00:39
204000 -- (-489.032) (-481.897) [-483.187] (-482.709) * (-484.784) [-482.807] (-482.087) (-481.339) -- 0:00:39
204500 -- (-483.620) [-482.453] (-482.028) (-484.790) * (-486.068) (-484.402) [-483.991] (-481.281) -- 0:00:38
205000 -- (-482.224) (-483.694) [-484.947] (-484.387) * [-482.549] (-484.844) (-485.643) (-482.180) -- 0:00:38
Average standard deviation of split frequencies: 0.018307
205500 -- (-484.194) (-483.048) (-483.322) [-481.638] * (-486.836) [-482.783] (-485.117) (-482.455) -- 0:00:38
206000 -- [-483.687] (-484.989) (-481.608) (-483.182) * (-482.265) (-484.842) [-482.188] (-482.161) -- 0:00:38
206500 -- (-481.561) (-484.148) [-480.548] (-480.689) * (-481.787) [-481.977] (-488.151) (-484.605) -- 0:00:38
207000 -- [-481.120] (-482.719) (-483.976) (-481.208) * (-484.136) (-482.630) (-483.340) [-483.023] -- 0:00:38
207500 -- (-481.202) [-481.506] (-483.937) (-481.671) * [-481.590] (-481.757) (-481.519) (-483.160) -- 0:00:38
208000 -- (-484.445) [-485.868] (-484.513) (-486.838) * (-486.801) (-484.297) [-481.649] (-482.096) -- 0:00:38
208500 -- [-481.953] (-481.412) (-482.428) (-482.597) * (-482.627) (-484.207) [-482.117] (-482.131) -- 0:00:37
209000 -- (-488.489) [-481.319] (-486.349) (-485.277) * [-481.160] (-481.265) (-483.787) (-486.323) -- 0:00:37
209500 -- (-481.581) (-483.468) (-488.485) [-486.430] * (-483.892) (-483.081) [-481.880] (-482.559) -- 0:00:37
210000 -- (-481.025) (-482.545) (-483.055) [-481.289] * (-484.466) [-482.286] (-482.875) (-483.696) -- 0:00:37
Average standard deviation of split frequencies: 0.016410
210500 -- [-483.087] (-482.573) (-483.711) (-480.613) * (-486.695) [-486.079] (-482.854) (-490.788) -- 0:00:37
211000 -- (-484.876) (-482.351) (-483.965) [-480.624] * (-484.857) [-490.911] (-486.680) (-485.774) -- 0:00:41
211500 -- (-483.160) (-481.690) (-487.782) [-480.619] * [-483.803] (-486.023) (-482.853) (-481.878) -- 0:00:41
212000 -- (-482.517) (-486.373) (-484.008) [-481.902] * [-481.139] (-481.332) (-484.059) (-481.089) -- 0:00:40
212500 -- [-481.289] (-485.578) (-484.619) (-482.083) * (-487.347) (-484.138) (-490.752) [-482.186] -- 0:00:40
213000 -- (-480.436) [-487.580] (-482.869) (-485.419) * [-482.489] (-484.021) (-482.632) (-483.796) -- 0:00:40
213500 -- (-480.721) (-481.354) [-482.455] (-484.936) * (-481.800) [-482.167] (-483.010) (-482.994) -- 0:00:40
214000 -- [-480.202] (-482.969) (-489.485) (-483.870) * (-482.169) (-481.093) [-481.972] (-480.904) -- 0:00:40
214500 -- [-480.539] (-484.454) (-484.722) (-482.349) * (-482.821) [-486.740] (-481.903) (-482.526) -- 0:00:40
215000 -- [-481.250] (-483.454) (-483.959) (-486.809) * (-481.497) (-490.107) (-481.163) [-485.445] -- 0:00:40
Average standard deviation of split frequencies: 0.016004
215500 -- (-481.914) (-481.086) [-480.831] (-481.001) * (-483.618) [-481.971] (-480.582) (-483.697) -- 0:00:40
216000 -- (-482.343) (-485.009) [-483.893] (-481.277) * (-485.147) [-482.734] (-481.681) (-481.824) -- 0:00:39
216500 -- (-484.410) (-483.628) (-484.782) [-484.845] * (-481.690) [-482.517] (-482.319) (-481.885) -- 0:00:39
217000 -- (-482.057) (-481.929) (-481.229) [-482.399] * (-483.194) (-482.300) [-481.483] (-485.523) -- 0:00:39
217500 -- [-483.628] (-482.654) (-484.139) (-484.831) * (-481.617) [-483.538] (-483.901) (-483.356) -- 0:00:39
218000 -- (-484.534) (-481.050) [-481.838] (-484.942) * (-482.770) (-484.043) [-484.750] (-480.566) -- 0:00:39
218500 -- [-483.372] (-481.469) (-483.820) (-485.379) * (-482.365) (-481.157) [-481.673] (-482.634) -- 0:00:39
219000 -- [-484.485] (-483.587) (-481.715) (-482.643) * (-485.264) [-483.808] (-481.709) (-483.695) -- 0:00:39
219500 -- (-482.939) (-484.479) [-488.458] (-485.096) * (-481.006) (-483.950) (-480.886) [-482.803] -- 0:00:39
220000 -- (-481.679) (-483.468) (-488.018) [-481.496] * (-482.494) (-482.865) [-481.946] (-482.577) -- 0:00:39
Average standard deviation of split frequencies: 0.019939
220500 -- [-483.060] (-484.482) (-489.565) (-482.262) * (-481.961) (-482.897) [-481.282] (-483.079) -- 0:00:38
221000 -- [-483.675] (-483.179) (-484.362) (-481.961) * (-481.317) (-483.944) [-482.136] (-482.515) -- 0:00:38
221500 -- (-486.582) (-481.503) (-482.500) [-480.983] * (-483.881) (-481.917) (-482.009) [-484.558] -- 0:00:38
222000 -- (-482.258) (-482.462) (-480.577) [-482.708] * (-485.319) (-482.593) [-481.571] (-480.884) -- 0:00:38
222500 -- [-482.608] (-485.028) (-481.433) (-481.820) * (-481.756) [-484.267] (-482.329) (-483.579) -- 0:00:38
223000 -- [-481.755] (-483.049) (-484.084) (-481.447) * (-485.293) (-481.233) [-487.414] (-482.173) -- 0:00:38
223500 -- (-480.948) (-480.599) (-480.709) [-481.413] * (-482.784) [-485.128] (-481.422) (-483.148) -- 0:00:38
224000 -- (-482.126) (-481.776) [-481.100] (-481.295) * [-483.586] (-484.233) (-482.809) (-482.696) -- 0:00:38
224500 -- [-482.477] (-482.033) (-481.370) (-485.933) * (-486.129) (-485.039) (-484.792) [-482.867] -- 0:00:37
225000 -- [-482.471] (-480.772) (-487.877) (-483.423) * (-487.920) (-480.592) [-483.317] (-483.678) -- 0:00:37
Average standard deviation of split frequencies: 0.019468
225500 -- [-481.580] (-481.455) (-482.478) (-489.494) * (-482.459) (-480.534) (-481.072) [-484.575] -- 0:00:37
226000 -- (-482.684) (-486.645) [-481.761] (-484.220) * (-482.989) (-481.271) (-487.439) [-482.841] -- 0:00:37
226500 -- (-483.935) [-481.047] (-481.347) (-485.364) * (-486.037) [-481.365] (-482.639) (-494.010) -- 0:00:37
227000 -- (-481.865) [-481.619] (-481.035) (-484.594) * (-481.900) [-484.162] (-481.478) (-483.946) -- 0:00:37
227500 -- (-480.586) [-485.311] (-484.035) (-484.628) * (-481.332) [-484.868] (-481.117) (-483.808) -- 0:00:37
228000 -- (-486.493) (-485.846) [-487.231] (-481.605) * (-484.584) (-482.801) (-482.710) [-483.156] -- 0:00:37
228500 -- (-485.395) [-483.318] (-488.202) (-480.893) * [-482.648] (-485.098) (-486.675) (-481.352) -- 0:00:37
229000 -- (-481.756) [-481.527] (-486.116) (-483.255) * (-482.176) (-483.976) (-486.493) [-482.197] -- 0:00:37
229500 -- [-481.333] (-481.312) (-485.410) (-482.009) * (-480.867) (-482.983) (-485.694) [-480.837] -- 0:00:36
230000 -- (-484.744) (-483.541) (-487.217) [-481.455] * (-482.701) (-483.531) (-483.289) [-483.980] -- 0:00:36
Average standard deviation of split frequencies: 0.016349
230500 -- (-485.189) (-481.718) [-481.932] (-482.667) * (-483.718) (-484.632) [-481.400] (-484.931) -- 0:00:36
231000 -- (-482.558) (-484.135) (-482.379) [-483.375] * (-481.682) (-480.750) [-483.891] (-486.795) -- 0:00:36
231500 -- (-484.362) (-482.965) (-481.673) [-483.897] * [-484.783] (-482.344) (-481.617) (-481.819) -- 0:00:36
232000 -- (-481.235) (-482.227) (-482.326) [-482.217] * (-481.082) (-480.786) [-481.383] (-485.171) -- 0:00:36
232500 -- (-481.118) [-482.087] (-481.359) (-484.623) * (-481.897) (-482.408) (-482.564) [-486.320] -- 0:00:39
233000 -- (-481.939) [-480.776] (-480.790) (-481.576) * [-482.468] (-483.350) (-485.479) (-482.868) -- 0:00:39
233500 -- [-481.015] (-480.294) (-484.350) (-481.850) * (-480.824) (-483.896) (-485.292) [-481.509] -- 0:00:39
234000 -- (-482.666) (-484.871) (-483.070) [-481.297] * (-481.293) (-482.214) (-483.699) [-481.534] -- 0:00:39
234500 -- (-481.215) (-481.102) [-481.055] (-481.847) * (-482.583) [-482.817] (-483.534) (-482.264) -- 0:00:39
235000 -- (-483.377) (-485.070) (-482.066) [-483.154] * (-485.322) [-481.114] (-484.853) (-483.722) -- 0:00:39
Average standard deviation of split frequencies: 0.017311
235500 -- [-485.553] (-483.320) (-484.423) (-481.293) * (-484.113) [-480.327] (-487.509) (-484.082) -- 0:00:38
236000 -- [-482.215] (-482.473) (-482.874) (-481.263) * (-482.381) (-483.175) [-483.185] (-481.360) -- 0:00:38
236500 -- (-485.131) (-485.304) [-483.753] (-483.014) * (-483.916) [-482.937] (-483.975) (-483.978) -- 0:00:38
237000 -- (-483.630) [-480.639] (-482.869) (-483.664) * [-481.524] (-484.902) (-486.218) (-488.303) -- 0:00:38
237500 -- [-484.695] (-482.279) (-481.661) (-480.381) * (-483.217) [-484.319] (-481.904) (-484.203) -- 0:00:38
238000 -- (-485.424) (-483.450) [-480.742] (-486.773) * (-484.037) (-483.648) (-481.291) [-481.172] -- 0:00:38
238500 -- (-482.364) (-482.347) (-484.153) [-481.730] * (-484.567) (-480.986) (-482.958) [-481.219] -- 0:00:38
239000 -- [-484.641] (-482.605) (-481.732) (-482.878) * (-485.514) (-482.705) [-481.048] (-485.812) -- 0:00:38
239500 -- [-483.045] (-482.203) (-484.659) (-485.539) * [-482.874] (-481.979) (-485.747) (-485.074) -- 0:00:38
240000 -- (-481.073) [-482.697] (-481.718) (-486.002) * [-484.549] (-482.673) (-485.482) (-484.278) -- 0:00:38
Average standard deviation of split frequencies: 0.016976
240500 -- (-482.557) (-481.376) (-484.435) [-483.108] * (-486.744) (-482.032) (-488.988) [-483.522] -- 0:00:37
241000 -- (-484.510) (-481.923) [-485.808] (-480.862) * (-482.608) (-482.555) [-484.271] (-482.507) -- 0:00:37
241500 -- [-482.738] (-482.035) (-481.547) (-481.892) * (-482.107) (-484.973) (-483.693) [-483.786] -- 0:00:37
242000 -- (-486.981) (-481.152) [-484.451] (-481.675) * (-486.634) (-484.568) (-482.448) [-485.044] -- 0:00:37
242500 -- (-483.532) [-484.576] (-483.282) (-484.403) * (-483.753) [-488.469] (-484.011) (-483.409) -- 0:00:37
243000 -- [-482.261] (-483.427) (-482.019) (-484.886) * (-483.336) [-480.625] (-482.486) (-483.025) -- 0:00:37
243500 -- (-484.732) (-482.085) [-482.258] (-482.709) * (-482.393) (-481.852) [-482.013] (-484.084) -- 0:00:37
244000 -- (-481.798) [-484.471] (-485.218) (-485.296) * (-481.886) (-483.430) (-482.499) [-481.963] -- 0:00:37
244500 -- (-482.678) (-482.201) (-482.346) [-483.110] * [-481.974] (-480.906) (-482.379) (-482.246) -- 0:00:37
245000 -- (-484.010) (-483.120) (-482.444) [-481.895] * (-486.808) [-482.350] (-482.007) (-485.304) -- 0:00:36
Average standard deviation of split frequencies: 0.015330
245500 -- (-482.910) (-484.053) [-482.879] (-483.553) * [-483.678] (-484.983) (-486.686) (-483.331) -- 0:00:36
246000 -- (-486.430) (-480.868) [-483.719] (-482.947) * (-481.785) [-480.546] (-483.077) (-484.506) -- 0:00:36
246500 -- (-482.546) [-481.036] (-481.714) (-480.632) * (-483.308) [-480.892] (-482.630) (-484.004) -- 0:00:36
247000 -- (-488.524) (-481.736) (-486.218) [-482.209] * [-484.202] (-480.708) (-481.980) (-482.980) -- 0:00:36
247500 -- (-486.252) [-484.248] (-483.487) (-482.442) * (-484.340) [-481.177] (-481.287) (-483.990) -- 0:00:36
248000 -- (-484.657) (-485.678) [-484.122] (-481.073) * (-483.440) (-480.911) [-480.421] (-487.324) -- 0:00:36
248500 -- (-484.398) (-483.411) (-484.728) [-482.062] * [-482.132] (-482.858) (-480.354) (-482.089) -- 0:00:36
249000 -- (-481.257) (-483.826) (-486.038) [-482.985] * (-485.673) [-481.555] (-484.607) (-484.749) -- 0:00:36
249500 -- (-485.694) [-482.095] (-481.236) (-483.035) * (-483.054) (-482.450) [-486.534] (-483.754) -- 0:00:36
250000 -- (-485.583) (-480.964) [-482.831] (-482.536) * (-482.954) [-482.026] (-481.164) (-484.868) -- 0:00:36
Average standard deviation of split frequencies: 0.016299
250500 -- (-483.277) [-483.002] (-486.065) (-482.929) * (-482.882) (-482.218) (-489.375) [-483.006] -- 0:00:35
251000 -- (-482.380) (-482.798) [-483.622] (-483.674) * (-480.988) (-484.033) (-483.755) [-488.535] -- 0:00:35
251500 -- (-482.919) (-482.430) (-483.876) [-482.370] * (-483.619) (-481.251) [-481.361] (-485.874) -- 0:00:35
252000 -- (-488.005) [-480.952] (-488.092) (-482.581) * [-483.821] (-490.933) (-481.225) (-482.196) -- 0:00:35
252500 -- (-482.844) [-481.324] (-482.840) (-483.237) * (-486.996) (-487.488) [-482.760] (-488.810) -- 0:00:35
253000 -- [-482.464] (-482.567) (-487.269) (-481.862) * [-484.629] (-481.067) (-485.977) (-482.728) -- 0:00:35
253500 -- (-482.977) [-482.359] (-490.102) (-481.661) * [-480.862] (-482.031) (-481.819) (-482.731) -- 0:00:35
254000 -- (-483.221) (-486.003) (-482.683) [-481.405] * (-482.634) (-482.414) [-481.421] (-483.557) -- 0:00:35
254500 -- (-482.183) (-481.008) (-482.221) [-482.030] * (-480.963) (-481.863) (-481.435) [-481.740] -- 0:00:38
255000 -- (-481.833) (-481.052) (-482.838) [-482.724] * (-482.730) (-482.668) (-480.935) [-482.287] -- 0:00:37
Average standard deviation of split frequencies: 0.015959
255500 -- [-481.349] (-484.932) (-481.006) (-482.958) * (-485.448) (-481.675) [-483.217] (-480.852) -- 0:00:37
256000 -- (-484.129) [-482.934] (-484.054) (-481.597) * (-484.932) (-481.795) (-481.511) [-482.068] -- 0:00:37
256500 -- (-482.742) (-482.203) (-482.961) [-483.334] * [-482.009] (-481.247) (-483.649) (-481.079) -- 0:00:37
257000 -- (-486.551) (-481.295) [-481.602] (-483.592) * (-483.373) (-486.602) (-485.082) [-485.713] -- 0:00:37
257500 -- (-483.273) [-480.766] (-483.237) (-482.545) * (-482.618) (-482.251) (-483.901) [-484.890] -- 0:00:37
258000 -- (-485.896) [-480.516] (-481.493) (-480.782) * (-483.713) (-483.972) [-484.246] (-486.296) -- 0:00:37
258500 -- (-482.659) [-483.256] (-481.930) (-481.505) * (-481.243) [-488.885] (-481.854) (-484.919) -- 0:00:37
259000 -- (-481.136) (-482.604) [-483.579] (-482.662) * (-484.031) (-488.581) [-482.240] (-483.442) -- 0:00:37
259500 -- (-482.316) (-485.172) [-481.328] (-482.430) * [-483.252] (-480.697) (-481.231) (-483.041) -- 0:00:37
260000 -- (-482.875) (-486.543) (-485.066) [-483.720] * [-482.329] (-481.080) (-482.431) (-481.845) -- 0:00:37
Average standard deviation of split frequencies: 0.012056
260500 -- [-484.225] (-482.832) (-483.693) (-481.321) * (-482.691) (-488.814) (-483.980) [-481.229] -- 0:00:36
261000 -- (-483.502) (-483.279) (-483.190) [-480.742] * (-481.462) (-489.580) [-481.127] (-481.519) -- 0:00:36
261500 -- (-482.687) (-483.758) (-483.182) [-485.586] * [-482.877] (-484.219) (-480.959) (-483.468) -- 0:00:36
262000 -- [-480.612] (-483.997) (-486.494) (-481.827) * (-483.373) (-483.341) [-483.924] (-482.616) -- 0:00:36
262500 -- (-483.612) (-481.938) [-483.522] (-482.243) * (-482.390) (-485.277) [-480.322] (-492.234) -- 0:00:36
263000 -- (-482.489) [-481.992] (-483.304) (-484.110) * (-484.205) (-482.272) [-483.290] (-487.949) -- 0:00:36
263500 -- (-485.646) [-482.177] (-482.186) (-481.186) * [-485.322] (-480.899) (-483.538) (-482.119) -- 0:00:36
264000 -- (-482.547) [-481.295] (-481.344) (-481.181) * (-482.713) (-484.118) [-484.166] (-482.025) -- 0:00:36
264500 -- (-481.110) (-481.594) [-482.769] (-483.366) * [-484.078] (-482.935) (-482.458) (-484.697) -- 0:00:36
265000 -- (-481.449) [-482.591] (-481.206) (-488.106) * (-483.723) (-485.139) [-481.360] (-484.210) -- 0:00:36
Average standard deviation of split frequencies: 0.009452
265500 -- (-483.305) [-482.616] (-482.635) (-483.296) * (-481.623) (-480.914) [-480.797] (-486.207) -- 0:00:35
266000 -- (-481.958) [-481.241] (-484.051) (-483.695) * (-484.278) (-480.388) (-482.168) [-484.154] -- 0:00:35
266500 -- (-480.802) [-486.384] (-481.475) (-481.865) * (-484.866) [-484.702] (-480.759) (-482.733) -- 0:00:35
267000 -- (-483.546) [-481.925] (-480.866) (-481.444) * (-482.903) (-483.335) (-482.821) [-480.901] -- 0:00:35
267500 -- (-485.183) [-482.186] (-483.554) (-481.217) * (-486.257) (-485.785) (-480.468) [-482.628] -- 0:00:35
268000 -- (-485.251) (-482.759) (-481.278) [-481.180] * (-482.895) [-485.563] (-482.206) (-481.783) -- 0:00:35
268500 -- (-483.409) [-481.628] (-483.572) (-480.645) * (-481.701) (-481.928) (-484.754) [-486.245] -- 0:00:35
269000 -- [-483.146] (-481.815) (-481.098) (-481.381) * (-482.483) (-482.611) [-481.947] (-483.008) -- 0:00:35
269500 -- (-487.977) [-481.345] (-481.715) (-483.029) * (-480.511) (-482.321) [-482.722] (-484.791) -- 0:00:35
270000 -- (-485.869) (-480.833) [-482.874] (-481.593) * [-480.757] (-482.689) (-485.733) (-483.618) -- 0:00:35
Average standard deviation of split frequencies: 0.013933
270500 -- (-484.137) (-481.540) (-486.908) [-480.324] * (-481.405) (-482.762) [-486.092] (-481.740) -- 0:00:35
271000 -- (-482.194) (-482.939) (-485.871) [-483.863] * [-480.626] (-483.329) (-482.686) (-482.051) -- 0:00:34
271500 -- (-482.127) (-481.580) (-482.152) [-484.596] * [-482.328] (-485.462) (-482.053) (-481.885) -- 0:00:34
272000 -- (-483.190) (-484.013) (-482.728) [-482.990] * [-483.319] (-482.855) (-481.137) (-484.812) -- 0:00:34
272500 -- [-483.368] (-485.005) (-483.609) (-481.994) * (-481.564) (-481.295) (-481.866) [-482.378] -- 0:00:34
273000 -- [-481.840] (-483.049) (-481.858) (-480.876) * (-483.996) (-482.782) [-482.961] (-482.358) -- 0:00:34
273500 -- [-480.667] (-483.238) (-481.256) (-483.900) * (-481.991) (-483.981) (-486.388) [-486.577] -- 0:00:34
274000 -- [-480.629] (-482.738) (-485.286) (-481.238) * (-484.411) [-483.348] (-482.128) (-486.297) -- 0:00:34
274500 -- (-484.110) (-482.476) [-480.953] (-483.000) * (-482.122) (-482.240) (-482.758) [-482.466] -- 0:00:34
275000 -- (-482.662) (-481.505) [-480.521] (-484.545) * (-483.608) [-486.446] (-483.112) (-483.123) -- 0:00:34
Average standard deviation of split frequencies: 0.015941
275500 -- (-483.294) [-482.549] (-482.828) (-481.248) * [-481.338] (-485.562) (-486.718) (-484.432) -- 0:00:34
276000 -- (-482.336) (-481.229) [-482.490] (-484.055) * (-488.426) [-486.762] (-484.347) (-483.369) -- 0:00:34
276500 -- (-481.538) [-483.319] (-484.984) (-482.882) * [-485.596] (-483.170) (-484.457) (-483.155) -- 0:00:36
277000 -- (-484.564) (-481.640) [-484.608] (-483.538) * (-480.880) [-484.010] (-484.302) (-488.452) -- 0:00:36
277500 -- (-485.244) [-481.188] (-480.924) (-482.227) * [-480.560] (-480.515) (-483.227) (-485.395) -- 0:00:36
278000 -- [-481.578] (-482.689) (-482.052) (-482.335) * (-483.199) (-483.139) [-484.244] (-485.061) -- 0:00:36
278500 -- (-482.215) (-485.292) [-483.279] (-483.058) * [-483.172] (-482.857) (-482.649) (-486.808) -- 0:00:36
279000 -- (-483.706) (-484.732) [-481.147] (-489.173) * [-489.830] (-481.202) (-482.240) (-488.807) -- 0:00:36
279500 -- (-481.380) [-484.217] (-482.117) (-482.331) * (-484.599) [-487.885] (-483.024) (-484.760) -- 0:00:36
280000 -- (-480.579) (-482.840) (-481.211) [-482.157] * (-488.037) (-481.729) (-482.510) [-481.596] -- 0:00:36
Average standard deviation of split frequencies: 0.013437
280500 -- (-481.368) (-486.483) (-483.780) [-485.851] * (-482.155) (-485.046) [-485.384] (-481.352) -- 0:00:35
281000 -- [-482.059] (-480.908) (-485.893) (-487.693) * [-481.805] (-485.226) (-481.324) (-484.052) -- 0:00:35
281500 -- [-480.915] (-483.752) (-481.340) (-481.368) * (-485.124) (-481.474) (-480.841) [-481.246] -- 0:00:35
282000 -- (-481.670) (-482.626) (-482.027) [-482.021] * (-484.220) (-481.387) [-483.313] (-484.012) -- 0:00:35
282500 -- (-484.104) (-482.171) (-484.145) [-485.146] * (-484.383) (-484.303) [-481.923] (-481.354) -- 0:00:35
283000 -- (-483.410) [-482.034] (-483.142) (-484.886) * (-481.235) (-484.196) [-480.953] (-481.317) -- 0:00:35
283500 -- [-481.707] (-484.726) (-483.898) (-484.324) * [-481.032] (-486.271) (-484.289) (-485.435) -- 0:00:35
284000 -- (-487.948) (-482.944) (-485.427) [-484.131] * (-480.743) (-483.220) [-482.308] (-483.611) -- 0:00:35
284500 -- (-482.080) (-484.738) (-482.368) [-482.907] * (-482.019) (-482.494) [-481.853] (-482.595) -- 0:00:35
285000 -- (-488.360) [-487.700] (-481.057) (-481.027) * (-483.415) (-481.366) (-481.067) [-483.168] -- 0:00:35
Average standard deviation of split frequencies: 0.012087
285500 -- (-483.119) (-481.659) (-483.959) [-480.781] * (-485.809) [-482.782] (-484.317) (-482.944) -- 0:00:35
286000 -- (-480.735) [-481.796] (-482.368) (-482.150) * (-482.737) (-480.686) [-482.654] (-482.584) -- 0:00:34
286500 -- [-481.299] (-483.800) (-481.301) (-480.756) * (-482.626) [-481.006] (-481.417) (-485.277) -- 0:00:34
287000 -- [-481.349] (-481.908) (-482.351) (-483.676) * (-483.213) (-483.238) (-481.416) [-484.050] -- 0:00:34
287500 -- [-482.351] (-480.999) (-483.794) (-482.546) * (-482.058) [-483.643] (-481.921) (-482.667) -- 0:00:34
288000 -- (-486.316) (-480.794) (-482.913) [-481.381] * [-481.169] (-482.521) (-482.904) (-481.450) -- 0:00:34
288500 -- [-481.333] (-483.407) (-483.910) (-481.540) * [-483.882] (-482.880) (-485.540) (-481.675) -- 0:00:34
289000 -- (-483.456) (-482.609) [-482.592] (-481.121) * (-480.671) (-480.554) (-483.944) [-481.306] -- 0:00:34
289500 -- (-483.624) (-484.420) [-482.385] (-484.277) * (-480.392) [-482.561] (-483.725) (-482.818) -- 0:00:34
290000 -- [-482.256] (-483.629) (-480.891) (-482.660) * (-485.441) (-482.149) (-484.999) [-482.418] -- 0:00:34
Average standard deviation of split frequencies: 0.010812
290500 -- (-481.007) (-481.977) [-482.739] (-481.777) * (-482.266) [-482.380] (-485.944) (-492.365) -- 0:00:34
291000 -- [-486.149] (-480.553) (-485.780) (-481.178) * (-482.233) (-486.134) (-483.996) [-484.856] -- 0:00:34
291500 -- (-486.441) [-482.979] (-483.574) (-482.222) * (-482.109) (-486.874) [-481.251] (-483.635) -- 0:00:34
292000 -- (-484.574) [-486.762] (-482.040) (-481.898) * (-481.703) [-481.359] (-482.293) (-481.690) -- 0:00:33
292500 -- [-482.318] (-482.164) (-483.213) (-482.812) * [-482.987] (-481.393) (-484.262) (-481.628) -- 0:00:33
293000 -- (-481.640) (-482.373) (-483.576) [-481.886] * (-482.815) (-484.931) (-485.084) [-484.194] -- 0:00:33
293500 -- (-483.840) (-483.250) [-481.642] (-484.179) * (-483.431) (-483.153) [-480.803] (-482.116) -- 0:00:33
294000 -- (-480.917) [-482.762] (-480.958) (-487.092) * (-482.499) (-481.592) [-487.233] (-487.324) -- 0:00:33
294500 -- (-482.105) (-480.876) [-482.933] (-483.616) * [-480.875] (-481.565) (-484.907) (-483.580) -- 0:00:33
295000 -- (-481.282) [-483.646] (-482.545) (-484.415) * (-481.607) [-481.704] (-487.188) (-482.657) -- 0:00:33
Average standard deviation of split frequencies: 0.010617
295500 -- (-481.533) (-488.019) (-485.023) [-483.019] * (-482.210) (-480.378) (-481.140) [-481.898] -- 0:00:33
296000 -- (-484.675) [-480.672] (-481.835) (-481.139) * (-482.468) (-482.436) (-482.256) [-483.386] -- 0:00:33
296500 -- (-483.012) (-482.696) [-487.171] (-480.702) * (-483.432) (-486.526) [-482.136] (-484.724) -- 0:00:33
297000 -- [-482.683] (-481.932) (-482.672) (-482.221) * [-481.862] (-486.368) (-482.316) (-482.755) -- 0:00:33
297500 -- (-480.741) (-482.568) (-482.751) [-481.039] * (-481.423) (-481.896) (-481.380) [-482.275] -- 0:00:33
298000 -- [-480.644] (-489.049) (-480.601) (-481.822) * [-480.675] (-483.562) (-482.550) (-480.639) -- 0:00:32
298500 -- (-482.234) [-483.444] (-484.107) (-482.138) * (-483.835) (-488.548) (-484.393) [-480.987] -- 0:00:32
299000 -- (-484.611) [-482.062] (-482.938) (-481.803) * (-484.898) [-480.868] (-485.817) (-481.330) -- 0:00:35
299500 -- (-483.904) (-484.308) (-484.224) [-481.405] * (-484.279) (-489.326) [-482.025] (-482.493) -- 0:00:35
300000 -- [-482.522] (-481.369) (-482.044) (-481.579) * [-483.445] (-481.665) (-481.745) (-483.330) -- 0:00:35
Average standard deviation of split frequencies: 0.010452
300500 -- (-486.508) (-483.198) [-480.542] (-485.227) * (-483.480) (-482.764) [-482.423] (-480.553) -- 0:00:34
301000 -- (-481.322) (-480.719) (-481.955) [-480.446] * (-480.532) [-482.987] (-482.668) (-486.880) -- 0:00:34
301500 -- (-483.772) (-486.303) [-482.407] (-480.677) * (-482.083) [-482.757] (-481.694) (-482.046) -- 0:00:34
302000 -- [-483.000] (-482.802) (-483.032) (-482.732) * (-481.309) [-483.977] (-484.941) (-481.502) -- 0:00:34
302500 -- (-483.069) [-482.593] (-480.850) (-484.334) * [-481.184] (-482.249) (-483.257) (-481.973) -- 0:00:34
303000 -- [-483.240] (-487.886) (-482.800) (-485.936) * (-486.794) (-483.849) (-482.932) [-481.542] -- 0:00:34
303500 -- (-480.498) [-482.635] (-482.722) (-482.381) * (-481.739) [-483.548] (-480.965) (-486.139) -- 0:00:34
304000 -- (-483.265) (-482.429) (-485.576) [-481.086] * (-486.298) (-483.162) (-485.291) [-485.154] -- 0:00:34
304500 -- (-482.874) [-481.879] (-482.824) (-480.701) * [-482.572] (-488.139) (-485.285) (-483.536) -- 0:00:34
305000 -- (-484.205) (-482.007) [-482.917] (-483.118) * (-481.369) (-482.568) [-480.494] (-485.660) -- 0:00:34
Average standard deviation of split frequencies: 0.011297
305500 -- (-483.823) [-482.270] (-481.820) (-485.708) * (-483.498) (-482.138) (-482.637) [-483.851] -- 0:00:34
306000 -- (-484.472) [-481.631] (-480.462) (-488.060) * (-486.355) (-484.377) [-480.801] (-486.679) -- 0:00:34
306500 -- [-480.492] (-482.467) (-480.993) (-482.859) * [-481.121] (-480.840) (-483.976) (-482.485) -- 0:00:33
307000 -- (-480.699) (-485.298) (-482.982) [-480.749] * (-481.530) (-481.252) [-481.100] (-484.493) -- 0:00:33
307500 -- (-481.776) (-481.035) (-481.453) [-483.914] * [-481.682] (-483.746) (-483.384) (-482.604) -- 0:00:33
308000 -- (-481.773) (-481.448) (-481.747) [-482.808] * (-484.162) (-488.033) (-484.261) [-482.102] -- 0:00:33
308500 -- [-482.393] (-485.266) (-484.948) (-481.577) * (-486.597) [-485.346] (-483.829) (-484.763) -- 0:00:33
309000 -- (-484.112) [-484.783] (-487.468) (-483.329) * (-483.008) [-484.664] (-480.662) (-486.794) -- 0:00:33
309500 -- (-485.535) [-481.908] (-482.886) (-483.463) * (-483.695) [-482.770] (-481.922) (-483.876) -- 0:00:33
310000 -- (-482.781) [-483.093] (-482.966) (-483.097) * [-481.793] (-484.721) (-485.191) (-482.146) -- 0:00:33
Average standard deviation of split frequencies: 0.012139
310500 -- (-481.927) [-485.931] (-482.496) (-481.712) * (-482.848) [-482.754] (-482.533) (-481.906) -- 0:00:33
311000 -- (-480.376) (-480.804) [-481.613] (-481.689) * [-483.831] (-482.780) (-483.119) (-481.533) -- 0:00:33
311500 -- (-484.282) (-484.785) (-486.250) [-481.225] * (-483.215) (-482.525) (-482.059) [-481.552] -- 0:00:33
312000 -- [-483.043] (-482.056) (-481.168) (-481.100) * [-480.765] (-481.917) (-483.025) (-482.487) -- 0:00:33
312500 -- [-481.773] (-481.898) (-481.243) (-482.085) * [-481.800] (-485.578) (-483.151) (-482.313) -- 0:00:33
313000 -- (-481.494) (-483.795) [-482.690] (-482.422) * (-488.433) (-480.742) [-481.403] (-485.299) -- 0:00:32
313500 -- [-484.525] (-482.824) (-484.034) (-489.163) * [-482.057] (-482.174) (-481.357) (-483.371) -- 0:00:32
314000 -- (-481.892) [-481.390] (-482.433) (-483.363) * [-483.653] (-483.924) (-482.864) (-482.289) -- 0:00:32
314500 -- [-481.301] (-482.986) (-482.659) (-483.432) * [-486.006] (-482.490) (-482.020) (-482.059) -- 0:00:32
315000 -- (-481.432) [-482.195] (-483.762) (-488.074) * (-481.980) [-481.335] (-483.372) (-483.551) -- 0:00:32
Average standard deviation of split frequencies: 0.009945
315500 -- [-480.954] (-483.228) (-480.936) (-481.978) * (-483.244) [-482.192] (-482.131) (-483.789) -- 0:00:32
316000 -- (-491.276) [-482.129] (-482.459) (-481.433) * (-482.650) [-482.845] (-480.939) (-483.177) -- 0:00:32
316500 -- (-480.946) [-484.708] (-480.548) (-481.813) * (-489.111) (-482.899) (-480.215) [-483.774] -- 0:00:32
317000 -- (-481.464) (-484.288) (-483.660) [-481.352] * (-482.547) (-484.427) (-482.051) [-481.370] -- 0:00:32
317500 -- [-481.398] (-483.949) (-486.016) (-481.511) * (-483.408) (-481.038) [-482.157] (-480.875) -- 0:00:32
318000 -- [-483.561] (-484.899) (-482.553) (-481.509) * (-484.245) (-481.615) (-483.895) [-482.277] -- 0:00:32
318500 -- (-483.479) [-482.286] (-482.915) (-482.160) * [-483.966] (-488.401) (-482.749) (-481.877) -- 0:00:32
319000 -- (-484.770) [-482.097] (-482.473) (-486.238) * [-484.093] (-482.669) (-487.350) (-482.528) -- 0:00:32
319500 -- (-483.751) (-482.889) (-485.406) [-486.478] * (-483.499) [-485.199] (-482.270) (-485.320) -- 0:00:31
320000 -- (-482.580) (-481.724) (-482.732) [-483.867] * (-482.810) (-482.451) (-481.589) [-482.888] -- 0:00:31
Average standard deviation of split frequencies: 0.011761
320500 -- (-482.764) (-483.804) (-485.359) [-483.554] * (-482.768) (-483.821) [-482.087] (-488.342) -- 0:00:33
321000 -- (-484.806) (-486.763) (-483.835) [-483.465] * (-483.463) (-489.421) [-481.326] (-483.957) -- 0:00:33
321500 -- (-485.099) (-482.780) (-481.798) [-483.332] * (-481.779) [-482.935] (-480.910) (-484.675) -- 0:00:33
322000 -- (-481.802) (-482.952) (-481.016) [-482.247] * (-481.581) [-481.155] (-483.275) (-481.472) -- 0:00:33
322500 -- (-484.808) (-483.596) (-481.612) [-482.543] * (-480.885) (-480.785) (-483.118) [-481.646] -- 0:00:33
323000 -- (-485.391) [-481.605] (-481.351) (-482.161) * (-483.655) (-481.859) (-482.728) [-483.857] -- 0:00:33
323500 -- (-482.110) [-481.178] (-481.272) (-482.115) * (-481.283) (-481.785) [-482.200] (-482.667) -- 0:00:33
324000 -- (-489.350) (-482.701) [-482.794] (-481.859) * [-486.676] (-481.171) (-483.759) (-482.438) -- 0:00:33
324500 -- (-486.345) (-483.190) [-482.546] (-481.068) * (-484.144) [-481.070] (-485.098) (-483.694) -- 0:00:33
325000 -- [-481.863] (-481.855) (-483.679) (-481.461) * (-480.685) (-483.116) [-482.228] (-484.798) -- 0:00:33
Average standard deviation of split frequencies: 0.017352
325500 -- (-482.065) (-483.305) (-483.947) [-481.150] * (-480.812) (-481.964) (-483.235) [-482.057] -- 0:00:33
326000 -- (-483.511) (-481.025) (-483.718) [-483.730] * [-481.066] (-483.082) (-482.145) (-484.634) -- 0:00:33
326500 -- [-481.428] (-483.135) (-483.964) (-481.209) * (-483.566) (-484.165) (-486.302) [-482.139] -- 0:00:33
327000 -- (-483.058) (-482.280) [-484.649] (-485.265) * (-490.507) (-483.587) (-487.418) [-480.535] -- 0:00:32
327500 -- (-483.833) (-484.205) (-480.808) [-484.111] * (-480.776) [-481.686] (-483.297) (-482.134) -- 0:00:32
328000 -- (-481.997) (-482.355) (-484.153) [-481.394] * (-482.153) [-482.635] (-481.213) (-482.214) -- 0:00:32
328500 -- (-482.798) [-483.233] (-483.893) (-485.130) * (-486.207) [-480.535] (-480.547) (-486.669) -- 0:00:32
329000 -- [-482.199] (-483.428) (-482.949) (-483.912) * [-484.972] (-482.431) (-482.511) (-485.836) -- 0:00:32
329500 -- (-482.425) (-482.731) [-482.032] (-480.837) * (-482.563) (-483.790) [-481.748] (-481.510) -- 0:00:32
330000 -- (-483.633) (-483.257) (-483.482) [-481.444] * [-480.754] (-482.669) (-481.282) (-489.645) -- 0:00:32
Average standard deviation of split frequencies: 0.023760
330500 -- (-493.801) (-483.096) (-482.333) [-481.629] * (-484.119) [-484.513] (-482.510) (-487.160) -- 0:00:32
331000 -- (-483.802) (-480.945) (-481.411) [-482.917] * (-481.554) [-481.571] (-481.936) (-481.822) -- 0:00:32
331500 -- (-484.086) [-485.102] (-483.399) (-480.851) * [-482.819] (-482.209) (-483.748) (-483.141) -- 0:00:32
332000 -- (-484.091) [-484.781] (-483.578) (-488.628) * (-485.313) (-481.951) [-481.050] (-483.081) -- 0:00:32
332500 -- (-483.300) [-485.422] (-482.324) (-486.370) * [-484.513] (-484.691) (-482.025) (-484.459) -- 0:00:32
333000 -- (-481.758) (-483.786) (-481.387) [-482.452] * (-487.183) (-484.627) [-480.969] (-483.236) -- 0:00:32
333500 -- (-481.637) (-481.621) (-484.025) [-483.715] * (-490.700) (-483.737) (-483.318) [-481.428] -- 0:00:31
334000 -- (-483.427) [-485.082] (-480.979) (-480.883) * (-488.230) (-482.400) [-481.402] (-482.972) -- 0:00:31
334500 -- (-480.630) [-480.804] (-482.055) (-488.109) * (-482.484) (-484.050) [-480.576] (-481.751) -- 0:00:31
335000 -- (-484.303) (-482.743) (-484.780) [-484.356] * (-482.516) (-484.676) (-481.291) [-481.964] -- 0:00:31
Average standard deviation of split frequencies: 0.022448
335500 -- (-483.204) (-488.221) [-481.352] (-481.201) * (-486.619) [-482.381] (-483.371) (-486.571) -- 0:00:31
336000 -- [-481.302] (-483.485) (-483.964) (-482.874) * (-486.329) (-481.897) (-481.753) [-483.943] -- 0:00:31
336500 -- (-482.947) [-481.956] (-486.288) (-482.391) * (-490.211) [-483.669] (-481.157) (-485.320) -- 0:00:31
337000 -- [-481.556] (-487.923) (-481.473) (-483.435) * (-481.741) [-483.235] (-482.756) (-483.998) -- 0:00:31
337500 -- (-484.253) [-481.603] (-485.372) (-486.216) * [-483.433] (-482.827) (-483.952) (-483.483) -- 0:00:31
338000 -- (-482.316) (-482.542) (-482.946) [-480.649] * [-488.118] (-482.874) (-485.169) (-483.022) -- 0:00:31
338500 -- (-483.141) [-482.612] (-482.982) (-482.016) * (-486.075) [-483.038] (-482.628) (-481.373) -- 0:00:31
339000 -- (-482.940) (-482.278) [-482.301] (-481.218) * [-489.637] (-488.708) (-480.825) (-481.701) -- 0:00:31
339500 -- (-482.796) [-484.521] (-482.330) (-482.933) * (-484.586) (-482.710) [-483.270] (-485.683) -- 0:00:31
340000 -- [-483.294] (-485.845) (-483.449) (-482.602) * (-482.442) (-483.041) [-484.032] (-483.226) -- 0:00:31
Average standard deviation of split frequencies: 0.021218
340500 -- (-487.862) (-481.916) (-482.392) [-481.300] * (-487.582) (-489.518) [-485.118] (-483.352) -- 0:00:30
341000 -- (-481.603) [-481.648] (-481.458) (-481.838) * [-481.394] (-490.396) (-482.405) (-483.545) -- 0:00:30
341500 -- (-481.266) (-481.770) [-483.552] (-482.278) * (-483.763) (-481.702) [-482.423] (-483.154) -- 0:00:30
342000 -- [-485.288] (-482.313) (-483.092) (-483.407) * (-482.975) (-481.449) (-490.862) [-486.986] -- 0:00:30
342500 -- (-483.455) (-483.484) [-484.943] (-485.112) * (-482.207) (-483.088) [-481.297] (-488.676) -- 0:00:30
343000 -- (-483.829) (-482.294) (-482.252) [-484.589] * [-482.399] (-481.791) (-484.164) (-483.970) -- 0:00:32
343500 -- [-482.284] (-487.861) (-485.248) (-481.534) * (-480.910) [-482.247] (-484.244) (-481.090) -- 0:00:32
344000 -- [-482.477] (-484.722) (-481.444) (-482.821) * (-487.363) (-481.872) (-481.253) [-482.573] -- 0:00:32
344500 -- (-485.494) (-484.686) (-485.013) [-481.844] * [-484.845] (-482.404) (-482.534) (-482.222) -- 0:00:32
345000 -- (-483.612) (-481.498) (-483.022) [-481.393] * [-482.851] (-483.810) (-482.297) (-484.715) -- 0:00:32
Average standard deviation of split frequencies: 0.017258
345500 -- (-480.819) [-483.470] (-483.415) (-482.652) * (-483.679) (-481.399) [-482.886] (-484.036) -- 0:00:32
346000 -- (-482.015) [-482.167] (-483.718) (-483.119) * (-481.875) (-483.754) [-482.372] (-483.390) -- 0:00:32
346500 -- [-480.986] (-480.985) (-483.729) (-484.439) * (-483.685) (-482.593) [-481.912] (-482.358) -- 0:00:32
347000 -- (-484.617) (-483.489) (-484.699) [-485.851] * [-484.195] (-482.602) (-482.977) (-480.872) -- 0:00:31
347500 -- (-485.189) (-484.055) (-481.093) [-481.405] * (-481.744) (-482.423) [-481.348] (-480.579) -- 0:00:31
348000 -- (-487.073) (-481.548) [-482.535] (-484.175) * [-483.532] (-484.573) (-485.119) (-483.232) -- 0:00:31
348500 -- [-484.713] (-481.501) (-485.084) (-483.305) * (-487.137) (-482.971) [-487.227] (-482.477) -- 0:00:31
349000 -- [-482.016] (-480.552) (-481.170) (-481.106) * (-482.078) (-482.416) (-483.161) [-485.135] -- 0:00:31
349500 -- (-481.615) [-486.024] (-488.623) (-481.942) * [-480.726] (-486.348) (-486.149) (-481.802) -- 0:00:31
350000 -- [-481.517] (-485.912) (-488.618) (-485.137) * (-484.221) [-481.334] (-482.253) (-481.635) -- 0:00:31
Average standard deviation of split frequencies: 0.016132
350500 -- [-483.126] (-485.467) (-486.205) (-482.817) * (-483.551) [-482.602] (-480.837) (-480.305) -- 0:00:31
351000 -- (-481.415) [-480.561] (-485.580) (-481.421) * [-482.244] (-484.465) (-482.302) (-482.808) -- 0:00:31
351500 -- (-481.289) (-482.715) (-481.871) [-484.351] * (-481.306) (-480.938) [-483.636] (-482.985) -- 0:00:31
352000 -- [-481.657] (-488.650) (-483.605) (-483.365) * (-484.863) (-482.255) (-482.713) [-481.327] -- 0:00:31
352500 -- [-484.018] (-482.560) (-482.078) (-483.825) * (-483.646) [-482.884] (-482.677) (-483.658) -- 0:00:31
353000 -- (-483.468) [-483.431] (-482.307) (-481.664) * [-481.529] (-482.979) (-483.147) (-482.403) -- 0:00:31
353500 -- (-482.262) (-482.698) (-480.588) [-482.723] * [-482.498] (-483.634) (-481.180) (-481.203) -- 0:00:31
354000 -- (-486.192) [-482.147] (-484.652) (-485.937) * (-482.180) (-482.162) (-487.024) [-481.182] -- 0:00:31
354500 -- (-481.836) (-487.460) (-485.341) [-483.723] * (-482.758) (-483.820) (-481.198) [-481.995] -- 0:00:30
355000 -- (-482.027) (-493.583) (-483.485) [-481.518] * (-483.810) [-482.249] (-481.288) (-481.279) -- 0:00:30
Average standard deviation of split frequencies: 0.015890
355500 -- (-480.952) (-482.886) (-486.035) [-481.787] * (-484.765) (-482.709) (-483.688) [-480.785] -- 0:00:30
356000 -- (-482.740) [-483.295] (-482.808) (-480.946) * (-484.246) (-485.526) [-481.451] (-483.244) -- 0:00:30
356500 -- (-481.337) (-481.519) [-483.367] (-480.810) * (-483.611) (-484.677) (-486.914) [-481.315] -- 0:00:30
357000 -- [-482.577] (-481.860) (-480.623) (-481.003) * (-484.918) [-482.592] (-482.573) (-481.745) -- 0:00:30
357500 -- [-481.175] (-481.923) (-483.036) (-480.856) * [-482.468] (-482.936) (-482.886) (-481.660) -- 0:00:30
358000 -- [-481.933] (-483.909) (-481.287) (-482.065) * (-483.504) (-481.168) (-481.690) [-481.962] -- 0:00:30
358500 -- (-486.572) (-483.589) [-482.932] (-485.211) * (-483.754) (-481.375) [-483.904] (-480.857) -- 0:00:30
359000 -- [-481.079] (-484.088) (-481.233) (-485.272) * (-483.391) (-487.198) [-482.119] (-481.843) -- 0:00:30
359500 -- (-482.793) [-484.309] (-485.583) (-481.835) * (-482.375) (-482.370) (-482.208) [-484.045] -- 0:00:30
360000 -- (-483.264) [-483.936] (-482.296) (-483.433) * (-481.961) [-481.792] (-481.631) (-488.863) -- 0:00:30
Average standard deviation of split frequencies: 0.014813
360500 -- (-482.640) [-481.569] (-481.268) (-481.857) * (-484.310) (-481.373) (-484.364) [-484.045] -- 0:00:30
361000 -- (-481.887) (-482.124) [-483.982] (-486.534) * [-482.223] (-481.915) (-481.326) (-484.291) -- 0:00:30
361500 -- (-482.019) (-482.655) (-482.510) [-484.135] * (-481.188) [-481.445] (-485.563) (-483.554) -- 0:00:30
362000 -- (-486.088) (-485.542) [-480.514] (-484.051) * [-481.080] (-483.100) (-483.238) (-483.235) -- 0:00:29
362500 -- (-483.437) (-482.174) [-483.058] (-489.634) * (-481.930) (-482.539) [-481.894] (-483.831) -- 0:00:29
363000 -- [-481.848] (-482.597) (-487.080) (-481.694) * (-485.005) (-482.718) (-481.350) [-481.021] -- 0:00:29
363500 -- (-481.645) (-483.848) (-483.783) [-482.947] * [-481.307] (-482.876) (-480.920) (-482.014) -- 0:00:29
364000 -- [-481.255] (-483.008) (-484.382) (-482.629) * (-483.686) (-481.285) [-484.274] (-481.902) -- 0:00:29
364500 -- (-481.853) (-482.331) [-481.279] (-480.934) * (-482.982) (-481.143) [-483.197] (-481.016) -- 0:00:29
365000 -- (-483.052) (-486.169) (-481.032) [-481.364] * (-485.722) (-481.326) [-481.194] (-481.104) -- 0:00:29
Average standard deviation of split frequencies: 0.018891
365500 -- [-480.979] (-483.469) (-481.752) (-481.576) * (-483.157) (-481.890) (-481.094) [-483.840] -- 0:00:29
366000 -- [-482.118] (-482.069) (-481.259) (-481.313) * (-484.266) [-484.546] (-483.294) (-482.765) -- 0:00:31
366500 -- (-482.794) (-482.179) [-483.039] (-482.476) * (-486.112) (-483.395) [-485.931] (-485.143) -- 0:00:31
367000 -- (-481.635) (-481.591) [-490.682] (-482.167) * (-489.372) [-482.114] (-482.211) (-483.104) -- 0:00:31
367500 -- (-481.145) [-483.418] (-481.627) (-481.528) * (-482.882) (-482.979) (-486.644) [-481.785] -- 0:00:30
368000 -- (-480.858) (-483.810) (-482.947) [-482.754] * [-485.040] (-482.249) (-482.628) (-485.204) -- 0:00:30
368500 -- (-481.609) [-483.658] (-482.171) (-484.731) * [-483.414] (-483.053) (-483.789) (-484.059) -- 0:00:30
369000 -- (-480.909) (-483.115) (-480.558) [-484.108] * [-481.238] (-485.003) (-482.045) (-484.866) -- 0:00:30
369500 -- (-482.302) (-485.476) (-481.816) [-482.522] * [-483.026] (-481.338) (-481.092) (-484.750) -- 0:00:30
370000 -- (-481.683) (-481.232) [-482.058] (-482.624) * (-482.888) (-481.126) (-484.378) [-480.696] -- 0:00:30
Average standard deviation of split frequencies: 0.019501
370500 -- (-484.798) (-482.423) [-482.723] (-485.679) * [-483.955] (-482.415) (-484.048) (-481.750) -- 0:00:30
371000 -- [-481.471] (-481.137) (-481.909) (-484.664) * (-484.888) [-481.747] (-487.765) (-481.823) -- 0:00:30
371500 -- (-488.787) [-482.717] (-484.621) (-483.356) * [-482.622] (-481.485) (-482.465) (-480.432) -- 0:00:30
372000 -- (-484.256) [-481.246] (-484.519) (-485.768) * (-483.690) (-484.614) (-484.945) [-482.308] -- 0:00:30
372500 -- (-487.233) (-483.068) (-485.816) [-483.407] * (-483.953) (-480.554) [-481.016] (-482.523) -- 0:00:30
373000 -- (-481.564) (-484.688) (-483.384) [-485.313] * (-483.604) [-482.929] (-483.669) (-480.870) -- 0:00:30
373500 -- (-482.139) (-482.662) (-485.377) [-482.884] * (-488.600) (-480.595) [-483.116] (-482.332) -- 0:00:30
374000 -- (-480.685) [-485.537] (-486.698) (-485.465) * [-490.230] (-486.352) (-483.489) (-484.503) -- 0:00:30
374500 -- (-488.721) (-485.129) [-481.838] (-480.797) * (-485.391) (-484.444) [-483.199] (-482.414) -- 0:00:30
375000 -- (-483.945) [-481.787] (-482.805) (-485.877) * (-483.064) (-482.377) (-484.075) [-482.830] -- 0:00:30
Average standard deviation of split frequencies: 0.018388
375500 -- (-482.476) [-482.513] (-481.625) (-482.382) * [-483.916] (-482.542) (-484.888) (-484.797) -- 0:00:29
376000 -- (-481.551) (-484.122) [-481.485] (-482.780) * (-482.383) (-483.878) [-484.314] (-483.546) -- 0:00:29
376500 -- (-488.898) (-481.765) [-481.817] (-482.740) * (-484.276) (-482.315) (-482.269) [-483.135] -- 0:00:29
377000 -- (-481.788) (-482.417) (-483.950) [-481.229] * (-483.947) [-481.992] (-482.040) (-483.433) -- 0:00:29
377500 -- (-480.450) (-482.776) (-481.426) [-482.341] * (-481.620) (-487.811) [-481.524] (-482.456) -- 0:00:29
378000 -- [-481.894] (-481.988) (-482.004) (-481.982) * (-483.099) [-480.387] (-481.308) (-485.810) -- 0:00:29
378500 -- [-481.390] (-484.365) (-481.500) (-485.006) * (-483.421) [-483.199] (-481.249) (-482.558) -- 0:00:29
379000 -- [-484.645] (-483.577) (-486.809) (-481.108) * (-483.430) [-480.894] (-482.302) (-485.664) -- 0:00:29
379500 -- (-483.320) [-482.883] (-483.105) (-482.411) * (-483.160) [-482.927] (-483.673) (-481.686) -- 0:00:29
380000 -- (-484.644) (-486.110) (-481.060) [-482.081] * (-484.254) [-481.987] (-481.577) (-483.950) -- 0:00:29
Average standard deviation of split frequencies: 0.019814
380500 -- (-485.157) [-483.379] (-483.014) (-483.342) * (-482.436) [-486.421] (-481.321) (-482.403) -- 0:00:29
381000 -- (-484.446) [-481.561] (-484.449) (-482.614) * (-482.628) (-486.587) (-481.503) [-481.428] -- 0:00:29
381500 -- (-482.164) (-481.153) [-482.557] (-481.861) * (-481.323) (-484.132) (-481.868) [-483.353] -- 0:00:29
382000 -- (-481.663) [-481.688] (-481.582) (-482.084) * [-481.494] (-481.585) (-482.680) (-481.838) -- 0:00:29
382500 -- (-487.625) (-483.143) [-482.145] (-482.149) * (-481.945) (-481.994) (-481.273) [-484.118] -- 0:00:29
383000 -- (-487.031) (-480.578) (-481.236) [-482.852] * (-483.959) (-483.469) [-482.349] (-482.355) -- 0:00:28
383500 -- (-485.470) [-482.031] (-483.080) (-487.347) * (-482.025) (-482.310) [-482.447] (-481.150) -- 0:00:28
384000 -- (-482.687) [-484.703] (-482.640) (-483.398) * (-481.655) (-481.175) (-486.623) [-482.047] -- 0:00:28
384500 -- (-482.661) (-485.226) (-480.876) [-484.377] * (-481.385) (-482.909) (-486.333) [-482.095] -- 0:00:28
385000 -- (-482.944) (-481.535) [-484.881] (-481.739) * [-480.647] (-483.924) (-480.487) (-481.109) -- 0:00:28
Average standard deviation of split frequencies: 0.018726
385500 -- (-481.460) (-481.185) (-481.342) [-481.600] * (-481.425) (-485.810) [-483.064] (-481.864) -- 0:00:28
386000 -- (-482.842) [-481.726] (-484.526) (-484.256) * [-481.794] (-482.923) (-482.734) (-485.047) -- 0:00:28
386500 -- (-482.622) [-480.273] (-480.937) (-489.250) * (-482.872) [-481.048] (-481.660) (-481.243) -- 0:00:28
387000 -- (-483.334) [-482.798] (-482.262) (-483.609) * (-482.401) [-487.451] (-480.386) (-480.967) -- 0:00:30
387500 -- [-481.168] (-483.365) (-481.875) (-491.891) * (-486.811) [-482.152] (-485.216) (-481.074) -- 0:00:30
388000 -- [-481.967] (-483.255) (-489.391) (-487.194) * (-483.708) [-482.252] (-486.501) (-482.288) -- 0:00:29
388500 -- (-484.117) (-484.925) [-482.535] (-481.412) * (-482.104) [-481.623] (-482.823) (-486.857) -- 0:00:29
389000 -- (-485.319) [-484.852] (-484.410) (-484.101) * (-482.420) (-484.597) (-480.724) [-480.737] -- 0:00:29
389500 -- (-483.704) [-482.225] (-484.783) (-481.939) * (-481.304) (-488.551) (-481.098) [-486.949] -- 0:00:29
390000 -- (-484.655) [-482.008] (-482.904) (-487.696) * (-482.497) (-482.013) (-482.023) [-481.058] -- 0:00:29
Average standard deviation of split frequencies: 0.017698
390500 -- [-483.419] (-485.496) (-484.655) (-483.049) * [-481.384] (-481.224) (-486.348) (-481.837) -- 0:00:29
391000 -- [-482.839] (-483.810) (-481.784) (-481.839) * (-482.549) [-480.913] (-488.093) (-482.820) -- 0:00:29
391500 -- (-483.967) [-486.705] (-482.947) (-482.177) * [-481.991] (-483.357) (-482.930) (-484.924) -- 0:00:29
392000 -- (-484.526) (-480.859) [-482.619] (-482.069) * (-482.855) (-481.987) [-481.428] (-480.598) -- 0:00:29
392500 -- (-485.808) [-482.325] (-482.820) (-481.282) * (-484.013) (-482.651) [-480.693] (-482.456) -- 0:00:29
393000 -- (-484.220) (-483.297) (-482.040) [-482.519] * (-482.630) (-481.898) (-481.887) [-482.152] -- 0:00:29
393500 -- [-483.615] (-484.922) (-481.267) (-481.789) * (-481.409) [-483.254] (-483.921) (-487.721) -- 0:00:29
394000 -- [-483.984] (-481.651) (-482.397) (-482.284) * [-483.713] (-481.315) (-481.768) (-483.578) -- 0:00:29
394500 -- (-480.542) (-481.208) (-483.948) [-481.129] * (-482.447) (-481.100) (-481.486) [-484.107] -- 0:00:29
395000 -- (-481.842) (-486.475) (-482.914) [-486.431] * (-484.825) (-480.293) (-490.558) [-483.952] -- 0:00:29
Average standard deviation of split frequencies: 0.014285
395500 -- (-482.066) [-482.828] (-483.466) (-490.355) * (-481.940) [-482.421] (-484.899) (-485.084) -- 0:00:29
396000 -- (-483.777) (-483.721) (-481.855) [-485.703] * (-483.666) (-485.587) (-485.000) [-482.311] -- 0:00:28
396500 -- (-481.659) [-483.215] (-482.657) (-483.901) * (-483.996) (-484.288) [-483.088] (-481.276) -- 0:00:28
397000 -- [-480.721] (-482.534) (-483.431) (-483.341) * [-480.994] (-483.954) (-483.975) (-483.311) -- 0:00:28
397500 -- (-482.980) (-483.303) (-485.593) [-482.090] * (-483.352) [-482.094] (-484.771) (-484.219) -- 0:00:28
398000 -- (-485.263) (-481.971) (-482.429) [-483.489] * [-482.023] (-482.759) (-484.261) (-481.589) -- 0:00:28
398500 -- (-482.977) (-483.548) [-483.111] (-483.002) * [-482.923] (-482.012) (-481.906) (-485.215) -- 0:00:28
399000 -- [-481.804] (-487.066) (-481.079) (-485.068) * (-488.392) (-481.198) (-482.717) [-481.407] -- 0:00:28
399500 -- (-485.677) (-484.108) [-482.195] (-485.395) * [-483.752] (-485.017) (-481.308) (-481.284) -- 0:00:28
400000 -- (-487.080) [-481.563] (-480.584) (-484.552) * (-481.018) (-484.535) [-481.629] (-480.695) -- 0:00:28
Average standard deviation of split frequencies: 0.014119
400500 -- (-480.460) (-483.958) [-481.092] (-485.464) * (-480.726) (-483.225) (-480.356) [-480.904] -- 0:00:28
401000 -- [-481.213] (-482.803) (-483.073) (-482.619) * [-484.082] (-484.535) (-483.441) (-481.569) -- 0:00:28
401500 -- (-481.213) (-482.739) (-481.778) [-481.552] * [-483.741] (-482.923) (-482.776) (-481.996) -- 0:00:28
402000 -- (-487.197) (-484.542) (-481.698) [-483.837] * [-485.647] (-481.223) (-482.891) (-482.401) -- 0:00:28
402500 -- (-483.469) [-483.272] (-481.561) (-484.273) * (-482.160) (-486.353) [-480.581] (-482.903) -- 0:00:28
403000 -- (-480.747) (-483.176) [-482.278] (-481.531) * (-482.137) [-482.425] (-480.732) (-483.215) -- 0:00:28
403500 -- (-480.821) [-483.448] (-482.572) (-481.785) * [-482.483] (-481.391) (-482.641) (-484.378) -- 0:00:28
404000 -- (-480.635) (-482.694) (-481.566) [-482.672] * (-489.456) (-482.257) [-481.959] (-481.332) -- 0:00:28
404500 -- [-482.241] (-482.552) (-481.815) (-480.813) * (-485.775) (-484.223) (-481.805) [-483.947] -- 0:00:27
405000 -- (-484.513) (-482.855) [-484.673] (-482.082) * (-480.841) [-483.104] (-481.487) (-485.714) -- 0:00:27
Average standard deviation of split frequencies: 0.016255
405500 -- (-482.205) [-483.184] (-488.612) (-486.058) * (-481.927) (-482.828) [-480.536] (-482.702) -- 0:00:27
406000 -- [-482.007] (-482.269) (-482.604) (-481.608) * [-482.245] (-483.952) (-480.461) (-484.182) -- 0:00:27
406500 -- (-482.684) (-480.548) [-481.311] (-481.734) * (-481.307) (-481.201) [-481.820] (-483.775) -- 0:00:27
407000 -- (-481.134) (-481.329) [-482.298] (-485.426) * (-483.027) [-481.744] (-481.487) (-481.231) -- 0:00:27
407500 -- (-480.981) [-482.155] (-483.468) (-483.052) * (-493.179) (-485.919) (-481.460) [-484.722] -- 0:00:27
408000 -- [-481.194] (-483.761) (-491.349) (-481.732) * (-484.035) [-481.642] (-482.987) (-484.839) -- 0:00:27
408500 -- (-481.903) (-483.506) (-482.208) [-481.274] * (-480.789) (-484.974) [-481.266] (-481.896) -- 0:00:27
409000 -- [-483.459] (-481.696) (-483.201) (-484.183) * (-482.766) (-482.893) [-486.065] (-483.950) -- 0:00:28
409500 -- (-482.197) (-483.075) (-484.102) [-484.453] * (-481.428) (-481.472) [-481.835] (-485.219) -- 0:00:28
410000 -- (-484.216) (-483.380) [-485.436] (-483.201) * [-481.213] (-481.810) (-483.062) (-486.184) -- 0:00:28
Average standard deviation of split frequencies: 0.018366
410500 -- (-482.407) (-490.499) (-483.588) [-481.437] * [-487.207] (-485.682) (-484.821) (-484.251) -- 0:00:28
411000 -- (-482.012) (-483.019) [-482.637] (-483.671) * (-484.294) (-484.173) (-481.640) [-484.738] -- 0:00:28
411500 -- [-481.317] (-485.257) (-484.406) (-481.748) * (-482.608) [-483.105] (-482.082) (-483.144) -- 0:00:28
412000 -- [-481.277] (-483.759) (-481.384) (-481.085) * [-483.951] (-481.190) (-482.646) (-482.149) -- 0:00:28
412500 -- (-481.064) (-482.475) [-480.963] (-481.646) * [-480.425] (-486.621) (-487.759) (-481.798) -- 0:00:28
413000 -- (-483.015) (-482.269) [-483.403] (-482.355) * [-483.963] (-482.506) (-491.378) (-480.963) -- 0:00:28
413500 -- (-482.849) (-481.181) (-481.366) [-484.086] * (-481.624) (-486.268) [-483.126] (-484.295) -- 0:00:28
414000 -- (-481.421) [-482.573] (-481.575) (-483.021) * (-483.970) [-482.174] (-486.744) (-486.292) -- 0:00:28
414500 -- (-481.803) [-482.273] (-482.412) (-482.434) * (-483.489) (-481.582) (-481.536) [-483.069] -- 0:00:28
415000 -- (-484.185) (-483.013) (-489.301) [-489.318] * (-481.802) (-483.790) (-480.930) [-481.959] -- 0:00:28
Average standard deviation of split frequencies: 0.018886
415500 -- (-484.616) [-485.938] (-482.203) (-486.719) * [-480.695] (-484.935) (-481.348) (-480.531) -- 0:00:28
416000 -- (-481.647) (-481.624) (-482.061) [-481.973] * (-483.602) (-481.719) (-482.133) [-483.387] -- 0:00:28
416500 -- [-482.327] (-481.981) (-482.599) (-481.491) * (-483.942) [-484.422] (-481.059) (-486.298) -- 0:00:28
417000 -- (-481.844) [-480.929] (-486.882) (-484.762) * [-483.923] (-485.488) (-487.818) (-481.103) -- 0:00:27
417500 -- [-482.529] (-482.328) (-482.849) (-485.040) * (-481.628) (-481.127) [-483.124] (-481.633) -- 0:00:27
418000 -- (-481.391) [-481.730] (-484.291) (-483.362) * (-482.466) (-486.902) [-483.663] (-484.734) -- 0:00:27
418500 -- (-482.270) (-484.813) (-483.896) [-481.884] * (-481.859) (-488.947) [-483.777] (-484.011) -- 0:00:27
419000 -- (-486.307) [-480.795] (-481.818) (-481.330) * (-483.173) (-484.224) [-481.565] (-483.607) -- 0:00:27
419500 -- (-483.854) (-483.302) [-483.101] (-486.694) * (-483.264) (-481.567) [-482.427] (-484.706) -- 0:00:27
420000 -- (-481.396) (-484.118) (-487.183) [-481.649] * (-481.697) (-480.582) [-484.489] (-482.740) -- 0:00:27
Average standard deviation of split frequencies: 0.017930
420500 -- (-485.903) [-483.729] (-489.317) (-482.848) * (-482.539) (-481.329) (-484.059) [-481.628] -- 0:00:27
421000 -- [-483.219] (-483.598) (-481.559) (-482.817) * [-481.166] (-484.221) (-482.106) (-482.565) -- 0:00:27
421500 -- (-481.667) (-492.057) (-483.570) [-482.854] * (-484.465) (-481.828) (-483.926) [-481.959] -- 0:00:27
422000 -- (-482.437) (-480.471) (-484.144) [-480.873] * (-482.746) (-482.363) (-482.797) [-484.631] -- 0:00:27
422500 -- (-483.718) [-480.441] (-484.963) (-484.239) * (-482.020) (-486.133) [-486.583] (-481.798) -- 0:00:27
423000 -- (-484.242) (-485.094) [-481.907] (-482.706) * (-482.155) (-489.333) (-483.805) [-481.901] -- 0:00:27
423500 -- (-484.348) (-481.516) [-481.626] (-480.742) * (-483.274) (-481.618) [-481.533] (-483.940) -- 0:00:27
424000 -- [-483.224] (-485.553) (-482.465) (-481.680) * (-486.050) (-482.244) [-481.691] (-485.548) -- 0:00:27
424500 -- (-483.684) [-480.865] (-481.907) (-480.993) * (-486.434) [-485.112] (-482.637) (-486.828) -- 0:00:27
425000 -- (-481.776) [-484.248] (-482.975) (-485.388) * (-483.724) (-484.583) [-482.625] (-485.294) -- 0:00:27
Average standard deviation of split frequencies: 0.019919
425500 -- (-483.343) [-484.692] (-485.300) (-480.793) * (-481.548) (-480.695) [-482.379] (-483.117) -- 0:00:27
426000 -- (-482.049) (-481.972) (-484.741) [-481.973] * (-483.864) [-483.291] (-481.088) (-491.587) -- 0:00:26
426500 -- (-485.563) [-481.993] (-481.726) (-480.876) * [-484.609] (-483.455) (-481.953) (-486.145) -- 0:00:26
427000 -- (-485.292) (-486.289) [-481.679] (-482.107) * (-482.300) (-480.371) (-482.368) [-482.061] -- 0:00:26
427500 -- [-481.133] (-484.567) (-480.903) (-485.156) * [-481.426] (-486.413) (-482.329) (-482.758) -- 0:00:26
428000 -- (-484.180) (-480.923) (-483.371) [-482.935] * (-481.129) (-483.112) (-483.766) [-481.514] -- 0:00:26
428500 -- [-485.360] (-485.197) (-482.395) (-482.141) * [-481.261] (-483.747) (-483.055) (-484.361) -- 0:00:26
429000 -- (-482.592) (-481.596) [-485.415] (-484.757) * (-485.542) [-484.801] (-486.075) (-482.721) -- 0:00:26
429500 -- (-482.973) (-490.288) [-482.418] (-490.301) * (-482.518) (-485.754) [-483.684] (-484.298) -- 0:00:26
430000 -- (-481.466) (-486.208) (-483.027) [-483.912] * [-481.749] (-481.277) (-485.590) (-481.170) -- 0:00:27
Average standard deviation of split frequencies: 0.021162
430500 -- (-483.399) (-484.083) [-482.111] (-483.029) * (-482.454) (-483.285) [-482.343] (-480.670) -- 0:00:27
431000 -- (-482.957) [-485.336] (-481.633) (-481.682) * (-482.240) (-484.852) (-483.822) [-480.470] -- 0:00:27
431500 -- [-482.047] (-482.180) (-480.915) (-485.461) * (-482.624) (-484.169) (-481.827) [-481.327] -- 0:00:27
432000 -- (-482.031) (-482.055) [-482.262] (-482.497) * [-485.982] (-487.760) (-481.210) (-481.063) -- 0:00:27
432500 -- (-483.398) [-484.518] (-484.549) (-482.714) * (-483.586) (-482.498) [-483.663] (-483.424) -- 0:00:27
433000 -- (-481.165) [-482.842] (-482.075) (-482.077) * [-482.158] (-481.782) (-481.894) (-483.646) -- 0:00:27
433500 -- [-483.483] (-481.289) (-483.776) (-485.068) * [-482.065] (-482.109) (-483.612) (-481.182) -- 0:00:27
434000 -- (-482.353) (-480.635) [-484.883] (-482.477) * [-481.490] (-482.794) (-485.324) (-482.464) -- 0:00:27
434500 -- (-483.476) (-482.232) [-483.065] (-482.039) * [-480.823] (-482.901) (-484.152) (-482.577) -- 0:00:27
435000 -- (-485.219) (-482.358) (-481.983) [-481.120] * (-484.068) (-487.609) (-482.786) [-481.732] -- 0:00:27
Average standard deviation of split frequencies: 0.020903
435500 -- (-482.699) [-481.811] (-482.438) (-482.887) * (-480.595) (-481.982) [-481.331] (-482.467) -- 0:00:27
436000 -- (-484.515) (-480.632) (-481.515) [-484.071] * [-480.762] (-483.766) (-481.131) (-483.944) -- 0:00:27
436500 -- (-483.466) [-481.607] (-483.240) (-483.067) * [-483.719] (-484.961) (-482.116) (-486.451) -- 0:00:27
437000 -- (-486.094) (-485.649) [-481.688] (-486.791) * (-481.148) (-481.506) [-484.715] (-482.815) -- 0:00:27
437500 -- (-481.930) [-482.319] (-482.577) (-481.026) * (-487.688) (-481.684) [-482.586] (-481.608) -- 0:00:27
438000 -- (-482.560) (-486.105) [-484.354] (-481.843) * (-481.219) (-485.172) [-481.891] (-483.417) -- 0:00:26
438500 -- (-482.231) [-484.570] (-481.269) (-484.848) * (-486.126) (-483.531) [-481.564] (-484.974) -- 0:00:26
439000 -- (-482.208) (-483.344) [-484.023] (-481.456) * [-481.642] (-484.380) (-484.871) (-485.722) -- 0:00:26
439500 -- (-484.028) (-481.098) (-483.440) [-483.523] * [-483.063] (-486.713) (-482.580) (-480.810) -- 0:00:26
440000 -- (-481.861) (-482.763) (-481.427) [-482.174] * [-481.316] (-485.736) (-483.061) (-483.589) -- 0:00:26
Average standard deviation of split frequencies: 0.019969
440500 -- (-482.510) (-480.735) [-486.150] (-481.781) * (-483.437) [-481.260] (-481.099) (-482.886) -- 0:00:26
441000 -- (-487.512) (-485.375) [-483.474] (-481.308) * [-481.517] (-486.164) (-482.224) (-481.391) -- 0:00:26
441500 -- [-485.429] (-485.533) (-481.867) (-483.999) * (-485.050) [-481.858] (-482.198) (-482.970) -- 0:00:26
442000 -- [-482.256] (-481.536) (-483.639) (-485.149) * (-482.103) (-491.201) [-483.073] (-484.475) -- 0:00:26
442500 -- (-480.964) [-481.792] (-481.673) (-484.466) * (-482.826) (-481.993) [-483.622] (-483.880) -- 0:00:26
443000 -- (-481.735) [-482.854] (-483.184) (-482.532) * (-481.950) (-480.631) (-483.768) [-480.963] -- 0:00:26
443500 -- (-484.154) (-484.486) [-480.764] (-481.126) * [-481.816] (-481.148) (-483.099) (-483.396) -- 0:00:26
444000 -- [-486.437] (-488.877) (-484.823) (-481.680) * (-482.024) [-480.619] (-482.438) (-485.608) -- 0:00:26
444500 -- [-481.340] (-488.970) (-482.363) (-482.312) * (-483.716) (-484.841) [-482.966] (-481.458) -- 0:00:26
445000 -- [-482.373] (-482.234) (-491.844) (-483.176) * (-484.506) [-483.817] (-486.349) (-484.983) -- 0:00:26
Average standard deviation of split frequencies: 0.020435
445500 -- [-482.321] (-483.172) (-486.889) (-483.285) * (-482.470) (-485.662) [-482.088] (-488.256) -- 0:00:26
446000 -- (-482.508) (-482.152) (-484.655) [-481.040] * (-484.389) [-484.835] (-481.963) (-488.240) -- 0:00:26
446500 -- [-482.748] (-487.072) (-484.211) (-482.861) * [-483.360] (-484.781) (-481.717) (-485.167) -- 0:00:26
447000 -- (-484.423) (-484.692) [-482.369] (-482.299) * (-483.125) (-482.145) [-485.695] (-484.938) -- 0:00:25
447500 -- (-481.966) [-483.886] (-483.067) (-481.497) * (-486.995) (-482.373) (-485.167) [-480.535] -- 0:00:25
448000 -- (-482.450) (-481.513) (-482.055) [-484.755] * (-481.461) (-480.399) (-484.018) [-483.015] -- 0:00:25
448500 -- [-482.673] (-482.167) (-482.838) (-482.925) * (-484.165) [-480.939] (-485.849) (-482.870) -- 0:00:25
449000 -- (-490.906) (-490.863) [-488.106] (-480.864) * (-482.770) (-480.900) [-484.245] (-484.053) -- 0:00:25
449500 -- (-484.080) (-493.560) (-480.615) [-480.519] * (-483.921) [-481.293] (-481.954) (-482.508) -- 0:00:25
450000 -- (-482.289) (-484.577) [-480.413] (-482.476) * (-483.888) [-482.876] (-483.616) (-483.150) -- 0:00:25
Average standard deviation of split frequencies: 0.018828
450500 -- (-484.920) (-482.848) [-481.097] (-481.941) * (-483.143) (-482.626) (-483.264) [-483.963] -- 0:00:25
451000 -- (-485.477) (-485.785) [-480.534] (-481.739) * [-486.149] (-486.713) (-485.704) (-485.903) -- 0:00:25
451500 -- [-481.061] (-482.308) (-482.010) (-482.448) * (-480.593) (-483.236) (-481.441) [-482.875] -- 0:00:25
452000 -- [-480.844] (-482.891) (-485.281) (-483.664) * (-482.409) (-483.088) (-480.703) [-483.423] -- 0:00:26
452500 -- [-483.482] (-485.006) (-482.003) (-482.590) * (-481.122) [-481.615] (-482.202) (-481.108) -- 0:00:26
453000 -- (-481.075) [-481.863] (-483.562) (-480.900) * (-484.156) (-483.375) [-485.472] (-483.747) -- 0:00:26
453500 -- [-482.664] (-481.384) (-481.980) (-481.353) * (-481.283) (-481.065) (-485.174) [-481.634] -- 0:00:26
454000 -- [-482.928] (-485.761) (-483.910) (-485.278) * (-482.616) [-482.696] (-489.342) (-481.645) -- 0:00:26
454500 -- (-481.490) [-482.767] (-481.886) (-481.723) * (-486.320) [-481.384] (-480.872) (-486.481) -- 0:00:26
455000 -- (-481.223) (-482.163) (-482.652) [-481.310] * [-483.674] (-482.014) (-482.133) (-482.634) -- 0:00:26
Average standard deviation of split frequencies: 0.016541
455500 -- (-483.058) [-481.082] (-483.864) (-482.308) * (-481.844) (-484.038) [-483.536] (-484.066) -- 0:00:26
456000 -- (-481.407) (-482.383) [-480.889] (-485.505) * [-481.526] (-481.041) (-485.583) (-483.446) -- 0:00:26
456500 -- (-481.873) [-481.710] (-484.668) (-486.801) * (-483.672) (-485.775) [-480.703] (-484.215) -- 0:00:26
457000 -- (-483.783) (-484.660) (-487.048) [-481.338] * (-485.053) [-482.808] (-484.042) (-483.458) -- 0:00:26
457500 -- (-483.000) (-485.767) [-485.463] (-482.095) * [-486.797] (-482.909) (-484.965) (-484.101) -- 0:00:26
458000 -- (-481.224) (-480.311) [-486.635] (-481.172) * [-484.185] (-480.868) (-483.758) (-482.226) -- 0:00:26
458500 -- (-482.150) (-484.976) [-483.054] (-481.733) * (-481.662) [-481.692] (-481.831) (-482.431) -- 0:00:25
459000 -- [-481.998] (-482.100) (-481.785) (-481.739) * (-482.403) (-480.744) [-481.274] (-485.721) -- 0:00:25
459500 -- (-482.676) (-483.837) (-483.000) [-485.858] * (-484.132) [-482.618] (-482.641) (-487.351) -- 0:00:25
460000 -- (-480.508) [-484.697] (-482.620) (-482.939) * (-483.962) (-482.475) [-482.221] (-482.473) -- 0:00:25
Average standard deviation of split frequencies: 0.014326
460500 -- (-481.612) (-484.750) [-480.551] (-482.377) * [-481.422] (-480.922) (-483.962) (-482.855) -- 0:00:25
461000 -- (-482.508) (-484.154) (-481.448) [-481.862] * [-482.352] (-483.981) (-483.208) (-485.868) -- 0:00:25
461500 -- (-485.261) [-481.579] (-482.898) (-483.096) * (-482.760) (-482.915) [-484.154] (-484.704) -- 0:00:25
462000 -- [-482.593] (-482.896) (-482.750) (-482.866) * [-482.405] (-482.879) (-480.768) (-481.905) -- 0:00:25
462500 -- (-485.928) [-481.177] (-483.497) (-486.133) * (-482.735) (-481.794) (-481.324) [-481.880] -- 0:00:25
463000 -- (-484.682) [-481.308] (-481.182) (-482.135) * (-486.445) (-482.979) (-487.356) [-480.667] -- 0:00:25
463500 -- [-486.629] (-481.639) (-485.380) (-483.496) * (-486.467) (-484.042) [-481.102] (-480.844) -- 0:00:25
464000 -- (-481.595) [-484.434] (-484.670) (-481.698) * (-482.103) (-482.500) [-484.330] (-481.869) -- 0:00:25
464500 -- (-481.885) (-480.968) (-484.165) [-482.637] * (-482.060) [-482.328] (-483.663) (-487.883) -- 0:00:25
465000 -- (-482.188) (-482.521) [-486.046] (-481.515) * [-482.137] (-483.631) (-486.968) (-482.061) -- 0:00:25
Average standard deviation of split frequencies: 0.013488
465500 -- [-483.174] (-484.320) (-483.258) (-485.478) * [-481.732] (-484.418) (-481.045) (-484.958) -- 0:00:25
466000 -- (-483.475) [-483.134] (-485.731) (-481.396) * [-486.342] (-481.987) (-483.090) (-481.905) -- 0:00:25
466500 -- [-481.159] (-485.080) (-484.450) (-481.039) * [-480.536] (-480.821) (-481.510) (-481.632) -- 0:00:25
467000 -- (-481.156) (-481.569) [-482.309] (-485.596) * (-482.721) [-480.317] (-482.165) (-481.015) -- 0:00:25
467500 -- (-486.388) [-481.507] (-486.452) (-483.088) * (-483.480) (-481.292) (-483.351) [-484.586] -- 0:00:25
468000 -- (-489.144) (-480.642) [-482.887] (-481.499) * [-481.772] (-481.666) (-481.479) (-481.270) -- 0:00:25
468500 -- [-481.613] (-480.686) (-489.350) (-490.003) * (-481.371) (-481.676) [-482.332] (-482.010) -- 0:00:24
469000 -- (-481.451) (-481.720) [-483.255] (-482.219) * (-484.534) (-482.557) [-484.042] (-481.971) -- 0:00:24
469500 -- (-482.437) (-481.778) [-482.277] (-482.054) * (-488.758) (-482.978) [-482.065] (-481.634) -- 0:00:24
470000 -- (-482.254) (-483.928) [-483.763] (-482.903) * (-482.248) (-486.110) [-483.969] (-480.929) -- 0:00:24
Average standard deviation of split frequencies: 0.011351
470500 -- (-481.505) (-483.474) [-480.864] (-482.259) * (-481.429) (-488.531) [-484.917] (-487.627) -- 0:00:24
471000 -- [-484.457] (-482.704) (-483.683) (-480.470) * (-483.102) (-484.675) (-485.047) [-481.706] -- 0:00:24
471500 -- (-481.139) (-481.131) (-484.623) [-482.989] * (-486.484) (-481.573) [-482.512] (-482.008) -- 0:00:24
472000 -- (-481.161) (-483.464) [-485.890] (-483.052) * (-481.342) (-481.809) (-482.886) [-482.332] -- 0:00:24
472500 -- [-481.791] (-486.603) (-485.669) (-481.687) * [-481.925] (-481.463) (-484.143) (-481.625) -- 0:00:24
473000 -- (-483.094) [-482.225] (-482.148) (-482.236) * (-481.974) [-481.940] (-482.997) (-484.462) -- 0:00:24
473500 -- (-483.596) [-481.365] (-481.183) (-482.691) * (-483.342) [-480.678] (-488.229) (-480.674) -- 0:00:24
474000 -- [-480.722] (-482.066) (-482.553) (-483.452) * (-483.331) [-484.247] (-486.752) (-482.199) -- 0:00:25
474500 -- (-480.885) (-482.992) [-482.699] (-482.217) * (-481.199) [-482.621] (-480.847) (-483.917) -- 0:00:25
475000 -- (-482.648) (-482.533) [-488.013] (-482.881) * [-480.772] (-480.719) (-481.009) (-483.298) -- 0:00:25
Average standard deviation of split frequencies: 0.011224
475500 -- (-484.377) [-481.698] (-487.596) (-483.436) * (-483.488) [-482.876] (-481.900) (-483.463) -- 0:00:25
476000 -- (-486.080) [-481.094] (-489.547) (-483.015) * [-485.184] (-481.840) (-482.903) (-488.514) -- 0:00:25
476500 -- (-484.298) (-488.049) (-482.723) [-483.012] * (-484.434) (-485.378) [-482.213] (-489.968) -- 0:00:25
477000 -- (-482.255) (-480.918) [-482.844] (-483.060) * (-482.235) (-481.439) [-481.266] (-481.636) -- 0:00:25
477500 -- (-482.365) (-485.160) (-483.539) [-482.261] * [-484.481] (-480.675) (-485.302) (-480.691) -- 0:00:25
478000 -- (-482.368) [-481.286] (-483.906) (-481.776) * (-481.053) [-486.347] (-482.810) (-481.681) -- 0:00:25
478500 -- (-481.887) [-481.965] (-482.271) (-482.113) * [-482.704] (-481.862) (-482.720) (-483.340) -- 0:00:25
479000 -- [-482.088] (-480.674) (-481.441) (-483.809) * [-482.261] (-484.810) (-481.629) (-482.935) -- 0:00:25
479500 -- (-483.058) (-481.699) (-481.026) [-483.389] * (-483.109) (-482.495) (-483.265) [-481.558] -- 0:00:24
480000 -- (-485.021) (-483.598) [-484.059] (-482.463) * (-485.938) [-482.269] (-484.021) (-481.575) -- 0:00:24
Average standard deviation of split frequencies: 0.009807
480500 -- (-481.831) (-482.962) (-481.794) [-483.034] * (-483.676) [-483.178] (-484.129) (-483.968) -- 0:00:24
481000 -- [-481.414] (-490.181) (-481.625) (-481.194) * (-485.847) (-484.016) (-481.013) [-481.888] -- 0:00:24
481500 -- (-483.864) [-481.074] (-483.188) (-481.474) * (-482.081) (-481.496) (-483.182) [-485.144] -- 0:00:24
482000 -- (-483.631) (-481.452) (-481.001) [-484.445] * (-482.866) (-484.359) [-482.211] (-485.967) -- 0:00:24
482500 -- [-483.578] (-480.753) (-480.379) (-480.721) * (-481.339) (-485.882) [-481.861] (-481.785) -- 0:00:24
483000 -- [-482.790] (-485.852) (-482.561) (-483.740) * (-481.795) [-484.457] (-483.197) (-483.058) -- 0:00:24
483500 -- (-483.342) [-483.407] (-483.949) (-484.636) * [-481.418] (-486.699) (-482.546) (-481.939) -- 0:00:24
484000 -- [-481.335] (-480.779) (-484.747) (-485.350) * [-481.106] (-485.629) (-481.067) (-483.581) -- 0:00:24
484500 -- [-482.620] (-482.173) (-482.660) (-484.266) * (-481.178) [-485.133] (-484.038) (-481.780) -- 0:00:24
485000 -- [-482.634] (-481.854) (-482.160) (-481.818) * (-482.967) [-482.109] (-480.615) (-483.603) -- 0:00:24
Average standard deviation of split frequencies: 0.010346
485500 -- (-482.103) (-482.059) (-482.760) [-483.657] * (-482.379) (-486.963) (-482.475) [-480.883] -- 0:00:24
486000 -- (-486.203) [-480.659] (-483.341) (-483.398) * [-482.378] (-485.917) (-482.791) (-481.521) -- 0:00:24
486500 -- (-483.233) [-480.881] (-483.444) (-483.082) * [-482.692] (-489.689) (-482.066) (-481.502) -- 0:00:24
487000 -- (-484.518) (-481.539) (-481.785) [-482.016] * (-482.358) (-482.717) (-483.225) [-482.287] -- 0:00:24
487500 -- (-484.160) (-485.989) [-482.532] (-482.083) * [-482.564] (-484.836) (-484.297) (-486.427) -- 0:00:24
488000 -- (-484.457) (-482.180) [-481.865] (-481.523) * (-488.453) [-481.615] (-483.486) (-482.648) -- 0:00:24
488500 -- (-481.460) (-483.403) (-485.152) [-481.731] * (-490.460) [-484.562] (-483.400) (-483.460) -- 0:00:24
489000 -- [-482.908] (-484.513) (-483.006) (-483.563) * (-481.844) (-480.979) [-482.080] (-484.269) -- 0:00:24
489500 -- [-483.515] (-486.464) (-481.677) (-488.299) * [-483.878] (-484.624) (-482.465) (-486.509) -- 0:00:23
490000 -- (-481.111) (-481.787) [-480.922] (-488.909) * [-485.224] (-481.297) (-481.959) (-482.835) -- 0:00:23
Average standard deviation of split frequencies: 0.008967
490500 -- (-482.413) (-480.993) (-482.881) [-485.406] * [-483.470] (-481.332) (-482.366) (-484.670) -- 0:00:23
491000 -- [-483.363] (-483.134) (-483.181) (-485.987) * (-482.970) (-484.811) [-482.485] (-483.740) -- 0:00:23
491500 -- [-481.922] (-484.508) (-484.303) (-481.084) * (-483.570) [-484.010] (-482.872) (-480.995) -- 0:00:23
492000 -- (-484.543) (-481.788) (-480.933) [-482.860] * (-482.563) (-482.619) [-481.241] (-484.520) -- 0:00:23
492500 -- (-481.674) (-486.747) (-482.418) [-481.080] * (-480.558) [-484.422] (-480.968) (-481.961) -- 0:00:23
493000 -- (-480.792) (-486.067) (-480.732) [-482.218] * (-482.335) [-482.076] (-481.977) (-481.253) -- 0:00:23
493500 -- (-482.411) (-481.583) (-481.206) [-482.030] * [-482.310] (-486.886) (-483.698) (-481.564) -- 0:00:23
494000 -- (-481.456) [-480.704] (-487.260) (-482.570) * (-483.613) [-482.510] (-482.947) (-484.181) -- 0:00:23
494500 -- (-483.958) (-480.808) (-480.900) [-480.981] * (-480.675) [-484.046] (-481.430) (-481.105) -- 0:00:23
495000 -- (-482.155) (-481.752) (-482.728) [-480.765] * (-481.119) (-488.041) (-483.470) [-480.388] -- 0:00:23
Average standard deviation of split frequencies: 0.008871
495500 -- (-486.279) (-482.182) (-482.497) [-480.675] * [-482.451] (-484.053) (-481.989) (-484.032) -- 0:00:23
496000 -- [-484.355] (-481.638) (-481.689) (-482.100) * (-487.286) (-490.132) (-483.405) [-483.315] -- 0:00:24
496500 -- [-484.453] (-480.906) (-484.773) (-485.793) * [-483.407] (-483.149) (-481.366) (-481.232) -- 0:00:24
497000 -- [-481.705] (-483.727) (-482.209) (-481.147) * [-481.983] (-481.968) (-483.932) (-481.283) -- 0:00:24
497500 -- [-483.078] (-482.765) (-485.040) (-482.090) * (-481.526) [-481.055] (-481.488) (-482.408) -- 0:00:24
498000 -- [-483.272] (-484.470) (-484.654) (-482.284) * (-482.374) (-481.626) (-480.627) [-481.446] -- 0:00:24
498500 -- (-484.837) (-481.982) [-481.123] (-481.316) * (-485.427) (-482.835) [-485.240] (-481.266) -- 0:00:24
499000 -- (-484.707) [-483.714] (-481.796) (-480.777) * [-482.454] (-483.064) (-483.966) (-483.565) -- 0:00:24
499500 -- (-483.495) (-483.835) [-480.672] (-483.669) * (-481.587) [-481.479] (-481.623) (-482.436) -- 0:00:24
500000 -- (-482.980) (-482.438) (-484.534) [-481.024] * [-481.662] (-482.419) (-483.231) (-485.123) -- 0:00:24
Average standard deviation of split frequencies: 0.006905
500500 -- (-482.847) (-484.539) (-481.844) [-481.255] * (-480.938) [-483.586] (-486.537) (-485.599) -- 0:00:23
501000 -- [-481.354] (-483.896) (-483.006) (-484.014) * [-482.700] (-481.078) (-487.837) (-484.690) -- 0:00:23
501500 -- (-483.451) (-480.560) (-482.780) [-482.955] * (-485.399) [-482.324] (-484.317) (-485.164) -- 0:00:23
502000 -- [-483.601] (-480.417) (-482.895) (-483.601) * (-483.447) (-481.729) [-481.468] (-482.968) -- 0:00:23
502500 -- (-481.024) [-481.614] (-482.441) (-485.460) * (-482.460) [-480.688] (-481.240) (-482.534) -- 0:00:23
503000 -- (-483.584) (-484.212) (-483.631) [-484.364] * (-483.233) (-482.556) [-483.481] (-482.585) -- 0:00:23
503500 -- (-484.150) [-482.122] (-484.495) (-481.253) * [-481.096] (-482.857) (-484.954) (-483.962) -- 0:00:23
504000 -- (-485.880) (-488.032) [-486.998] (-484.834) * (-482.321) [-481.922] (-483.431) (-484.759) -- 0:00:23
504500 -- (-484.599) [-485.418] (-481.211) (-484.317) * [-481.416] (-483.332) (-483.510) (-482.165) -- 0:00:23
505000 -- (-481.083) [-481.718] (-481.524) (-480.770) * [-481.037] (-485.112) (-485.450) (-484.178) -- 0:00:23
Average standard deviation of split frequencies: 0.010558
505500 -- (-480.912) (-481.857) (-481.882) [-486.078] * (-483.719) (-484.365) [-483.102] (-483.773) -- 0:00:23
506000 -- (-481.488) (-482.546) [-482.630] (-484.413) * [-484.327] (-486.414) (-483.445) (-481.414) -- 0:00:23
506500 -- (-483.324) (-482.409) [-485.780] (-482.856) * (-485.142) [-482.683] (-480.345) (-481.139) -- 0:00:23
507000 -- (-481.518) [-482.825] (-483.135) (-483.365) * (-486.849) [-483.140] (-482.612) (-483.596) -- 0:00:23
507500 -- (-482.885) (-483.557) [-481.285] (-485.121) * [-487.711] (-482.458) (-483.651) (-483.364) -- 0:00:23
508000 -- (-481.630) [-482.757] (-482.560) (-481.611) * (-487.846) [-481.043] (-484.819) (-482.593) -- 0:00:23
508500 -- [-481.132] (-480.588) (-485.714) (-482.554) * (-482.212) (-481.245) (-482.755) [-484.717] -- 0:00:23
509000 -- [-483.588] (-481.770) (-484.354) (-482.364) * (-483.279) (-481.792) (-483.438) [-481.861] -- 0:00:23
509500 -- [-480.998] (-482.834) (-484.730) (-486.561) * [-483.939] (-488.801) (-483.428) (-483.375) -- 0:00:23
510000 -- (-480.897) [-480.586] (-482.264) (-484.944) * (-482.711) (-483.164) [-480.757] (-483.817) -- 0:00:23
Average standard deviation of split frequencies: 0.011693
510500 -- [-482.592] (-482.302) (-482.048) (-484.062) * (-481.592) [-483.121] (-485.211) (-482.663) -- 0:00:23
511000 -- (-484.225) [-481.366] (-482.076) (-484.445) * (-482.372) (-484.766) (-482.811) [-482.756] -- 0:00:22
511500 -- [-483.234] (-482.124) (-482.336) (-481.569) * (-483.084) [-483.467] (-485.051) (-483.421) -- 0:00:22
512000 -- (-484.707) (-483.600) (-481.339) [-481.875] * [-482.779] (-484.752) (-482.632) (-482.577) -- 0:00:22
512500 -- (-484.752) (-485.218) (-482.282) [-481.728] * (-484.225) (-483.101) [-483.518] (-482.231) -- 0:00:22
513000 -- [-481.330] (-483.444) (-482.626) (-480.868) * (-482.590) (-482.526) [-485.043] (-482.894) -- 0:00:22
513500 -- (-483.900) [-480.544] (-482.777) (-481.577) * (-482.607) [-483.521] (-484.593) (-482.025) -- 0:00:22
514000 -- [-482.769] (-482.390) (-481.632) (-482.548) * (-480.840) [-482.242] (-482.432) (-485.141) -- 0:00:22
514500 -- [-482.798] (-484.367) (-483.128) (-482.097) * (-483.472) (-480.562) [-481.357] (-486.606) -- 0:00:22
515000 -- (-482.355) (-481.392) (-482.829) [-483.690] * (-482.784) [-482.257] (-483.940) (-481.008) -- 0:00:22
Average standard deviation of split frequencies: 0.012790
515500 -- (-482.183) (-482.158) (-481.970) [-485.258] * (-484.918) (-482.958) [-481.623] (-483.339) -- 0:00:22
516000 -- (-483.902) (-483.730) [-485.381] (-482.788) * (-485.496) [-480.980] (-481.515) (-482.232) -- 0:00:22
516500 -- (-484.612) [-481.276] (-485.890) (-483.331) * (-482.056) (-484.765) (-480.583) [-481.729] -- 0:00:22
517000 -- (-482.298) [-484.985] (-481.954) (-482.514) * (-481.428) (-480.950) (-481.069) [-481.910] -- 0:00:22
517500 -- (-480.541) [-482.231] (-485.495) (-490.129) * [-481.528] (-483.516) (-482.820) (-484.097) -- 0:00:22
518000 -- (-482.724) [-485.622] (-482.483) (-484.339) * (-481.182) (-482.274) (-482.032) [-480.693] -- 0:00:23
518500 -- (-482.342) [-482.922] (-485.301) (-486.487) * (-481.491) (-483.567) (-482.186) [-481.721] -- 0:00:23
519000 -- [-482.455] (-481.891) (-483.128) (-483.882) * [-483.240] (-482.663) (-482.013) (-482.019) -- 0:00:23
519500 -- (-483.857) [-483.688] (-483.193) (-480.854) * [-482.156] (-481.577) (-484.388) (-481.623) -- 0:00:23
520000 -- (-481.418) (-482.607) (-487.360) [-482.484] * (-482.277) (-482.474) [-481.503] (-485.415) -- 0:00:23
Average standard deviation of split frequencies: 0.010865
520500 -- [-480.961] (-481.825) (-482.433) (-482.562) * (-483.265) (-482.505) [-481.919] (-485.076) -- 0:00:23
521000 -- (-484.089) (-483.957) [-483.650] (-482.855) * (-482.131) (-481.079) [-481.046] (-482.930) -- 0:00:22
521500 -- (-481.566) [-482.626] (-485.943) (-482.199) * (-481.444) (-483.825) [-484.643] (-484.847) -- 0:00:22
522000 -- (-485.963) (-483.001) (-482.657) [-481.640] * (-482.681) (-481.569) [-487.666] (-482.421) -- 0:00:22
522500 -- (-481.984) (-480.982) [-481.601] (-482.633) * [-482.369] (-483.717) (-483.348) (-484.259) -- 0:00:22
523000 -- [-480.760] (-483.381) (-485.338) (-482.722) * (-486.794) [-483.094] (-481.466) (-481.559) -- 0:00:22
523500 -- (-483.504) (-481.640) [-484.802] (-483.537) * (-489.697) (-484.663) [-481.768] (-482.550) -- 0:00:22
524000 -- (-482.844) (-484.592) [-481.486] (-481.387) * (-481.424) (-485.206) [-481.696] (-482.451) -- 0:00:22
524500 -- (-480.691) (-482.581) (-485.439) [-482.577] * (-482.404) (-483.078) [-481.934] (-482.037) -- 0:00:22
525000 -- (-481.650) [-482.172] (-483.190) (-481.424) * (-481.338) (-483.518) [-481.821] (-483.563) -- 0:00:22
Average standard deviation of split frequencies: 0.011352
525500 -- (-486.438) (-480.783) (-483.323) [-482.054] * (-484.698) (-482.105) [-486.099] (-489.781) -- 0:00:22
526000 -- (-483.363) (-487.002) (-483.792) [-481.714] * (-482.566) (-483.824) (-482.227) [-480.591] -- 0:00:22
526500 -- (-482.968) (-485.088) [-482.899] (-481.402) * (-483.805) [-485.747] (-480.920) (-481.856) -- 0:00:22
527000 -- (-484.401) (-488.327) [-481.626] (-483.242) * (-480.860) [-482.736] (-480.815) (-486.598) -- 0:00:22
527500 -- (-482.777) (-490.737) (-481.020) [-481.043] * [-482.921] (-481.594) (-484.159) (-482.304) -- 0:00:22
528000 -- (-484.589) [-482.065] (-480.628) (-484.927) * [-482.126] (-482.416) (-484.844) (-484.024) -- 0:00:22
528500 -- (-485.067) (-482.715) (-480.588) [-482.502] * (-489.369) [-484.052] (-484.693) (-483.865) -- 0:00:22
529000 -- [-486.196] (-481.542) (-483.005) (-482.665) * (-484.875) [-484.517] (-484.950) (-485.184) -- 0:00:22
529500 -- (-482.988) [-484.822] (-481.545) (-483.051) * (-483.523) [-481.235] (-480.690) (-486.380) -- 0:00:22
530000 -- [-483.316] (-483.215) (-481.717) (-481.948) * (-484.092) [-482.837] (-483.216) (-481.451) -- 0:00:22
Average standard deviation of split frequencies: 0.011252
530500 -- [-481.396] (-484.789) (-485.380) (-483.513) * (-484.605) (-481.588) (-481.391) [-483.768] -- 0:00:22
531000 -- [-484.730] (-481.268) (-480.941) (-482.810) * (-480.894) [-483.096] (-480.993) (-483.762) -- 0:00:22
531500 -- (-483.924) (-483.212) (-484.392) [-480.708] * (-484.124) (-484.239) [-482.974] (-483.738) -- 0:00:22
532000 -- (-483.306) (-481.284) (-481.483) [-482.351] * (-480.554) (-488.393) (-481.982) [-481.944] -- 0:00:21
532500 -- (-482.841) (-488.634) (-483.526) [-483.123] * (-484.540) [-482.672] (-487.764) (-482.207) -- 0:00:21
533000 -- (-481.367) [-483.069] (-481.989) (-482.350) * (-481.801) (-481.340) (-481.203) [-483.030] -- 0:00:21
533500 -- (-481.794) (-483.017) (-483.122) [-483.193] * (-480.569) [-481.995] (-482.694) (-485.752) -- 0:00:21
534000 -- (-484.565) (-482.175) (-481.678) [-480.895] * [-482.202] (-481.538) (-482.480) (-483.435) -- 0:00:21
534500 -- (-484.000) (-483.896) [-483.992] (-482.483) * (-484.083) [-481.168] (-482.303) (-482.978) -- 0:00:21
535000 -- (-482.670) [-481.905] (-483.266) (-481.628) * [-480.830] (-485.022) (-484.278) (-485.053) -- 0:00:21
Average standard deviation of split frequencies: 0.011140
535500 -- (-483.349) (-481.965) [-481.657] (-481.885) * (-483.351) (-481.571) [-487.366] (-483.502) -- 0:00:21
536000 -- (-483.286) (-482.942) [-481.802] (-486.476) * (-481.431) (-481.708) [-482.072] (-484.625) -- 0:00:21
536500 -- (-486.957) (-484.058) [-481.145] (-482.857) * (-483.360) (-485.511) [-482.765] (-482.330) -- 0:00:21
537000 -- (-480.488) [-481.844] (-480.977) (-484.052) * (-482.846) (-483.362) (-482.832) [-482.024] -- 0:00:21
537500 -- (-485.038) (-484.825) (-483.175) [-484.089] * (-480.835) [-486.307] (-484.578) (-480.432) -- 0:00:21
538000 -- (-483.505) (-483.546) (-484.265) [-481.973] * (-482.770) (-483.365) (-484.574) [-485.300] -- 0:00:21
538500 -- (-485.882) (-482.136) (-483.141) [-481.510] * [-483.565] (-486.279) (-481.252) (-486.706) -- 0:00:21
539000 -- (-484.142) (-484.584) (-481.163) [-484.244] * [-482.321] (-483.252) (-483.309) (-483.809) -- 0:00:21
539500 -- (-484.829) (-482.654) (-482.379) [-482.774] * [-483.000] (-481.603) (-481.760) (-483.346) -- 0:00:21
540000 -- (-485.033) (-485.535) [-481.868] (-484.079) * [-481.793] (-482.283) (-481.169) (-488.889) -- 0:00:21
Average standard deviation of split frequencies: 0.009881
540500 -- [-483.024] (-486.354) (-482.926) (-483.752) * (-486.568) (-481.235) (-480.343) [-481.976] -- 0:00:22
541000 -- (-482.591) (-483.611) (-481.321) [-483.290] * (-484.109) [-482.496] (-480.836) (-483.049) -- 0:00:22
541500 -- (-483.403) (-484.119) [-486.620] (-484.247) * (-485.359) (-485.181) (-483.716) [-481.956] -- 0:00:22
542000 -- [-484.000] (-481.922) (-481.015) (-482.742) * (-482.856) (-480.944) (-482.723) [-485.951] -- 0:00:21
542500 -- (-483.172) [-484.475] (-487.757) (-483.822) * (-483.910) (-480.629) [-482.213] (-481.779) -- 0:00:21
543000 -- (-483.349) [-482.628] (-485.881) (-482.207) * (-484.692) (-485.340) [-482.460] (-484.935) -- 0:00:21
543500 -- (-483.576) (-482.772) [-481.072] (-485.919) * [-481.763] (-480.618) (-481.436) (-488.781) -- 0:00:21
544000 -- [-482.075] (-481.113) (-484.998) (-482.036) * (-481.858) [-482.614] (-482.876) (-483.978) -- 0:00:21
544500 -- (-481.207) (-482.615) (-483.090) [-482.886] * (-482.266) [-480.310] (-482.155) (-483.698) -- 0:00:21
545000 -- [-480.919] (-483.263) (-482.197) (-482.017) * (-482.666) (-487.730) [-481.823] (-484.978) -- 0:00:21
Average standard deviation of split frequencies: 0.009785
545500 -- (-486.883) [-480.616] (-481.646) (-481.675) * (-483.111) (-484.405) (-484.620) [-484.521] -- 0:00:21
546000 -- (-484.517) [-481.023] (-480.923) (-483.669) * (-481.795) (-485.071) [-483.140] (-481.535) -- 0:00:21
546500 -- (-482.619) (-481.824) (-481.156) [-488.316] * (-481.371) [-484.720] (-481.763) (-481.374) -- 0:00:21
547000 -- (-483.686) (-481.749) [-481.843] (-486.660) * (-480.863) (-483.969) (-481.464) [-481.917] -- 0:00:21
547500 -- (-485.363) [-481.932] (-482.669) (-481.288) * (-483.690) (-482.287) (-482.694) [-486.551] -- 0:00:21
548000 -- (-481.138) (-481.667) [-483.116] (-481.690) * (-482.411) [-481.069] (-484.094) (-487.950) -- 0:00:21
548500 -- (-481.085) (-481.974) [-483.272] (-486.867) * (-481.938) (-481.355) [-482.421] (-484.950) -- 0:00:21
549000 -- (-482.268) (-482.207) (-480.753) [-481.652] * [-481.849] (-482.480) (-482.019) (-481.775) -- 0:00:21
549500 -- [-480.851] (-482.279) (-481.919) (-482.523) * (-481.068) (-484.185) [-480.418] (-482.167) -- 0:00:21
550000 -- [-486.680] (-482.058) (-482.172) (-481.979) * (-483.134) [-481.096] (-485.998) (-482.900) -- 0:00:21
Average standard deviation of split frequencies: 0.011414
550500 -- [-481.813] (-481.915) (-482.973) (-483.764) * (-483.619) [-481.474] (-484.193) (-483.930) -- 0:00:21
551000 -- (-481.729) (-484.067) (-486.325) [-483.045] * (-483.903) (-482.319) (-482.192) [-481.994] -- 0:00:21
551500 -- [-481.793] (-485.031) (-487.073) (-482.004) * (-482.779) [-482.631] (-488.170) (-482.585) -- 0:00:21
552000 -- (-485.307) (-483.066) (-484.857) [-485.495] * (-480.822) [-482.877] (-488.320) (-481.944) -- 0:00:21
552500 -- (-486.060) (-481.590) (-482.720) [-481.627] * [-480.933] (-480.613) (-491.988) (-480.902) -- 0:00:21
553000 -- [-483.909] (-481.311) (-485.663) (-481.712) * (-481.218) (-481.683) [-491.623] (-481.064) -- 0:00:21
553500 -- (-488.324) (-483.025) (-482.486) [-482.810] * (-486.697) (-481.262) [-482.966] (-481.369) -- 0:00:20
554000 -- (-484.772) (-481.671) (-483.985) [-481.903] * (-483.554) (-482.695) (-485.259) [-485.947] -- 0:00:20
554500 -- (-481.862) [-480.461] (-485.071) (-483.369) * (-484.156) [-483.115] (-482.165) (-484.361) -- 0:00:20
555000 -- (-484.269) (-480.359) [-484.082] (-481.390) * (-482.521) (-484.136) [-482.639] (-485.254) -- 0:00:20
Average standard deviation of split frequencies: 0.011870
555500 -- (-486.078) (-486.310) [-482.233] (-485.704) * (-483.105) (-483.863) (-482.272) [-484.837] -- 0:00:20
556000 -- (-481.777) (-484.128) (-485.446) [-482.691] * (-482.008) (-487.601) (-481.790) [-481.230] -- 0:00:20
556500 -- [-480.794] (-483.043) (-481.227) (-484.691) * [-481.602] (-481.254) (-480.745) (-482.837) -- 0:00:20
557000 -- (-481.848) [-483.164] (-483.452) (-482.277) * (-480.615) (-481.876) [-481.111] (-482.048) -- 0:00:20
557500 -- [-482.429] (-483.335) (-481.832) (-483.198) * (-481.622) [-482.776] (-482.454) (-481.855) -- 0:00:20
558000 -- [-480.693] (-481.920) (-480.574) (-485.161) * (-482.242) (-483.979) [-482.717] (-481.163) -- 0:00:20
558500 -- [-481.223] (-484.994) (-482.780) (-481.220) * (-483.125) (-481.912) (-486.609) [-484.090] -- 0:00:20
559000 -- (-481.714) (-483.541) (-483.728) [-482.349] * (-486.121) (-481.832) (-481.379) [-482.417] -- 0:00:20
559500 -- (-483.760) [-481.929] (-484.288) (-481.358) * [-481.208] (-482.136) (-482.186) (-482.389) -- 0:00:20
560000 -- (-481.311) (-482.683) [-482.824] (-485.058) * (-483.123) (-484.390) (-483.010) [-482.982] -- 0:00:20
Average standard deviation of split frequencies: 0.009529
560500 -- [-481.734] (-481.971) (-482.153) (-481.237) * [-482.942] (-483.850) (-482.238) (-481.337) -- 0:00:20
561000 -- (-484.132) [-481.934] (-481.897) (-480.287) * (-484.876) [-484.383] (-483.662) (-481.788) -- 0:00:20
561500 -- (-481.578) (-481.766) (-480.356) [-481.224] * (-482.876) (-485.650) [-488.864] (-481.062) -- 0:00:20
562000 -- (-482.051) (-481.496) [-481.158] (-481.348) * [-481.885] (-481.525) (-483.116) (-482.787) -- 0:00:20
562500 -- (-482.655) [-481.692] (-482.614) (-483.580) * (-483.687) (-484.515) [-481.166] (-481.231) -- 0:00:21
563000 -- (-482.591) (-480.445) [-480.342] (-482.641) * [-481.264] (-488.101) (-482.058) (-482.647) -- 0:00:20
563500 -- (-481.289) [-481.777] (-481.587) (-482.813) * (-482.555) (-487.293) (-482.032) [-483.498] -- 0:00:20
564000 -- (-482.736) [-483.907] (-482.218) (-481.331) * [-481.849] (-485.079) (-482.722) (-483.511) -- 0:00:20
564500 -- (-481.647) (-482.054) [-483.210] (-482.018) * (-483.244) (-483.375) (-482.091) [-486.406] -- 0:00:20
565000 -- [-481.560] (-481.873) (-483.437) (-482.056) * (-482.264) [-483.601] (-486.463) (-481.973) -- 0:00:20
Average standard deviation of split frequencies: 0.009994
565500 -- [-482.697] (-482.588) (-482.293) (-481.203) * [-482.557] (-481.542) (-484.658) (-486.093) -- 0:00:20
566000 -- [-484.212] (-489.278) (-484.212) (-481.859) * (-481.994) (-489.821) (-484.086) [-483.846] -- 0:00:20
566500 -- [-481.357] (-484.733) (-484.426) (-482.876) * (-480.770) (-485.427) (-483.057) [-482.428] -- 0:00:20
567000 -- (-486.695) [-484.780] (-482.963) (-480.310) * (-483.555) (-483.897) (-482.724) [-481.198] -- 0:00:20
567500 -- (-481.597) [-486.117] (-486.813) (-483.605) * (-487.237) (-481.475) (-482.189) [-480.587] -- 0:00:20
568000 -- (-481.635) (-486.453) [-481.572] (-484.804) * (-480.624) [-482.096] (-485.267) (-482.806) -- 0:00:20
568500 -- (-482.778) (-484.133) [-482.050] (-486.080) * (-481.901) (-481.689) (-489.126) [-483.508] -- 0:00:20
569000 -- (-486.821) (-481.409) (-480.487) [-482.880] * (-485.241) [-482.671] (-486.923) (-482.319) -- 0:00:20
569500 -- (-481.722) [-480.955] (-483.122) (-482.593) * (-483.758) [-483.010] (-482.947) (-482.791) -- 0:00:20
570000 -- (-481.681) [-481.092] (-482.775) (-482.871) * (-484.704) [-484.808] (-482.023) (-480.998) -- 0:00:20
Average standard deviation of split frequencies: 0.010463
570500 -- (-482.497) [-481.473] (-481.320) (-482.342) * (-480.995) [-482.038] (-485.644) (-485.339) -- 0:00:20
571000 -- [-485.819] (-482.485) (-486.867) (-481.165) * [-482.940] (-481.790) (-487.249) (-481.753) -- 0:00:20
571500 -- (-482.605) [-484.540] (-482.019) (-482.207) * (-484.075) (-484.272) (-482.390) [-482.618] -- 0:00:20
572000 -- (-481.415) [-481.778] (-481.886) (-482.228) * (-488.071) [-483.211] (-481.344) (-483.279) -- 0:00:20
572500 -- (-481.559) (-480.947) [-481.856] (-482.245) * [-482.029] (-480.777) (-482.124) (-481.920) -- 0:00:20
573000 -- [-483.318] (-482.040) (-480.411) (-484.727) * (-481.934) (-482.884) (-481.058) [-481.293] -- 0:00:20
573500 -- [-483.738] (-483.498) (-481.333) (-486.560) * (-484.160) (-486.916) (-487.675) [-482.687] -- 0:00:20
574000 -- (-482.664) [-481.402] (-481.076) (-484.240) * (-485.230) (-483.599) [-482.650] (-483.730) -- 0:00:20
574500 -- [-482.340] (-482.486) (-485.113) (-482.084) * (-481.912) [-484.592] (-483.067) (-482.654) -- 0:00:19
575000 -- [-481.194] (-481.733) (-481.867) (-484.195) * (-482.342) [-483.222] (-480.616) (-482.450) -- 0:00:19
Average standard deviation of split frequencies: 0.009275
575500 -- (-480.973) (-487.626) (-481.483) [-480.735] * (-480.581) [-482.461] (-483.782) (-482.448) -- 0:00:19
576000 -- (-483.264) [-487.129] (-480.485) (-483.325) * (-481.636) (-485.823) (-484.275) [-486.213] -- 0:00:19
576500 -- (-485.713) (-482.540) (-483.215) [-482.546] * [-481.269] (-483.758) (-482.442) (-480.858) -- 0:00:19
577000 -- (-483.797) (-481.022) (-484.981) [-481.243] * (-482.695) [-481.919] (-482.616) (-481.821) -- 0:00:19
577500 -- (-482.764) (-487.020) (-487.568) [-483.807] * (-483.629) (-483.035) [-482.489] (-481.616) -- 0:00:19
578000 -- (-482.438) (-481.659) [-483.146] (-483.975) * (-485.047) (-484.216) (-482.956) [-483.109] -- 0:00:19
578500 -- (-483.896) (-482.551) [-488.139] (-481.249) * (-484.424) (-484.612) [-481.333] (-482.966) -- 0:00:19
579000 -- (-481.470) (-483.040) [-482.390] (-483.400) * (-482.689) [-484.049] (-480.794) (-481.180) -- 0:00:19
579500 -- (-486.236) (-481.972) (-482.393) [-483.597] * (-482.999) (-485.527) (-485.297) [-483.405] -- 0:00:19
580000 -- (-485.818) [-482.768] (-483.900) (-481.259) * (-480.938) (-484.464) (-484.716) [-482.211] -- 0:00:19
Average standard deviation of split frequencies: 0.006495
580500 -- (-484.171) [-484.915] (-480.502) (-481.850) * (-482.889) (-483.648) (-482.023) [-481.815] -- 0:00:19
581000 -- (-486.708) (-481.775) (-485.047) [-481.926] * (-481.482) (-481.957) (-483.241) [-482.740] -- 0:00:19
581500 -- (-482.153) (-482.679) (-484.563) [-482.292] * (-483.220) (-483.480) [-486.552] (-481.247) -- 0:00:19
582000 -- (-484.978) (-483.232) [-481.637] (-481.899) * (-482.744) [-483.843] (-480.545) (-482.254) -- 0:00:19
582500 -- [-483.328] (-482.543) (-483.655) (-483.201) * [-483.298] (-483.322) (-481.413) (-483.738) -- 0:00:19
583000 -- (-481.731) (-487.815) (-485.435) [-483.901] * (-483.757) [-486.799] (-487.438) (-481.678) -- 0:00:19
583500 -- (-480.501) (-481.756) (-483.406) [-484.070] * [-482.254] (-481.676) (-484.972) (-481.633) -- 0:00:19
584000 -- [-480.669] (-481.615) (-481.634) (-480.862) * (-482.804) (-482.365) (-483.627) [-481.777] -- 0:00:19
584500 -- (-483.097) (-480.884) (-484.745) [-480.970] * [-481.406] (-483.346) (-486.013) (-485.632) -- 0:00:19
585000 -- [-482.425] (-484.796) (-480.820) (-483.025) * [-481.619] (-482.650) (-485.817) (-482.261) -- 0:00:19
Average standard deviation of split frequencies: 0.006436
585500 -- [-481.020] (-482.709) (-484.742) (-483.400) * (-481.732) (-484.336) (-480.426) [-481.494] -- 0:00:19
586000 -- (-483.007) (-484.279) [-481.798] (-484.958) * (-486.101) (-488.425) (-483.279) [-481.737] -- 0:00:19
586500 -- (-483.762) [-483.313] (-483.899) (-488.770) * (-483.425) (-487.039) (-480.718) [-482.068] -- 0:00:19
587000 -- [-481.694] (-480.999) (-482.488) (-482.835) * [-483.962] (-483.774) (-482.669) (-484.624) -- 0:00:19
587500 -- (-482.942) (-482.515) (-484.742) [-480.774] * (-480.533) (-482.799) [-482.249] (-483.965) -- 0:00:19
588000 -- (-483.101) [-484.696] (-481.299) (-481.454) * [-480.802] (-484.265) (-480.812) (-484.256) -- 0:00:19
588500 -- (-480.656) (-483.783) [-482.089] (-480.902) * (-481.925) [-483.691] (-484.106) (-483.178) -- 0:00:19
589000 -- [-481.702] (-483.066) (-482.005) (-481.780) * (-483.056) (-487.185) (-483.699) [-485.133] -- 0:00:19
589500 -- (-483.921) (-484.261) (-482.226) [-482.163] * (-482.038) (-480.560) [-481.290] (-483.422) -- 0:00:19
590000 -- [-482.155] (-483.268) (-483.085) (-480.767) * (-481.029) (-484.068) (-484.550) [-482.989] -- 0:00:19
Average standard deviation of split frequencies: 0.005853
590500 -- (-480.754) (-485.217) (-482.232) [-484.640] * [-480.544] (-484.020) (-482.609) (-480.650) -- 0:00:19
591000 -- (-484.900) [-485.711] (-482.775) (-482.080) * (-483.958) (-487.663) (-485.628) [-482.949] -- 0:00:19
591500 -- (-484.817) (-482.959) (-480.778) [-482.428] * (-482.079) (-483.378) [-483.528] (-483.253) -- 0:00:19
592000 -- (-481.405) (-482.093) (-483.979) [-481.099] * (-481.896) [-488.503] (-481.335) (-485.085) -- 0:00:19
592500 -- [-482.223] (-481.012) (-483.162) (-482.415) * (-484.559) (-483.133) [-481.815] (-484.836) -- 0:00:19
593000 -- (-481.661) (-482.944) (-482.284) [-485.313] * [-484.250] (-483.617) (-482.637) (-481.381) -- 0:00:19
593500 -- (-484.318) (-482.736) (-484.625) [-482.146] * (-481.497) [-481.223] (-486.009) (-485.856) -- 0:00:19
594000 -- [-480.257] (-481.200) (-480.940) (-482.188) * (-481.245) (-481.272) [-482.343] (-481.374) -- 0:00:19
594500 -- (-482.439) (-483.614) (-487.615) [-481.822] * (-485.447) (-480.646) [-485.448] (-481.732) -- 0:00:19
595000 -- (-480.761) (-482.008) (-484.636) [-484.025] * (-480.545) [-484.822] (-485.967) (-487.639) -- 0:00:19
Average standard deviation of split frequencies: 0.005273
595500 -- (-482.686) [-482.972] (-487.054) (-482.567) * [-481.744] (-482.789) (-483.486) (-483.567) -- 0:00:19
596000 -- [-482.211] (-482.236) (-482.511) (-482.455) * (-482.774) (-482.827) [-484.565] (-483.883) -- 0:00:18
596500 -- (-483.070) (-482.046) (-482.008) [-480.592] * (-481.873) (-483.678) (-481.308) [-482.484] -- 0:00:18
597000 -- (-482.375) (-482.428) (-481.424) [-484.660] * (-483.635) [-490.041] (-482.836) (-481.597) -- 0:00:18
597500 -- (-485.074) (-480.607) (-482.446) [-485.203] * (-482.680) [-482.232] (-483.584) (-484.674) -- 0:00:18
598000 -- [-482.521] (-481.040) (-481.494) (-484.888) * (-483.287) (-484.363) [-480.999] (-484.417) -- 0:00:18
598500 -- (-485.555) (-482.171) (-484.050) [-481.125] * (-485.349) (-481.229) [-481.025] (-482.753) -- 0:00:18
599000 -- (-490.182) (-488.466) [-482.592] (-483.935) * (-484.065) (-480.339) (-481.516) [-484.019] -- 0:00:18
599500 -- (-483.859) (-490.586) (-481.795) [-483.344] * (-482.213) (-480.390) [-480.363] (-484.269) -- 0:00:18
600000 -- (-483.406) [-487.603] (-484.697) (-482.727) * [-481.250] (-482.621) (-480.796) (-482.862) -- 0:00:18
Average standard deviation of split frequencies: 0.005755
600500 -- [-480.939] (-488.623) (-482.197) (-482.591) * (-481.898) (-486.510) (-481.391) [-484.175] -- 0:00:18
601000 -- (-481.408) (-484.503) [-484.959] (-481.213) * [-483.637] (-488.241) (-483.752) (-484.282) -- 0:00:18
601500 -- (-482.367) [-481.340] (-480.650) (-481.635) * (-481.416) (-483.123) [-480.721] (-483.324) -- 0:00:18
602000 -- (-482.527) (-481.572) [-480.783] (-483.755) * [-481.349] (-490.505) (-481.171) (-481.031) -- 0:00:18
602500 -- (-482.215) (-484.992) [-483.093] (-485.775) * (-482.441) [-482.948] (-482.174) (-486.520) -- 0:00:18
603000 -- (-486.690) (-487.513) [-482.631] (-483.260) * (-483.689) (-482.835) [-485.797] (-483.442) -- 0:00:18
603500 -- (-482.532) (-490.175) [-483.208] (-485.871) * (-482.013) [-481.591] (-482.316) (-483.048) -- 0:00:18
604000 -- [-484.454] (-481.472) (-482.320) (-482.649) * (-481.695) (-483.619) [-483.731] (-484.304) -- 0:00:18
604500 -- (-482.764) (-481.372) [-482.660] (-483.613) * (-483.127) (-481.379) [-482.118] (-482.428) -- 0:00:18
605000 -- (-484.026) (-483.300) (-481.468) [-482.384] * (-482.372) (-483.521) (-483.443) [-482.305] -- 0:00:18
Average standard deviation of split frequencies: 0.007260
605500 -- (-483.957) [-483.580] (-481.444) (-485.127) * (-482.989) [-481.455] (-480.864) (-482.047) -- 0:00:18
606000 -- (-483.930) [-481.517] (-483.344) (-484.521) * (-484.029) (-482.043) [-481.279] (-481.447) -- 0:00:18
606500 -- [-483.110] (-483.116) (-484.942) (-481.878) * [-482.667] (-482.645) (-483.380) (-482.881) -- 0:00:18
607000 -- [-482.172] (-481.381) (-482.953) (-481.536) * [-483.415] (-481.499) (-481.527) (-483.371) -- 0:00:18
607500 -- [-480.857] (-482.899) (-485.389) (-481.310) * (-482.387) (-481.944) [-483.622] (-482.127) -- 0:00:18
608000 -- (-481.285) (-481.639) (-482.161) [-482.894] * [-483.121] (-483.855) (-489.409) (-483.068) -- 0:00:18
608500 -- [-483.286] (-485.465) (-482.451) (-487.769) * (-483.545) [-482.216] (-484.801) (-489.815) -- 0:00:18
609000 -- [-482.727] (-483.488) (-481.074) (-482.992) * (-482.260) [-481.539] (-482.306) (-486.486) -- 0:00:18
609500 -- (-480.610) (-484.177) (-483.738) [-484.631] * [-483.053] (-481.320) (-484.989) (-484.127) -- 0:00:18
610000 -- [-484.626] (-480.300) (-481.941) (-482.040) * (-485.826) [-481.057] (-481.711) (-482.813) -- 0:00:18
Average standard deviation of split frequencies: 0.008234
610500 -- (-482.771) (-484.124) (-484.279) [-481.992] * (-484.264) (-482.186) (-481.655) [-481.931] -- 0:00:18
611000 -- (-482.779) (-482.368) (-482.316) [-482.800] * (-481.796) [-481.308] (-482.514) (-480.942) -- 0:00:18
611500 -- [-483.427] (-481.918) (-483.931) (-482.385) * (-482.648) [-482.022] (-482.643) (-482.009) -- 0:00:18
612000 -- (-483.780) (-480.817) (-490.896) [-480.780] * (-482.880) [-482.744] (-481.636) (-482.205) -- 0:00:18
612500 -- (-485.135) (-481.469) (-483.914) [-480.726] * (-481.239) [-482.121] (-481.562) (-483.604) -- 0:00:18
613000 -- (-483.649) (-482.643) [-485.570] (-485.119) * (-481.555) (-481.781) [-483.758] (-483.051) -- 0:00:18
613500 -- [-483.579] (-482.567) (-483.276) (-483.022) * [-480.896] (-486.890) (-484.592) (-485.997) -- 0:00:18
614000 -- [-485.398] (-480.493) (-486.050) (-481.727) * (-480.965) (-482.300) [-485.005] (-485.159) -- 0:00:18
614500 -- (-480.904) [-481.350] (-483.596) (-483.641) * [-484.399] (-480.932) (-482.781) (-483.538) -- 0:00:18
615000 -- [-483.012] (-480.831) (-483.686) (-482.360) * [-483.088] (-482.779) (-482.924) (-485.338) -- 0:00:18
Average standard deviation of split frequencies: 0.007142
615500 -- (-481.523) [-483.916] (-483.277) (-483.488) * (-481.519) [-482.450] (-482.321) (-484.580) -- 0:00:18
616000 -- (-483.042) [-481.387] (-482.015) (-484.074) * (-482.887) (-481.747) [-485.458] (-484.184) -- 0:00:18
616500 -- (-482.904) [-481.259] (-484.270) (-481.574) * (-482.856) (-480.694) (-481.930) [-482.404] -- 0:00:18
617000 -- (-485.369) (-482.362) [-481.025] (-481.933) * (-480.969) [-481.866] (-482.667) (-482.639) -- 0:00:18
617500 -- (-485.666) [-480.412] (-482.633) (-482.840) * (-484.291) (-481.381) [-482.804] (-491.441) -- 0:00:17
618000 -- (-484.119) [-485.459] (-482.230) (-482.719) * (-481.427) (-480.918) (-482.500) [-482.698] -- 0:00:17
618500 -- (-484.622) [-484.560] (-484.164) (-487.676) * (-481.932) (-481.367) [-483.129] (-481.965) -- 0:00:17
619000 -- [-483.851] (-482.636) (-480.440) (-484.168) * (-480.854) [-482.105] (-483.420) (-484.844) -- 0:00:17
619500 -- [-482.315] (-485.248) (-481.254) (-483.579) * [-483.563] (-481.048) (-482.673) (-484.254) -- 0:00:17
620000 -- (-482.044) (-483.451) [-481.858] (-484.258) * (-480.998) (-483.413) [-481.114] (-481.688) -- 0:00:17
Average standard deviation of split frequencies: 0.009621
620500 -- (-481.427) (-481.177) (-487.118) [-482.026] * (-483.944) [-482.409] (-483.477) (-483.881) -- 0:00:17
621000 -- [-482.401] (-482.393) (-486.603) (-483.204) * (-482.385) (-481.197) (-483.482) [-485.928] -- 0:00:17
621500 -- (-488.090) (-484.938) [-484.797] (-480.588) * (-483.487) (-490.826) (-483.120) [-486.708] -- 0:00:17
622000 -- (-482.817) [-482.070] (-483.251) (-481.809) * [-484.277] (-491.710) (-482.183) (-492.528) -- 0:00:17
622500 -- (-482.113) (-483.116) [-481.571] (-483.664) * (-481.864) [-482.862] (-483.612) (-481.750) -- 0:00:17
623000 -- (-481.338) (-482.675) (-481.933) [-481.305] * (-490.459) [-481.761] (-484.114) (-484.244) -- 0:00:17
623500 -- [-485.796] (-483.598) (-482.905) (-481.071) * (-482.505) (-485.227) [-486.928] (-484.063) -- 0:00:17
624000 -- (-483.150) (-482.948) (-486.758) [-483.682] * (-485.182) (-480.843) [-483.757] (-482.850) -- 0:00:17
624500 -- (-480.937) (-483.155) (-484.442) [-482.332] * (-483.541) (-481.664) (-484.999) [-482.778] -- 0:00:17
625000 -- (-483.546) (-482.849) (-482.150) [-481.803] * (-481.405) (-482.869) [-481.630] (-481.465) -- 0:00:17
Average standard deviation of split frequencies: 0.007530
625500 -- (-482.618) [-482.587] (-481.898) (-484.046) * [-481.875] (-486.017) (-486.062) (-483.606) -- 0:00:17
626000 -- (-484.026) (-485.434) (-483.353) [-481.365] * (-483.039) (-484.834) (-482.768) [-482.984] -- 0:00:17
626500 -- (-482.353) [-482.227] (-486.807) (-482.574) * [-481.665] (-489.376) (-483.504) (-483.585) -- 0:00:17
627000 -- [-484.068] (-483.080) (-486.044) (-481.903) * [-480.648] (-485.066) (-483.966) (-484.154) -- 0:00:17
627500 -- (-484.561) [-484.285] (-488.054) (-486.689) * (-480.865) [-481.860] (-481.504) (-483.485) -- 0:00:17
628000 -- (-484.552) (-482.511) [-482.281] (-492.542) * (-481.858) (-482.751) (-483.099) [-483.164] -- 0:00:17
628500 -- (-484.707) (-481.269) (-486.370) [-482.175] * (-481.836) (-481.989) [-483.209] (-487.544) -- 0:00:17
629000 -- (-481.270) (-486.935) (-482.549) [-482.939] * (-482.508) (-483.701) [-482.430] (-483.668) -- 0:00:17
629500 -- (-481.012) (-482.821) [-480.639] (-480.504) * (-480.721) (-483.902) (-482.022) [-481.145] -- 0:00:17
630000 -- (-481.787) [-482.579] (-486.787) (-481.853) * (-481.440) (-484.393) (-481.854) [-481.914] -- 0:00:17
Average standard deviation of split frequencies: 0.007973
630500 -- (-484.097) (-482.986) (-480.335) [-481.455] * (-481.730) (-483.893) (-482.039) [-481.862] -- 0:00:17
631000 -- (-481.878) [-482.454] (-481.517) (-481.732) * (-483.808) [-482.271] (-484.788) (-483.222) -- 0:00:17
631500 -- (-481.454) (-483.045) (-486.885) [-481.388] * (-484.018) (-482.808) [-481.549] (-482.695) -- 0:00:17
632000 -- [-482.714] (-485.827) (-488.165) (-481.027) * (-482.884) [-484.609] (-482.337) (-486.012) -- 0:00:17
632500 -- [-481.457] (-486.467) (-489.017) (-482.700) * (-480.980) (-485.408) [-483.815] (-486.420) -- 0:00:17
633000 -- [-482.389] (-483.634) (-482.980) (-486.563) * (-481.327) (-481.779) (-483.357) [-481.500] -- 0:00:17
633500 -- (-484.230) [-483.131] (-481.590) (-484.875) * (-488.236) (-481.754) (-484.733) [-482.350] -- 0:00:17
634000 -- [-481.720] (-481.253) (-480.944) (-484.132) * (-484.555) (-481.480) [-481.294] (-481.975) -- 0:00:17
634500 -- (-481.955) (-483.501) (-484.548) [-483.204] * [-483.425] (-484.982) (-481.218) (-484.538) -- 0:00:17
635000 -- (-483.373) (-482.284) [-481.179] (-482.248) * (-482.172) [-485.947] (-481.310) (-484.041) -- 0:00:17
Average standard deviation of split frequencies: 0.006424
635500 -- (-481.263) (-483.059) [-481.109] (-482.983) * (-483.554) (-482.040) (-482.372) [-481.811] -- 0:00:17
636000 -- (-485.859) (-487.837) [-481.670] (-487.717) * (-484.342) (-486.031) [-482.551] (-482.815) -- 0:00:17
636500 -- [-486.061] (-481.968) (-481.831) (-485.457) * (-482.769) (-485.098) [-481.357] (-482.001) -- 0:00:17
637000 -- (-482.004) (-482.127) (-482.707) [-484.834] * [-483.321] (-484.816) (-482.400) (-482.214) -- 0:00:17
637500 -- (-480.991) (-482.773) [-483.410] (-481.291) * (-482.842) (-481.167) [-483.002] (-481.648) -- 0:00:17
638000 -- (-482.534) (-483.346) [-483.378] (-484.181) * (-486.683) [-483.214] (-481.952) (-485.873) -- 0:00:17
638500 -- (-484.872) (-482.061) (-481.968) [-483.389] * (-482.048) [-481.144] (-483.318) (-483.018) -- 0:00:16
639000 -- (-483.348) (-483.893) [-483.270] (-481.977) * (-485.068) (-484.756) [-482.333] (-482.813) -- 0:00:16
639500 -- [-481.619] (-483.639) (-481.103) (-482.488) * (-484.959) [-485.145] (-484.469) (-484.472) -- 0:00:16
640000 -- [-483.483] (-483.112) (-481.046) (-482.160) * [-481.107] (-484.008) (-487.786) (-483.698) -- 0:00:16
Average standard deviation of split frequencies: 0.006377
640500 -- [-481.243] (-484.232) (-481.047) (-481.489) * (-482.517) (-481.819) (-481.683) [-484.726] -- 0:00:16
641000 -- [-489.702] (-483.634) (-480.420) (-481.039) * [-484.694] (-482.742) (-484.746) (-481.447) -- 0:00:16
641500 -- (-486.780) (-482.015) (-482.404) [-482.326] * (-487.321) [-483.636] (-484.153) (-480.491) -- 0:00:16
642000 -- (-487.440) (-483.969) [-481.499] (-485.777) * (-485.156) (-484.061) (-482.545) [-482.775] -- 0:00:16
642500 -- (-481.362) (-484.287) [-482.520] (-486.121) * (-485.563) (-481.201) (-482.855) [-481.392] -- 0:00:16
643000 -- (-484.110) (-482.463) (-484.238) [-481.613] * (-481.176) (-481.168) (-484.743) [-486.131] -- 0:00:16
643500 -- (-484.668) (-483.757) [-483.606] (-480.943) * (-481.801) (-480.761) (-483.382) [-483.362] -- 0:00:16
644000 -- (-485.604) [-482.548] (-482.742) (-481.752) * (-481.439) [-481.300] (-482.546) (-482.506) -- 0:00:16
644500 -- (-482.249) (-482.124) [-483.473] (-482.434) * (-481.563) [-481.724] (-481.254) (-482.782) -- 0:00:16
645000 -- [-483.852] (-482.473) (-483.782) (-485.577) * (-485.279) (-484.330) [-481.388] (-483.113) -- 0:00:16
Average standard deviation of split frequencies: 0.004865
645500 -- (-484.209) (-482.429) [-482.570] (-484.222) * (-487.932) (-484.330) [-481.841] (-485.319) -- 0:00:16
646000 -- (-481.579) (-481.859) [-481.128] (-482.451) * (-483.746) [-484.235] (-481.558) (-482.705) -- 0:00:16
646500 -- [-485.440] (-484.712) (-481.536) (-485.719) * (-486.217) [-482.486] (-482.301) (-483.290) -- 0:00:16
647000 -- (-483.016) (-482.464) (-484.801) [-484.368] * (-483.941) (-484.806) [-485.400] (-481.192) -- 0:00:16
647500 -- (-481.350) [-484.090] (-482.331) (-482.088) * [-481.424] (-482.675) (-480.624) (-486.726) -- 0:00:16
648000 -- (-481.885) (-481.963) (-482.658) [-482.183] * (-481.389) (-482.028) [-481.323] (-482.156) -- 0:00:16
648500 -- (-485.200) (-494.132) [-489.481] (-482.479) * (-483.969) [-483.959] (-487.980) (-483.589) -- 0:00:16
649000 -- (-483.194) (-483.918) (-486.081) [-485.918] * (-481.543) [-480.924] (-482.833) (-484.034) -- 0:00:16
649500 -- (-484.764) [-482.956] (-483.605) (-482.697) * [-483.173] (-484.705) (-481.496) (-485.074) -- 0:00:16
650000 -- (-482.481) (-485.019) [-482.657] (-482.765) * (-481.100) (-482.081) [-481.361] (-483.879) -- 0:00:16
Average standard deviation of split frequencies: 0.006279
650500 -- (-483.001) (-483.084) [-484.057] (-482.474) * (-483.198) (-485.640) (-483.469) [-480.754] -- 0:00:16
651000 -- (-486.093) [-483.026] (-481.342) (-486.107) * [-484.852] (-484.899) (-481.406) (-480.786) -- 0:00:16
651500 -- [-487.611] (-481.619) (-482.237) (-482.180) * (-488.228) (-481.713) (-480.611) [-486.045] -- 0:00:16
652000 -- (-486.029) [-483.515] (-483.142) (-481.585) * (-484.791) (-485.259) (-480.687) [-482.092] -- 0:00:16
652500 -- [-481.261] (-482.037) (-484.808) (-481.092) * [-480.920] (-486.607) (-485.463) (-482.612) -- 0:00:16
653000 -- [-487.341] (-481.163) (-484.705) (-481.771) * (-481.480) (-485.265) (-482.959) [-482.257] -- 0:00:16
653500 -- (-483.128) (-483.313) [-481.421] (-482.080) * (-482.860) (-481.272) (-485.672) [-485.517] -- 0:00:16
654000 -- (-480.963) (-480.676) [-483.120] (-482.561) * (-486.333) [-484.614] (-481.554) (-481.091) -- 0:00:16
654500 -- [-480.841] (-482.591) (-481.842) (-481.801) * (-483.669) (-483.679) [-482.040] (-483.129) -- 0:00:16
655000 -- (-481.384) (-486.133) (-482.366) [-482.286] * [-484.598] (-480.714) (-482.893) (-483.526) -- 0:00:16
Average standard deviation of split frequencies: 0.004312
655500 -- (-484.672) (-482.961) (-482.483) [-481.905] * (-482.805) (-480.600) (-480.665) [-481.407] -- 0:00:16
656000 -- [-482.028] (-484.346) (-482.703) (-488.834) * (-483.263) (-480.331) (-484.572) [-481.367] -- 0:00:16
656500 -- [-482.367] (-484.633) (-486.435) (-482.248) * (-482.596) (-480.716) [-482.221] (-482.360) -- 0:00:16
657000 -- (-481.498) (-481.716) [-482.962] (-481.130) * (-484.643) (-482.101) [-481.476] (-480.750) -- 0:00:16
657500 -- (-482.335) [-481.388] (-484.103) (-482.156) * (-481.607) (-483.869) (-481.367) [-482.993] -- 0:00:16
658000 -- (-485.317) (-482.524) (-482.779) [-484.251] * (-481.320) (-482.478) (-484.782) [-483.679] -- 0:00:16
658500 -- [-485.966] (-482.631) (-482.952) (-482.529) * (-483.107) [-483.494] (-483.289) (-482.128) -- 0:00:16
659000 -- (-481.341) (-480.884) [-482.036] (-484.667) * [-482.161] (-482.117) (-484.223) (-486.841) -- 0:00:16
659500 -- (-486.083) (-482.181) [-486.005] (-484.442) * (-482.951) (-485.942) [-483.878] (-482.753) -- 0:00:16
660000 -- (-483.925) [-482.582] (-482.111) (-480.861) * (-481.686) [-480.887] (-483.564) (-486.995) -- 0:00:15
Average standard deviation of split frequencies: 0.004757
660500 -- [-482.509] (-481.986) (-481.026) (-482.299) * (-481.213) (-480.578) [-484.651] (-481.284) -- 0:00:15
661000 -- (-483.151) (-485.403) (-482.556) [-481.556] * (-483.414) (-480.455) [-482.169] (-483.058) -- 0:00:15
661500 -- [-481.066] (-481.653) (-484.559) (-480.865) * (-482.263) [-481.449] (-481.304) (-483.014) -- 0:00:15
662000 -- (-481.540) (-488.867) (-482.836) [-483.147] * [-481.729] (-482.108) (-482.868) (-481.907) -- 0:00:15
662500 -- [-481.124] (-484.038) (-482.399) (-485.046) * (-481.939) (-484.739) [-483.076] (-483.804) -- 0:00:15
663000 -- (-481.639) [-484.030] (-481.196) (-481.127) * [-481.779] (-485.223) (-483.732) (-483.358) -- 0:00:15
663500 -- (-482.036) (-481.978) (-481.736) [-482.992] * (-482.752) [-483.800] (-482.128) (-488.533) -- 0:00:15
664000 -- (-482.467) (-482.869) (-481.642) [-483.827] * (-484.393) [-485.733] (-485.271) (-481.935) -- 0:00:15
664500 -- (-482.230) (-481.905) [-483.372] (-481.365) * [-486.795] (-484.364) (-486.041) (-481.388) -- 0:00:15
665000 -- (-482.356) (-481.622) (-481.359) [-481.429] * (-481.841) (-484.740) (-485.186) [-484.706] -- 0:00:15
Average standard deviation of split frequencies: 0.003775
665500 -- (-482.693) (-481.006) (-483.711) [-481.490] * (-484.911) (-487.820) (-484.637) [-485.393] -- 0:00:15
666000 -- (-485.361) (-481.634) (-482.727) [-483.056] * (-482.815) (-483.094) (-484.927) [-485.146] -- 0:00:15
666500 -- (-481.696) (-484.314) (-485.285) [-482.748] * (-482.586) [-481.248] (-484.361) (-483.404) -- 0:00:15
667000 -- (-485.540) [-480.642] (-480.582) (-485.448) * (-484.139) [-485.176] (-483.574) (-480.627) -- 0:00:15
667500 -- [-482.651] (-481.837) (-483.139) (-481.644) * (-482.215) (-482.748) [-482.738] (-482.757) -- 0:00:15
668000 -- (-483.768) (-482.897) [-481.447] (-484.036) * (-483.613) (-486.005) [-482.876] (-482.407) -- 0:00:15
668500 -- [-480.984] (-488.040) (-480.651) (-483.655) * (-485.616) (-482.120) [-481.367] (-483.235) -- 0:00:15
669000 -- (-482.608) (-483.315) (-482.570) [-483.146] * (-481.102) (-482.639) [-482.890] (-482.444) -- 0:00:15
669500 -- (-486.663) [-483.141] (-484.125) (-481.168) * [-483.745] (-481.705) (-480.891) (-481.492) -- 0:00:15
670000 -- (-486.761) (-481.312) [-482.543] (-481.158) * [-481.486] (-481.127) (-481.292) (-481.046) -- 0:00:15
Average standard deviation of split frequencies: 0.004217
670500 -- (-482.646) [-485.810] (-484.707) (-486.751) * (-484.560) [-486.345] (-482.469) (-484.089) -- 0:00:15
671000 -- (-481.518) (-483.234) [-483.921] (-480.768) * (-487.388) (-483.185) (-485.843) [-485.196] -- 0:00:15
671500 -- (-481.361) (-483.278) [-482.739] (-482.943) * (-486.057) [-483.589] (-489.892) (-483.083) -- 0:00:15
672000 -- (-480.976) (-481.293) (-480.942) [-482.316] * (-482.628) [-484.788] (-486.014) (-481.694) -- 0:00:15
672500 -- [-481.258] (-481.175) (-486.265) (-482.366) * [-482.682] (-483.040) (-485.253) (-480.959) -- 0:00:15
673000 -- [-481.324] (-481.784) (-487.394) (-483.563) * (-485.263) [-480.809] (-485.363) (-483.876) -- 0:00:15
673500 -- (-485.952) [-482.769] (-483.595) (-484.056) * [-481.065] (-481.460) (-484.911) (-483.404) -- 0:00:15
674000 -- (-481.777) (-481.745) [-482.931] (-484.407) * (-487.738) (-482.193) [-481.284] (-484.011) -- 0:00:15
674500 -- [-481.223] (-483.478) (-485.636) (-481.981) * (-484.417) [-483.218] (-481.608) (-480.883) -- 0:00:15
675000 -- (-480.870) (-483.320) [-482.824] (-487.355) * (-482.946) (-481.621) [-481.376] (-480.613) -- 0:00:15
Average standard deviation of split frequencies: 0.003719
675500 -- (-482.726) (-483.056) (-483.836) [-481.463] * [-481.799] (-483.277) (-482.000) (-484.000) -- 0:00:15
676000 -- [-481.158] (-483.550) (-484.088) (-481.016) * (-484.684) [-483.221] (-481.586) (-482.186) -- 0:00:15
676500 -- (-483.733) (-483.421) (-484.458) [-483.075] * (-482.253) (-484.653) [-481.184] (-486.015) -- 0:00:15
677000 -- (-482.683) [-481.073] (-481.947) (-486.735) * [-483.273] (-483.366) (-482.095) (-482.289) -- 0:00:15
677500 -- [-481.838] (-485.905) (-481.189) (-481.199) * (-483.010) [-485.929] (-485.248) (-482.693) -- 0:00:15
678000 -- (-485.736) (-482.330) [-483.361] (-480.782) * (-481.611) (-482.668) (-481.448) [-482.197] -- 0:00:15
678500 -- (-485.854) [-484.091] (-482.167) (-482.583) * (-482.881) (-484.962) [-481.594] (-480.743) -- 0:00:15
679000 -- (-483.442) [-481.760] (-483.277) (-481.227) * (-485.565) (-483.115) [-481.891] (-482.961) -- 0:00:15
679500 -- (-482.052) (-481.989) [-483.265] (-480.974) * (-482.608) [-483.385] (-484.398) (-482.295) -- 0:00:15
680000 -- (-481.078) [-481.071] (-483.402) (-484.411) * (-482.230) [-485.124] (-481.900) (-480.946) -- 0:00:15
Average standard deviation of split frequencies: 0.006002
680500 -- (-481.813) (-482.156) (-486.906) [-481.548] * [-485.785] (-482.014) (-485.764) (-480.835) -- 0:00:15
681000 -- (-484.787) [-481.007] (-484.252) (-481.571) * (-485.803) (-482.161) (-484.931) [-482.081] -- 0:00:14
681500 -- [-481.790] (-480.873) (-482.739) (-481.451) * (-482.541) [-482.129] (-487.563) (-482.183) -- 0:00:14
682000 -- (-482.702) [-481.160] (-482.603) (-480.751) * (-486.144) [-483.435] (-483.760) (-482.645) -- 0:00:14
682500 -- [-481.932] (-487.505) (-480.832) (-480.694) * (-488.455) (-484.186) [-488.565] (-481.632) -- 0:00:14
683000 -- [-483.881] (-483.472) (-487.018) (-483.581) * (-480.961) (-482.660) (-481.625) [-485.101] -- 0:00:14
683500 -- (-482.934) [-483.266] (-487.749) (-481.827) * (-480.801) [-482.311] (-481.686) (-484.331) -- 0:00:14
684000 -- (-489.243) (-482.866) (-482.644) [-482.048] * (-482.209) (-480.773) [-480.627] (-482.955) -- 0:00:14
684500 -- (-483.055) [-481.784] (-484.861) (-481.126) * (-482.317) (-484.551) [-481.256] (-483.648) -- 0:00:14
685000 -- [-480.655] (-483.385) (-482.168) (-482.344) * (-482.159) [-484.360] (-483.052) (-481.418) -- 0:00:14
Average standard deviation of split frequencies: 0.005956
685500 -- [-483.959] (-482.437) (-481.947) (-484.824) * (-482.873) [-482.952] (-481.729) (-483.437) -- 0:00:14
686000 -- [-483.739] (-483.561) (-482.156) (-482.631) * [-482.388] (-487.910) (-486.364) (-483.488) -- 0:00:14
686500 -- (-484.398) [-481.164] (-484.140) (-484.478) * (-484.270) [-481.805] (-481.918) (-481.722) -- 0:00:14
687000 -- (-482.970) (-481.163) (-481.664) [-480.749] * (-485.520) (-485.224) [-483.191] (-484.876) -- 0:00:14
687500 -- [-482.715] (-483.385) (-480.706) (-482.008) * (-483.510) [-481.400] (-484.933) (-483.030) -- 0:00:14
688000 -- [-480.975] (-483.914) (-480.838) (-480.855) * (-481.145) (-482.104) (-480.690) [-486.269] -- 0:00:14
688500 -- [-482.760] (-483.985) (-482.314) (-482.871) * (-484.970) (-484.296) (-482.151) [-484.077] -- 0:00:14
689000 -- (-482.698) (-483.420) (-486.231) [-481.440] * (-482.384) (-482.430) [-483.514] (-483.686) -- 0:00:14
689500 -- [-481.598] (-480.867) (-485.428) (-481.383) * (-481.144) [-482.258] (-484.880) (-483.910) -- 0:00:14
690000 -- (-483.985) (-482.016) [-480.862] (-481.266) * (-482.824) (-481.296) (-482.998) [-483.628] -- 0:00:14
Average standard deviation of split frequencies: 0.006825
690500 -- [-480.910] (-483.448) (-481.907) (-482.103) * (-484.185) [-481.368] (-483.428) (-481.348) -- 0:00:14
691000 -- (-480.656) (-481.136) [-482.044] (-485.942) * (-484.035) (-480.733) (-482.971) [-480.931] -- 0:00:14
691500 -- (-482.915) (-485.962) [-482.410] (-485.127) * (-482.003) (-482.126) (-483.270) [-481.619] -- 0:00:14
692000 -- [-482.328] (-484.655) (-485.283) (-484.166) * (-481.116) (-482.722) [-482.498] (-481.685) -- 0:00:14
692500 -- [-482.195] (-482.012) (-483.728) (-483.378) * (-484.820) (-480.936) [-481.699] (-480.920) -- 0:00:14
693000 -- (-484.531) (-481.426) [-481.225] (-482.297) * [-482.863] (-482.597) (-481.185) (-484.580) -- 0:00:14
693500 -- [-484.798] (-483.483) (-483.116) (-483.971) * (-481.319) (-482.645) [-481.301] (-483.474) -- 0:00:14
694000 -- (-484.706) (-481.230) [-481.926] (-484.434) * (-481.880) (-483.795) [-482.796] (-480.940) -- 0:00:14
694500 -- (-484.128) (-481.974) [-484.851] (-481.965) * (-480.611) [-483.596] (-482.706) (-480.962) -- 0:00:14
695000 -- [-482.768] (-481.039) (-481.965) (-482.460) * (-481.810) [-482.183] (-481.781) (-482.511) -- 0:00:14
Average standard deviation of split frequencies: 0.006322
695500 -- (-481.948) (-483.082) [-481.744] (-481.842) * (-482.781) [-485.377] (-482.385) (-482.380) -- 0:00:14
696000 -- [-482.706] (-482.920) (-484.210) (-482.123) * [-481.836] (-485.608) (-481.986) (-482.057) -- 0:00:14
696500 -- (-484.841) [-482.566] (-481.998) (-483.050) * (-482.778) [-481.910] (-482.103) (-483.873) -- 0:00:14
697000 -- (-483.754) (-481.081) [-481.231] (-482.444) * [-481.548] (-482.514) (-482.257) (-483.623) -- 0:00:14
697500 -- [-484.860] (-481.960) (-484.312) (-482.381) * (-483.832) (-485.300) (-481.225) [-481.875] -- 0:00:14
698000 -- (-481.489) (-482.394) [-486.420] (-480.845) * [-482.231] (-481.465) (-481.871) (-481.246) -- 0:00:14
698500 -- (-481.542) (-484.382) (-483.968) [-481.955] * [-481.574] (-484.255) (-481.942) (-482.018) -- 0:00:14
699000 -- [-481.631] (-481.608) (-493.363) (-482.952) * (-480.980) (-481.766) [-482.477] (-482.647) -- 0:00:14
699500 -- (-484.801) [-482.934] (-483.352) (-486.159) * (-484.301) (-481.905) (-482.673) [-481.289] -- 0:00:14
700000 -- [-482.038] (-484.586) (-486.152) (-481.444) * [-483.544] (-483.673) (-481.285) (-482.587) -- 0:00:14
Average standard deviation of split frequencies: 0.002691
700500 -- [-481.859] (-485.302) (-483.152) (-485.054) * (-482.000) (-481.142) (-480.673) [-483.234] -- 0:00:14
701000 -- [-483.519] (-484.431) (-486.575) (-484.362) * (-483.782) (-481.180) (-481.936) [-481.880] -- 0:00:14
701500 -- (-482.614) [-480.812] (-484.007) (-480.734) * (-483.431) [-481.846] (-481.748) (-484.103) -- 0:00:14
702000 -- (-482.308) (-481.211) [-483.419] (-483.427) * [-488.149] (-481.801) (-483.215) (-482.154) -- 0:00:14
702500 -- (-481.447) [-481.549] (-483.536) (-480.721) * (-486.397) [-482.569] (-485.990) (-484.329) -- 0:00:13
703000 -- (-483.277) (-481.734) (-482.845) [-480.608] * (-481.259) (-484.953) [-482.937] (-489.155) -- 0:00:13
703500 -- (-482.154) (-481.501) (-480.899) [-481.359] * (-481.582) (-483.353) (-481.514) [-481.866] -- 0:00:13
704000 -- (-484.177) [-486.650] (-481.443) (-481.508) * (-483.426) [-481.674] (-483.992) (-483.734) -- 0:00:13
704500 -- (-481.940) [-482.093] (-482.570) (-481.562) * (-483.104) (-482.975) (-483.764) [-486.973] -- 0:00:13
705000 -- (-486.473) [-480.516] (-484.875) (-486.989) * (-484.461) [-482.274] (-482.445) (-482.559) -- 0:00:13
Average standard deviation of split frequencies: 0.002671
705500 -- (-482.763) [-481.212] (-481.154) (-484.711) * [-482.123] (-483.176) (-487.283) (-486.540) -- 0:00:13
706000 -- (-482.773) (-485.681) [-483.071] (-482.986) * [-484.826] (-482.098) (-484.304) (-484.142) -- 0:00:13
706500 -- (-482.551) (-485.991) (-486.007) [-482.184] * (-483.422) [-481.746] (-485.317) (-484.050) -- 0:00:13
707000 -- (-483.855) [-483.590] (-486.815) (-481.776) * (-483.008) (-481.998) (-483.686) [-480.803] -- 0:00:13
707500 -- (-481.952) [-481.086] (-480.974) (-482.594) * (-481.212) (-481.169) [-483.176] (-484.174) -- 0:00:13
708000 -- (-480.753) (-482.741) [-486.034] (-484.624) * (-485.103) (-481.591) [-483.817] (-484.243) -- 0:00:13
708500 -- (-481.247) (-484.583) (-483.005) [-484.838] * (-484.152) (-483.114) (-481.001) [-480.945] -- 0:00:13
709000 -- (-483.508) (-482.367) (-482.639) [-481.056] * (-484.433) (-481.649) (-484.275) [-481.492] -- 0:00:13
709500 -- (-484.302) (-481.238) (-484.375) [-483.482] * [-486.421] (-482.230) (-482.544) (-482.169) -- 0:00:13
710000 -- (-485.137) [-482.134] (-481.889) (-481.868) * (-484.848) [-481.603] (-481.219) (-483.805) -- 0:00:13
Average standard deviation of split frequencies: 0.002653
710500 -- (-481.008) [-480.743] (-481.646) (-486.811) * (-483.107) (-482.733) [-482.641] (-482.471) -- 0:00:13
711000 -- (-484.642) [-482.080] (-483.803) (-485.126) * (-485.479) (-482.868) (-482.811) [-481.077] -- 0:00:13
711500 -- [-481.747] (-481.479) (-483.461) (-483.413) * (-483.532) (-482.859) (-482.165) [-485.260] -- 0:00:13
712000 -- (-483.792) [-485.854] (-484.380) (-482.377) * [-483.441] (-481.877) (-483.716) (-484.273) -- 0:00:13
712500 -- (-481.913) (-481.007) [-481.384] (-481.127) * [-482.661] (-486.288) (-485.249) (-480.668) -- 0:00:13
713000 -- (-482.699) [-484.959] (-482.485) (-481.841) * (-485.828) [-480.843] (-481.932) (-482.605) -- 0:00:13
713500 -- (-484.338) (-483.873) [-485.788] (-482.113) * [-480.927] (-483.913) (-482.797) (-483.246) -- 0:00:13
714000 -- (-484.341) [-482.145] (-486.978) (-483.117) * [-483.457] (-483.077) (-481.186) (-481.072) -- 0:00:13
714500 -- (-483.468) [-481.923] (-483.041) (-489.537) * [-483.846] (-481.460) (-482.390) (-482.041) -- 0:00:13
715000 -- (-483.431) (-482.517) [-486.304] (-485.542) * [-483.603] (-482.654) (-481.846) (-483.091) -- 0:00:13
Average standard deviation of split frequencies: 0.003511
715500 -- [-481.296] (-482.556) (-482.429) (-482.574) * [-484.009] (-482.359) (-480.982) (-483.367) -- 0:00:13
716000 -- [-484.156] (-481.497) (-484.540) (-481.947) * (-482.231) (-484.814) (-482.361) [-483.216] -- 0:00:13
716500 -- (-484.371) (-481.424) (-481.483) [-482.187] * (-486.028) (-483.605) (-482.457) [-482.301] -- 0:00:13
717000 -- (-483.648) (-482.761) (-493.076) [-482.692] * [-487.079] (-487.881) (-482.113) (-482.164) -- 0:00:13
717500 -- [-481.793] (-484.680) (-482.843) (-484.157) * (-481.228) (-481.579) (-485.711) [-481.032] -- 0:00:12
718000 -- (-483.690) (-485.341) [-480.649] (-483.887) * [-483.539] (-481.907) (-481.272) (-483.957) -- 0:00:12
718500 -- (-487.794) (-484.774) (-484.736) [-481.837] * (-485.582) (-483.621) [-481.133] (-481.758) -- 0:00:13
719000 -- (-484.406) [-482.769] (-482.797) (-482.584) * (-486.577) (-482.642) [-481.792] (-485.453) -- 0:00:13
719500 -- (-485.562) (-484.382) (-482.389) [-483.802] * (-481.980) (-482.864) (-482.878) [-483.848] -- 0:00:13
720000 -- (-481.576) (-484.528) [-483.409] (-483.361) * (-480.768) [-481.073] (-482.951) (-484.543) -- 0:00:13
Average standard deviation of split frequencies: 0.003925
720500 -- (-481.190) (-483.205) (-483.640) [-481.798] * [-482.139] (-485.574) (-481.666) (-483.976) -- 0:00:13
721000 -- (-482.516) [-482.126] (-483.138) (-481.607) * (-481.966) [-481.090] (-482.082) (-486.720) -- 0:00:13
721500 -- [-482.365] (-482.280) (-481.183) (-483.055) * (-485.582) (-482.432) [-486.538] (-483.648) -- 0:00:13
722000 -- [-488.680] (-483.456) (-481.791) (-482.028) * (-483.839) (-482.112) [-483.220] (-482.092) -- 0:00:13
722500 -- [-481.428] (-483.585) (-484.176) (-482.166) * (-486.839) (-484.037) [-482.722] (-484.792) -- 0:00:13
723000 -- (-484.579) (-483.601) [-483.757] (-482.207) * (-483.312) (-482.114) (-482.522) [-483.437] -- 0:00:13
723500 -- [-483.512] (-483.022) (-484.310) (-485.418) * (-482.567) (-482.357) (-486.382) [-484.997] -- 0:00:12
724000 -- [-485.183] (-482.042) (-488.761) (-486.808) * (-482.082) [-482.884] (-482.396) (-485.930) -- 0:00:12
724500 -- (-485.541) [-481.739] (-481.049) (-487.181) * (-486.652) (-481.860) [-484.967] (-481.367) -- 0:00:12
725000 -- (-484.183) [-481.545] (-482.507) (-486.622) * [-482.389] (-484.515) (-482.085) (-482.470) -- 0:00:12
Average standard deviation of split frequencies: 0.006060
725500 -- (-482.710) [-485.795] (-483.590) (-485.789) * (-483.694) [-481.347] (-482.550) (-485.027) -- 0:00:12
726000 -- (-485.154) [-481.003] (-482.362) (-483.775) * (-481.511) [-481.995] (-482.043) (-483.639) -- 0:00:12
726500 -- [-481.594] (-483.493) (-483.560) (-481.626) * (-485.146) (-482.489) (-482.461) [-480.538] -- 0:00:12
727000 -- [-481.901] (-481.348) (-482.562) (-480.675) * (-481.283) (-481.908) (-483.202) [-481.180] -- 0:00:12
727500 -- (-482.842) (-480.827) (-481.458) [-481.372] * (-482.765) [-485.108] (-481.483) (-480.654) -- 0:00:12
728000 -- (-483.149) [-482.664] (-485.740) (-481.996) * [-481.837] (-485.609) (-484.008) (-485.102) -- 0:00:12
728500 -- (-482.572) (-484.386) (-484.369) [-482.236] * [-480.798] (-484.215) (-484.014) (-481.620) -- 0:00:12
729000 -- (-481.058) (-482.798) [-481.728] (-482.892) * [-483.325] (-481.891) (-483.732) (-482.369) -- 0:00:12
729500 -- [-482.043] (-482.813) (-482.046) (-481.591) * [-482.679] (-481.296) (-483.222) (-482.949) -- 0:00:12
730000 -- (-484.212) (-483.486) (-482.471) [-483.095] * (-483.358) [-481.697] (-483.417) (-482.903) -- 0:00:12
Average standard deviation of split frequencies: 0.004731
730500 -- (-483.955) (-481.828) [-481.619] (-482.409) * (-483.861) [-482.637] (-482.399) (-482.342) -- 0:00:12
731000 -- [-481.238] (-485.468) (-482.793) (-482.432) * [-483.368] (-483.527) (-482.068) (-481.158) -- 0:00:12
731500 -- (-482.081) (-485.318) (-480.424) [-483.232] * [-483.368] (-482.754) (-482.076) (-482.951) -- 0:00:12
732000 -- (-480.952) (-484.636) (-483.175) [-480.577] * (-483.349) [-481.151] (-483.477) (-480.369) -- 0:00:12
732500 -- [-481.014] (-483.513) (-481.788) (-481.670) * (-483.031) [-482.213] (-483.209) (-481.279) -- 0:00:12
733000 -- (-481.548) (-482.739) [-481.924] (-483.181) * [-481.131] (-480.775) (-484.000) (-482.098) -- 0:00:12
733500 -- (-483.859) (-483.092) (-484.570) [-480.832] * (-481.180) (-482.732) (-481.779) [-482.595] -- 0:00:12
734000 -- (-482.680) [-482.414] (-481.474) (-482.526) * (-481.927) [-482.646] (-492.236) (-483.219) -- 0:00:12
734500 -- (-483.280) [-482.012] (-482.222) (-483.480) * (-482.802) (-481.701) [-480.751] (-481.621) -- 0:00:12
735000 -- (-481.552) (-482.547) [-482.484] (-486.079) * (-482.501) (-483.090) (-484.300) [-480.338] -- 0:00:12
Average standard deviation of split frequencies: 0.004270
735500 -- (-482.273) [-484.675] (-483.847) (-482.623) * [-483.993] (-481.035) (-483.942) (-482.021) -- 0:00:12
736000 -- [-480.834] (-481.762) (-484.986) (-481.726) * (-483.686) (-482.926) [-484.824] (-480.538) -- 0:00:12
736500 -- (-483.405) [-484.441] (-486.117) (-480.766) * (-483.345) [-481.764] (-486.204) (-480.976) -- 0:00:12
737000 -- (-483.208) (-482.140) [-483.450] (-488.687) * [-484.109] (-482.179) (-485.516) (-485.236) -- 0:00:12
737500 -- (-481.683) (-481.626) [-481.323] (-483.190) * (-484.134) [-481.670] (-491.689) (-483.077) -- 0:00:12
738000 -- [-481.482] (-482.267) (-483.389) (-481.116) * (-483.075) [-483.854] (-484.435) (-482.618) -- 0:00:12
738500 -- (-484.973) (-480.562) [-481.624] (-481.947) * (-486.522) [-482.548] (-480.776) (-481.851) -- 0:00:12
739000 -- (-483.818) (-483.664) (-487.006) [-480.656] * (-487.311) (-481.018) (-482.109) [-482.999] -- 0:00:12
739500 -- (-482.888) (-484.407) [-482.499] (-485.082) * (-482.219) (-480.852) (-482.483) [-480.858] -- 0:00:11
740000 -- (-482.113) [-482.653] (-480.998) (-481.957) * (-483.828) (-484.729) [-482.513] (-481.747) -- 0:00:11
Average standard deviation of split frequencies: 0.004243
740500 -- (-480.800) [-481.956] (-481.819) (-483.331) * (-484.684) (-482.909) (-481.851) [-484.373] -- 0:00:12
741000 -- (-482.213) (-488.221) (-485.121) [-482.773] * (-481.226) (-483.912) (-483.878) [-481.657] -- 0:00:12
741500 -- (-480.776) (-481.111) (-483.811) [-481.446] * (-480.300) (-481.606) [-484.327] (-481.449) -- 0:00:12
742000 -- (-481.773) [-483.241] (-484.780) (-482.257) * [-481.790] (-481.288) (-486.698) (-480.873) -- 0:00:12
742500 -- [-482.770] (-487.812) (-482.654) (-481.071) * (-481.890) (-484.167) [-483.765] (-483.182) -- 0:00:12
743000 -- (-480.371) [-481.808] (-484.479) (-485.900) * (-482.042) [-482.143] (-483.289) (-483.070) -- 0:00:12
743500 -- [-483.424] (-489.961) (-486.825) (-482.336) * (-481.513) (-482.536) (-483.057) [-481.307] -- 0:00:12
744000 -- (-484.531) (-484.595) (-483.308) [-482.927] * (-483.830) (-480.866) [-480.695] (-484.110) -- 0:00:12
744500 -- (-481.896) [-482.780] (-483.600) (-480.855) * (-485.156) (-481.708) (-483.868) [-486.532] -- 0:00:12
745000 -- [-480.768] (-483.012) (-480.879) (-481.784) * (-484.734) [-480.629] (-481.227) (-481.458) -- 0:00:11
Average standard deviation of split frequencies: 0.004213
745500 -- (-481.884) (-482.380) (-484.690) [-481.651] * (-480.929) [-484.365] (-482.238) (-482.291) -- 0:00:11
746000 -- [-482.937] (-484.150) (-481.069) (-482.896) * (-481.537) (-488.179) [-485.740] (-481.736) -- 0:00:11
746500 -- (-485.623) (-480.981) [-488.299] (-481.124) * (-482.904) (-482.600) (-481.563) [-484.305] -- 0:00:11
747000 -- [-482.749] (-481.598) (-482.027) (-484.870) * (-485.017) (-483.213) [-481.423] (-484.846) -- 0:00:11
747500 -- (-484.139) (-483.799) [-482.530] (-482.071) * (-481.794) (-481.372) [-481.703] (-482.523) -- 0:00:11
748000 -- (-483.393) (-487.632) [-480.823] (-484.511) * (-483.037) [-486.826] (-481.881) (-481.187) -- 0:00:11
748500 -- [-481.512] (-482.620) (-486.501) (-482.970) * (-484.206) [-484.844] (-481.059) (-482.839) -- 0:00:11
749000 -- (-485.808) (-481.662) (-482.955) [-480.697] * (-484.795) [-481.246] (-483.963) (-481.458) -- 0:00:11
749500 -- (-481.984) (-482.717) [-481.971] (-484.297) * [-482.756] (-485.879) (-487.799) (-481.408) -- 0:00:11
750000 -- (-481.852) [-481.386] (-483.469) (-481.485) * (-482.804) (-483.375) (-483.813) [-481.745] -- 0:00:11
Average standard deviation of split frequencies: 0.003768
750500 -- [-480.549] (-481.282) (-484.333) (-480.834) * (-481.018) [-484.475] (-482.576) (-482.616) -- 0:00:11
751000 -- (-480.986) [-482.172] (-484.505) (-480.987) * (-483.053) (-482.234) [-484.829] (-484.926) -- 0:00:11
751500 -- [-481.800] (-484.341) (-484.451) (-484.330) * (-485.790) (-483.565) (-480.917) [-481.751] -- 0:00:11
752000 -- (-481.689) [-481.596] (-483.070) (-482.381) * (-483.163) (-484.231) (-481.530) [-487.489] -- 0:00:11
752500 -- (-480.833) [-481.909] (-480.906) (-481.080) * (-482.318) [-480.546] (-482.650) (-480.244) -- 0:00:11
753000 -- (-482.394) (-482.724) [-481.958] (-481.712) * [-481.053] (-480.845) (-483.470) (-483.473) -- 0:00:11
753500 -- (-483.342) (-486.253) (-483.188) [-484.027] * [-481.335] (-480.363) (-481.579) (-480.768) -- 0:00:11
754000 -- [-483.835] (-480.780) (-482.877) (-481.114) * (-481.720) [-481.468] (-484.306) (-487.009) -- 0:00:11
754500 -- (-483.247) (-482.082) [-481.988] (-484.932) * (-480.480) [-484.214] (-482.707) (-483.294) -- 0:00:11
755000 -- [-486.057] (-481.814) (-480.684) (-482.820) * (-487.889) (-484.094) [-482.357] (-483.400) -- 0:00:11
Average standard deviation of split frequencies: 0.004157
755500 -- [-486.578] (-482.457) (-482.233) (-483.676) * (-480.712) (-481.925) [-482.006] (-484.674) -- 0:00:11
756000 -- (-480.932) (-480.633) [-482.712] (-482.760) * [-481.574] (-483.167) (-482.386) (-480.489) -- 0:00:11
756500 -- [-482.351] (-484.470) (-482.995) (-482.426) * (-481.462) (-481.296) [-484.963] (-481.274) -- 0:00:11
757000 -- (-484.061) (-485.598) (-481.844) [-483.565] * (-481.492) (-481.319) [-484.682] (-483.220) -- 0:00:11
757500 -- (-480.673) (-483.943) [-484.273] (-481.471) * [-485.414] (-482.638) (-483.963) (-483.507) -- 0:00:11
758000 -- (-483.190) (-481.461) (-484.927) [-481.300] * [-486.335] (-483.504) (-484.417) (-482.497) -- 0:00:11
758500 -- [-481.290] (-482.422) (-486.805) (-482.904) * (-484.864) (-485.440) (-480.405) [-483.565] -- 0:00:11
759000 -- (-482.377) [-482.298] (-482.054) (-480.944) * [-483.290] (-481.057) (-480.487) (-481.574) -- 0:00:11
759500 -- (-483.622) [-481.682] (-484.168) (-481.088) * (-487.032) (-488.462) [-482.791] (-482.388) -- 0:00:11
760000 -- [-485.504] (-484.527) (-484.935) (-484.174) * [-483.997] (-484.959) (-485.546) (-483.077) -- 0:00:11
Average standard deviation of split frequencies: 0.003305
760500 -- (-481.816) (-484.096) (-482.377) [-485.414] * (-483.192) (-484.034) (-485.180) [-482.779] -- 0:00:11
761000 -- [-483.127] (-482.143) (-482.696) (-484.379) * (-482.763) (-481.193) (-483.230) [-482.422] -- 0:00:10
761500 -- (-482.815) (-483.135) [-481.108] (-483.340) * (-482.447) [-482.789] (-484.385) (-481.766) -- 0:00:10
762000 -- (-483.985) (-483.846) (-483.149) [-482.555] * (-485.279) (-489.284) [-484.489] (-483.718) -- 0:00:10
762500 -- (-480.635) (-483.163) (-480.395) [-481.067] * (-483.640) (-485.902) [-482.877] (-481.757) -- 0:00:11
763000 -- (-481.923) (-484.026) [-480.414] (-480.719) * (-481.861) (-483.485) (-482.636) [-484.868] -- 0:00:11
763500 -- (-481.841) (-482.541) [-481.520] (-480.716) * (-481.460) [-483.066] (-486.907) (-482.331) -- 0:00:11
764000 -- (-482.796) (-482.871) [-481.840] (-481.983) * (-482.536) (-483.110) (-480.956) [-481.623] -- 0:00:11
764500 -- (-481.574) [-480.437] (-482.475) (-483.693) * [-483.081] (-484.515) (-480.620) (-483.058) -- 0:00:11
765000 -- [-481.225] (-481.771) (-481.389) (-482.661) * (-481.126) (-481.781) [-483.381] (-482.073) -- 0:00:11
Average standard deviation of split frequencies: 0.002051
765500 -- (-484.122) (-482.008) [-481.435] (-486.379) * [-481.620] (-483.561) (-484.224) (-484.131) -- 0:00:11
766000 -- (-484.662) [-481.300] (-482.590) (-493.574) * (-483.065) (-484.450) [-481.708] (-485.738) -- 0:00:10
766500 -- (-482.810) (-480.774) (-485.700) [-481.614] * (-484.944) (-486.152) [-484.318] (-481.453) -- 0:00:10
767000 -- (-481.995) (-483.963) (-484.963) [-482.964] * [-482.391] (-482.916) (-481.570) (-481.382) -- 0:00:10
767500 -- (-480.938) (-483.384) [-483.522] (-482.302) * (-483.716) (-484.151) [-481.653] (-488.538) -- 0:00:10
768000 -- [-482.088] (-481.108) (-486.367) (-481.998) * (-481.712) (-483.591) (-483.479) [-483.610] -- 0:00:10
768500 -- (-480.728) (-482.799) [-482.790] (-481.468) * [-482.833] (-485.082) (-485.858) (-484.669) -- 0:00:10
769000 -- (-482.947) [-485.260] (-481.635) (-485.403) * (-483.495) (-480.943) (-486.003) [-482.225] -- 0:00:10
769500 -- (-482.136) [-483.104] (-482.194) (-483.804) * [-485.396] (-483.255) (-484.336) (-482.238) -- 0:00:10
770000 -- (-481.119) [-480.740] (-480.933) (-485.469) * (-482.269) [-481.944] (-486.250) (-484.146) -- 0:00:10
Average standard deviation of split frequencies: 0.002039
770500 -- (-482.755) [-482.192] (-484.146) (-481.970) * (-482.275) [-482.706] (-483.934) (-487.428) -- 0:00:10
771000 -- [-481.388] (-481.523) (-485.168) (-482.613) * (-484.242) [-481.464] (-485.278) (-484.238) -- 0:00:10
771500 -- (-483.812) [-486.810] (-482.308) (-485.141) * (-484.004) [-482.783] (-483.288) (-482.317) -- 0:00:10
772000 -- [-484.374] (-481.693) (-484.186) (-482.087) * (-481.145) (-480.596) [-481.719] (-484.724) -- 0:00:10
772500 -- (-484.092) [-482.043] (-482.865) (-484.981) * (-480.953) (-481.596) (-482.585) [-481.862] -- 0:00:10
773000 -- (-486.049) (-487.931) [-482.592] (-483.620) * (-484.288) (-483.420) [-485.242] (-481.996) -- 0:00:10
773500 -- (-482.470) (-482.588) (-483.389) [-483.588] * (-482.702) (-482.204) (-482.484) [-481.500] -- 0:00:10
774000 -- [-481.043] (-483.979) (-481.962) (-481.697) * [-483.248] (-482.062) (-483.209) (-481.758) -- 0:00:10
774500 -- (-482.672) (-482.933) (-480.421) [-482.395] * (-484.359) (-481.314) (-482.344) [-482.434] -- 0:00:10
775000 -- (-485.461) [-484.286] (-482.279) (-482.776) * (-483.529) [-481.770] (-482.548) (-487.376) -- 0:00:10
Average standard deviation of split frequencies: 0.002430
775500 -- (-484.227) (-482.834) (-480.796) [-481.842] * (-480.831) (-481.662) [-485.616] (-481.886) -- 0:00:10
776000 -- (-484.270) [-486.619] (-481.200) (-480.738) * [-481.315] (-481.198) (-485.198) (-482.202) -- 0:00:10
776500 -- (-484.263) [-481.741] (-481.467) (-482.233) * (-481.510) [-484.109] (-483.466) (-482.009) -- 0:00:10
777000 -- (-482.455) (-480.889) [-481.510] (-484.647) * (-481.015) (-486.225) (-484.712) [-483.976] -- 0:00:10
777500 -- (-482.643) (-483.150) (-481.227) [-483.601] * (-483.591) [-480.702] (-486.913) (-483.371) -- 0:00:10
778000 -- (-486.770) (-489.920) [-481.187] (-482.430) * (-481.851) (-481.066) (-489.094) [-481.916] -- 0:00:10
778500 -- (-481.181) (-480.901) [-480.466] (-484.422) * (-481.690) (-480.836) [-482.718] (-481.287) -- 0:00:10
779000 -- (-482.428) (-482.505) (-484.698) [-483.574] * (-483.143) (-480.288) (-483.862) [-482.337] -- 0:00:10
779500 -- (-482.187) (-482.866) (-485.067) [-482.596] * (-483.997) [-481.595] (-481.198) (-484.531) -- 0:00:10
780000 -- (-485.339) (-481.725) (-481.659) [-482.990] * (-484.253) (-482.094) [-483.278] (-485.030) -- 0:00:10
Average standard deviation of split frequencies: 0.004026
780500 -- (-482.580) (-487.441) [-481.241] (-483.187) * (-487.771) (-487.151) (-482.519) [-482.994] -- 0:00:10
781000 -- [-483.205] (-481.489) (-481.361) (-482.337) * (-482.006) (-481.096) [-484.157] (-484.966) -- 0:00:10
781500 -- (-482.195) (-484.784) (-483.772) [-482.425] * (-485.508) [-482.060] (-486.400) (-485.343) -- 0:00:10
782000 -- (-482.040) (-484.564) [-485.661] (-483.074) * (-486.466) (-485.158) [-483.546] (-481.267) -- 0:00:10
782500 -- (-482.837) [-484.065] (-485.725) (-480.690) * (-482.615) (-480.552) [-480.694] (-483.984) -- 0:00:10
783000 -- (-481.682) (-484.332) [-481.244] (-483.474) * (-485.651) (-482.706) [-486.329] (-483.799) -- 0:00:09
783500 -- (-488.323) [-480.632] (-484.840) (-482.966) * (-483.626) [-482.855] (-482.001) (-482.825) -- 0:00:09
784000 -- [-485.117] (-481.285) (-481.686) (-482.467) * (-484.976) (-481.118) (-481.914) [-481.088] -- 0:00:10
784500 -- [-483.304] (-482.680) (-481.981) (-483.277) * (-482.391) [-481.726] (-486.807) (-482.171) -- 0:00:10
785000 -- (-483.563) (-480.763) (-480.508) [-481.912] * (-482.265) [-485.094] (-483.692) (-484.969) -- 0:00:10
Average standard deviation of split frequencies: 0.003998
785500 -- (-484.079) (-485.729) (-481.906) [-480.977] * (-480.946) [-483.816] (-481.427) (-484.530) -- 0:00:10
786000 -- (-482.758) [-487.748] (-482.605) (-482.106) * [-488.302] (-482.460) (-483.531) (-483.545) -- 0:00:10
786500 -- (-482.883) [-485.650] (-481.277) (-487.671) * [-481.066] (-482.775) (-481.407) (-483.068) -- 0:00:10
787000 -- [-483.832] (-481.730) (-489.896) (-485.319) * (-482.757) (-486.387) [-481.390] (-481.589) -- 0:00:10
787500 -- (-484.092) (-480.916) [-482.099] (-487.875) * (-484.561) (-482.028) [-482.886] (-483.819) -- 0:00:09
788000 -- (-483.637) [-483.186] (-481.225) (-483.094) * (-482.297) (-484.980) [-482.707] (-483.693) -- 0:00:09
788500 -- (-483.017) (-483.919) (-481.972) [-482.620] * (-480.914) (-481.822) [-486.386] (-485.027) -- 0:00:09
789000 -- (-483.183) (-483.330) (-485.915) [-482.067] * (-481.315) [-481.294] (-487.171) (-483.469) -- 0:00:09
789500 -- (-490.684) [-483.426] (-485.006) (-480.999) * (-483.666) [-482.617] (-480.831) (-480.995) -- 0:00:09
790000 -- [-482.349] (-482.082) (-482.704) (-483.027) * (-483.236) (-488.241) (-483.605) [-480.654] -- 0:00:09
Average standard deviation of split frequencies: 0.004372
790500 -- (-481.325) (-481.467) (-482.269) [-483.666] * (-482.506) (-483.044) (-482.769) [-484.067] -- 0:00:09
791000 -- [-481.300] (-486.063) (-481.271) (-481.159) * [-484.552] (-482.687) (-483.339) (-482.706) -- 0:00:09
791500 -- (-483.309) (-484.777) (-481.994) [-480.835] * (-485.847) (-483.424) (-482.384) [-481.257] -- 0:00:09
792000 -- (-481.193) [-482.603] (-481.805) (-483.669) * (-482.230) (-481.364) (-482.167) [-481.426] -- 0:00:09
792500 -- (-482.706) [-484.629] (-483.716) (-485.026) * (-482.227) (-481.202) [-481.784] (-484.410) -- 0:00:09
793000 -- (-481.383) (-481.468) (-481.502) [-484.063] * [-480.924] (-481.508) (-487.037) (-482.862) -- 0:00:09
793500 -- [-484.420] (-484.505) (-482.371) (-487.560) * (-485.281) (-481.604) (-484.019) [-485.667] -- 0:00:09
794000 -- (-485.212) (-482.154) (-481.105) [-485.959] * [-482.741] (-483.885) (-486.139) (-483.457) -- 0:00:09
794500 -- (-485.994) (-483.518) (-482.633) [-485.020] * (-481.824) (-483.259) (-481.808) [-481.470] -- 0:00:09
795000 -- (-482.705) (-484.278) [-482.434] (-483.482) * (-482.104) (-483.713) (-485.318) [-480.915] -- 0:00:09
Average standard deviation of split frequencies: 0.005133
795500 -- (-482.812) (-484.189) [-482.018] (-483.674) * (-486.765) [-482.915] (-486.184) (-482.836) -- 0:00:09
796000 -- [-482.125] (-483.760) (-482.268) (-482.598) * (-481.031) (-481.433) [-484.571] (-481.977) -- 0:00:09
796500 -- [-481.260] (-482.792) (-480.851) (-484.441) * (-484.195) (-485.037) [-482.831] (-481.597) -- 0:00:09
797000 -- (-485.350) [-482.153] (-485.800) (-485.344) * (-482.961) (-482.632) [-482.647] (-482.644) -- 0:00:09
797500 -- (-483.804) [-483.736] (-481.881) (-483.544) * (-483.536) (-482.532) [-480.929] (-482.981) -- 0:00:09
798000 -- (-482.165) [-481.790] (-484.911) (-484.864) * (-484.279) (-483.129) [-481.971] (-483.227) -- 0:00:09
798500 -- [-482.057] (-484.399) (-482.339) (-481.553) * (-485.184) (-484.469) [-481.794] (-484.098) -- 0:00:09
799000 -- (-482.474) (-482.222) (-483.528) [-481.608] * [-483.912] (-484.658) (-482.609) (-481.695) -- 0:00:09
799500 -- (-483.275) (-482.619) (-482.317) [-482.334] * [-481.436] (-482.649) (-482.712) (-481.947) -- 0:00:09
800000 -- [-485.729] (-482.694) (-481.028) (-484.262) * [-485.272] (-480.616) (-487.946) (-482.082) -- 0:00:09
Average standard deviation of split frequencies: 0.004318
800500 -- (-484.356) (-480.481) [-483.239] (-481.645) * (-483.108) [-483.240] (-484.827) (-482.083) -- 0:00:09
801000 -- (-482.651) (-485.652) (-490.186) [-481.026] * [-481.654] (-481.952) (-483.926) (-481.927) -- 0:00:09
801500 -- (-487.687) (-482.456) [-483.224] (-483.456) * (-481.825) [-482.305] (-482.841) (-484.896) -- 0:00:09
802000 -- (-481.185) (-488.155) (-485.730) [-485.734] * (-483.333) (-481.801) [-482.197] (-482.858) -- 0:00:09
802500 -- (-485.905) [-483.800] (-485.574) (-481.054) * (-481.818) (-483.563) [-482.429] (-484.138) -- 0:00:09
803000 -- [-483.869] (-483.831) (-481.427) (-481.213) * [-482.523] (-481.048) (-482.032) (-483.428) -- 0:00:09
803500 -- (-484.060) (-484.517) [-482.758] (-483.561) * (-482.182) (-487.733) [-483.635] (-482.394) -- 0:00:09
804000 -- (-486.516) (-481.319) (-481.263) [-481.965] * (-484.219) [-482.985] (-482.831) (-483.984) -- 0:00:09
804500 -- (-485.459) (-481.476) [-483.637] (-480.931) * [-483.511] (-481.767) (-485.795) (-482.960) -- 0:00:08
805000 -- (-481.460) (-483.235) (-483.513) [-481.668] * [-481.710] (-482.044) (-486.580) (-482.119) -- 0:00:08
Average standard deviation of split frequencies: 0.003119
805500 -- (-481.410) (-481.578) (-482.577) [-480.995] * [-482.925] (-484.824) (-481.892) (-480.678) -- 0:00:08
806000 -- (-484.267) (-483.025) [-482.119] (-483.952) * (-482.416) (-482.542) [-482.830] (-481.015) -- 0:00:09
806500 -- [-481.061] (-483.759) (-481.656) (-482.067) * (-483.400) (-481.411) [-483.755] (-481.694) -- 0:00:09
807000 -- [-481.802] (-484.249) (-482.543) (-480.608) * [-482.353] (-482.378) (-482.422) (-484.760) -- 0:00:09
807500 -- (-481.664) (-482.522) [-485.401] (-482.531) * (-483.539) [-482.905] (-483.292) (-484.474) -- 0:00:09
808000 -- (-481.533) [-484.244] (-483.935) (-483.947) * (-482.362) (-486.392) [-481.630] (-484.157) -- 0:00:09
808500 -- (-482.528) (-486.396) [-484.598] (-481.294) * (-483.633) (-482.340) (-484.517) [-484.222] -- 0:00:09
809000 -- (-482.031) [-482.023] (-484.655) (-481.152) * (-481.672) (-480.951) [-485.061] (-485.510) -- 0:00:08
809500 -- (-482.283) [-483.448] (-482.501) (-482.942) * (-481.085) (-480.851) [-484.151] (-481.554) -- 0:00:08
810000 -- (-489.832) (-482.639) [-482.698] (-482.959) * (-484.787) [-482.368] (-481.732) (-482.137) -- 0:00:08
Average standard deviation of split frequencies: 0.001938
810500 -- (-483.499) (-481.548) (-487.116) [-481.969] * (-481.244) (-483.898) (-483.450) [-480.372] -- 0:00:08
811000 -- (-483.313) (-484.041) [-484.611] (-482.962) * (-482.750) [-482.825] (-481.101) (-482.266) -- 0:00:08
811500 -- (-481.889) (-481.685) (-480.731) [-483.526] * (-481.268) [-482.890] (-482.563) (-487.529) -- 0:00:08
812000 -- (-480.936) (-482.248) (-482.761) [-483.107] * [-480.466] (-484.094) (-481.969) (-489.041) -- 0:00:08
812500 -- [-484.576] (-486.364) (-482.555) (-481.977) * (-482.089) [-482.387] (-482.585) (-484.035) -- 0:00:08
813000 -- (-482.070) (-483.862) [-483.283] (-485.308) * [-483.498] (-481.878) (-482.974) (-483.351) -- 0:00:08
813500 -- (-482.701) (-483.530) (-482.679) [-483.657] * [-482.200] (-482.382) (-481.945) (-483.640) -- 0:00:08
814000 -- (-482.098) (-481.415) (-483.338) [-482.503] * (-484.766) (-482.253) (-481.645) [-483.809] -- 0:00:08
814500 -- (-483.856) (-482.284) (-481.914) [-483.702] * [-482.147] (-481.615) (-481.015) (-482.953) -- 0:00:08
815000 -- (-481.467) (-482.531) (-485.319) [-481.037] * (-481.850) [-481.161] (-486.257) (-483.144) -- 0:00:08
Average standard deviation of split frequencies: 0.001541
815500 -- [-481.170] (-481.937) (-484.086) (-482.374) * (-487.407) [-482.300] (-483.766) (-481.389) -- 0:00:08
816000 -- [-481.519] (-480.688) (-482.491) (-482.023) * (-481.321) (-484.363) (-484.569) [-482.428] -- 0:00:08
816500 -- (-483.256) (-483.126) [-480.975] (-482.355) * [-480.971] (-485.958) (-485.645) (-482.046) -- 0:00:08
817000 -- [-480.582] (-481.924) (-483.373) (-481.529) * (-483.567) [-483.411] (-486.488) (-482.988) -- 0:00:08
817500 -- (-480.987) (-481.679) (-481.064) [-481.389] * (-482.316) [-488.275] (-487.896) (-482.142) -- 0:00:08
818000 -- (-485.542) (-481.604) (-481.542) [-481.601] * (-481.281) (-486.765) [-483.531] (-481.781) -- 0:00:08
818500 -- (-481.520) [-485.625] (-481.556) (-481.133) * [-484.829] (-482.793) (-483.416) (-481.778) -- 0:00:08
819000 -- [-480.887] (-490.274) (-482.100) (-481.800) * [-482.076] (-481.501) (-486.652) (-481.050) -- 0:00:08
819500 -- (-481.873) (-491.480) (-482.772) [-481.808] * (-480.758) (-483.068) (-485.690) [-483.922] -- 0:00:08
820000 -- [-481.354] (-488.015) (-486.035) (-482.725) * (-481.571) (-483.485) [-482.552] (-481.738) -- 0:00:08
Average standard deviation of split frequencies: 0.000766
820500 -- (-486.633) (-482.101) (-486.139) [-482.965] * (-485.334) [-486.680] (-483.836) (-484.875) -- 0:00:08
821000 -- (-486.755) [-484.637] (-483.846) (-482.535) * (-489.168) (-487.747) (-482.197) [-485.050] -- 0:00:08
821500 -- [-481.127] (-482.466) (-485.195) (-482.240) * (-484.698) [-481.917] (-481.669) (-482.126) -- 0:00:08
822000 -- (-481.022) [-481.488] (-482.852) (-483.407) * [-482.727] (-484.726) (-482.337) (-481.020) -- 0:00:08
822500 -- (-481.985) [-481.737] (-486.286) (-484.084) * (-482.607) (-482.094) (-484.845) [-480.879] -- 0:00:08
823000 -- (-483.761) (-483.559) (-482.043) [-483.943] * (-481.667) [-481.863] (-481.784) (-482.738) -- 0:00:08
823500 -- [-480.641] (-483.388) (-482.976) (-482.106) * (-486.495) (-481.955) [-481.672] (-485.690) -- 0:00:08
824000 -- [-481.214] (-483.341) (-481.676) (-482.883) * (-483.084) [-486.057] (-482.358) (-481.402) -- 0:00:08
824500 -- (-484.233) [-481.696] (-480.610) (-483.987) * (-486.670) (-482.786) [-480.544] (-484.180) -- 0:00:08
825000 -- [-482.517] (-482.179) (-481.661) (-482.684) * (-482.664) (-482.562) (-484.446) [-482.242] -- 0:00:08
Average standard deviation of split frequencies: 0.001902
825500 -- [-482.444] (-484.042) (-482.128) (-482.531) * (-482.623) (-486.888) [-484.244] (-482.241) -- 0:00:08
826000 -- (-486.094) [-481.926] (-481.747) (-483.178) * (-481.358) (-482.710) (-482.896) [-481.651] -- 0:00:08
826500 -- (-486.395) [-481.948] (-481.946) (-482.162) * (-480.983) [-485.362] (-480.721) (-481.257) -- 0:00:07
827000 -- (-482.306) (-483.044) (-481.408) [-482.846] * [-482.674] (-480.900) (-484.435) (-482.372) -- 0:00:07
827500 -- (-484.936) [-481.395] (-480.945) (-482.343) * (-481.788) (-482.146) (-482.291) [-482.472] -- 0:00:07
828000 -- [-481.806] (-481.397) (-481.570) (-481.288) * [-480.979] (-483.809) (-483.249) (-482.674) -- 0:00:07
828500 -- (-483.334) (-482.121) (-483.451) [-480.894] * (-484.543) (-484.935) [-482.483] (-482.497) -- 0:00:08
829000 -- (-486.557) [-481.234] (-483.147) (-480.999) * (-481.915) (-483.622) [-484.243] (-483.607) -- 0:00:08
829500 -- (-481.645) (-485.219) [-483.928] (-483.359) * (-482.391) [-481.794] (-482.849) (-480.744) -- 0:00:08
830000 -- (-483.990) [-484.778] (-483.082) (-484.943) * (-481.505) (-481.472) (-483.571) [-481.405] -- 0:00:07
Average standard deviation of split frequencies: 0.001513
830500 -- [-481.970] (-485.812) (-480.717) (-482.074) * (-482.381) [-482.149] (-482.396) (-483.213) -- 0:00:07
831000 -- [-481.214] (-484.545) (-482.532) (-481.366) * (-481.912) (-484.077) [-481.945] (-480.791) -- 0:00:07
831500 -- (-480.643) (-482.229) [-480.650] (-480.743) * (-485.556) (-480.421) [-481.332] (-482.136) -- 0:00:07
832000 -- [-484.927] (-484.165) (-481.811) (-482.240) * (-483.475) (-482.212) (-483.475) [-482.615] -- 0:00:07
832500 -- (-482.569) (-482.440) [-484.153] (-481.473) * [-486.677] (-482.210) (-481.309) (-482.153) -- 0:00:07
833000 -- (-486.073) (-481.935) [-480.404] (-482.528) * [-487.343] (-481.072) (-483.926) (-482.222) -- 0:00:07
833500 -- (-484.471) [-481.112] (-482.487) (-482.288) * [-483.306] (-484.674) (-481.933) (-485.064) -- 0:00:07
834000 -- (-483.738) (-480.866) (-481.289) [-484.388] * (-482.380) [-482.741] (-480.368) (-486.552) -- 0:00:07
834500 -- [-482.563] (-482.995) (-484.253) (-484.348) * [-482.314] (-481.737) (-484.673) (-484.770) -- 0:00:07
835000 -- (-481.027) [-483.252] (-485.059) (-484.151) * (-480.960) [-482.604] (-482.779) (-482.511) -- 0:00:07
Average standard deviation of split frequencies: 0.001128
835500 -- (-481.315) (-482.411) [-481.295] (-482.871) * (-482.504) [-482.572] (-487.395) (-482.105) -- 0:00:07
836000 -- (-490.956) (-483.900) [-482.607] (-482.789) * (-483.915) (-484.177) [-485.846] (-483.609) -- 0:00:07
836500 -- (-486.435) (-483.225) (-482.572) [-481.161] * (-483.395) (-480.591) [-483.067] (-480.877) -- 0:00:07
837000 -- (-482.132) (-482.355) [-482.703] (-482.047) * (-481.839) (-480.987) [-482.429] (-482.293) -- 0:00:07
837500 -- (-481.060) (-482.527) (-490.105) [-482.819] * (-489.131) (-482.736) (-480.363) [-481.801] -- 0:00:07
838000 -- (-481.234) (-483.236) [-481.087] (-481.318) * [-484.062] (-483.034) (-482.501) (-481.899) -- 0:00:07
838500 -- (-481.396) (-481.756) [-484.937] (-483.859) * (-480.576) [-482.212] (-486.302) (-487.960) -- 0:00:07
839000 -- (-481.458) (-484.431) [-480.698] (-483.794) * [-482.090] (-484.253) (-481.156) (-483.780) -- 0:00:07
839500 -- (-484.381) (-483.383) (-482.323) [-481.805] * (-486.249) [-482.174] (-481.680) (-482.225) -- 0:00:07
840000 -- (-481.350) (-484.350) (-480.988) [-482.648] * [-481.863] (-485.956) (-484.239) (-482.586) -- 0:00:07
Average standard deviation of split frequencies: 0.001122
840500 -- (-484.247) (-486.918) [-483.109] (-482.638) * [-483.852] (-486.925) (-487.285) (-484.048) -- 0:00:07
841000 -- (-482.058) (-486.954) (-483.391) [-484.670] * (-482.538) (-483.283) (-481.886) [-487.167] -- 0:00:07
841500 -- [-484.981] (-483.296) (-485.141) (-481.979) * [-484.342] (-482.109) (-482.055) (-484.731) -- 0:00:07
842000 -- (-484.177) [-481.889] (-486.440) (-482.394) * (-480.223) (-481.336) [-481.245] (-486.746) -- 0:00:07
842500 -- [-482.189] (-482.837) (-483.742) (-482.562) * (-481.744) (-480.832) [-482.566] (-482.969) -- 0:00:07
843000 -- [-483.061] (-483.091) (-484.009) (-483.694) * [-483.065] (-480.350) (-482.056) (-482.949) -- 0:00:07
843500 -- [-481.277] (-483.410) (-484.617) (-482.348) * [-481.900] (-483.120) (-484.681) (-483.858) -- 0:00:07
844000 -- [-481.689] (-480.868) (-482.028) (-482.069) * (-481.756) (-493.467) (-483.214) [-482.455] -- 0:00:07
844500 -- (-484.203) [-486.431] (-482.116) (-480.880) * (-481.864) (-482.493) [-482.326] (-486.210) -- 0:00:07
845000 -- (-482.848) (-481.733) [-480.533] (-480.672) * (-482.584) (-482.371) (-482.643) [-482.240] -- 0:00:07
Average standard deviation of split frequencies: 0.001857
845500 -- (-484.483) [-484.322] (-482.684) (-480.998) * (-485.631) (-480.913) (-485.819) [-481.252] -- 0:00:07
846000 -- [-481.652] (-481.313) (-483.360) (-483.518) * (-481.462) (-481.611) (-481.439) [-481.180] -- 0:00:07
846500 -- (-483.353) (-486.691) (-485.941) [-480.366] * (-484.036) [-481.987] (-481.703) (-482.249) -- 0:00:07
847000 -- (-484.420) (-482.480) (-482.904) [-481.958] * [-482.092] (-481.306) (-484.153) (-482.241) -- 0:00:07
847500 -- (-485.640) [-486.326] (-483.006) (-483.010) * (-481.898) [-481.927] (-485.140) (-481.904) -- 0:00:07
848000 -- [-481.246] (-480.991) (-483.933) (-486.701) * (-480.960) (-482.132) (-483.663) [-481.322] -- 0:00:06
848500 -- (-481.545) (-483.706) [-485.513] (-483.619) * [-480.918] (-482.831) (-481.234) (-482.162) -- 0:00:06
849000 -- (-484.066) (-482.675) (-486.523) [-480.951] * (-481.775) [-483.320] (-481.676) (-482.309) -- 0:00:06
849500 -- (-484.446) (-483.201) [-484.892] (-485.227) * [-484.073] (-486.962) (-484.138) (-483.236) -- 0:00:06
850000 -- (-482.260) [-480.956] (-483.548) (-485.722) * (-482.127) (-484.373) (-481.566) [-482.684] -- 0:00:06
Average standard deviation of split frequencies: 0.002217
850500 -- (-480.834) (-483.482) (-481.621) [-482.852] * (-485.126) (-480.506) [-481.248] (-481.851) -- 0:00:07
851000 -- (-480.586) [-483.929] (-485.630) (-482.081) * (-488.387) [-482.258] (-481.618) (-481.609) -- 0:00:07
851500 -- (-486.250) [-481.986] (-481.720) (-488.094) * (-481.658) (-484.620) (-485.141) [-481.209] -- 0:00:06
852000 -- (-483.317) [-482.528] (-486.240) (-481.728) * (-482.536) (-481.808) [-483.546] (-481.564) -- 0:00:06
852500 -- (-485.616) (-480.936) (-484.661) [-481.106] * (-486.722) [-481.056] (-485.831) (-483.497) -- 0:00:06
853000 -- (-484.748) [-482.598] (-484.098) (-486.136) * (-481.733) (-484.587) (-481.155) [-484.476] -- 0:00:06
853500 -- (-481.314) (-485.158) [-485.128] (-482.462) * [-481.275] (-482.033) (-482.083) (-484.405) -- 0:00:06
854000 -- [-484.433] (-482.328) (-485.034) (-485.290) * (-481.163) (-486.821) (-481.573) [-480.815] -- 0:00:06
854500 -- (-483.102) (-481.221) [-481.598] (-484.479) * [-480.739] (-486.059) (-484.220) (-484.005) -- 0:00:06
855000 -- (-485.616) (-483.431) [-483.470] (-484.618) * (-482.393) (-482.770) (-484.386) [-482.247] -- 0:00:06
Average standard deviation of split frequencies: 0.003671
855500 -- (-488.688) [-483.268] (-484.425) (-483.404) * (-481.268) (-483.871) (-488.154) [-485.881] -- 0:00:06
856000 -- (-483.829) (-480.757) (-485.203) [-482.513] * (-480.989) [-482.507] (-481.988) (-480.730) -- 0:00:06
856500 -- (-481.321) [-481.573] (-485.277) (-482.799) * (-482.298) [-484.980] (-483.065) (-481.712) -- 0:00:06
857000 -- (-481.277) (-482.976) [-482.965] (-482.904) * (-483.305) (-484.620) (-484.703) [-483.779] -- 0:00:06
857500 -- (-482.048) (-483.299) [-485.534] (-481.688) * [-482.774] (-485.554) (-481.695) (-486.571) -- 0:00:06
858000 -- (-480.922) (-482.143) [-481.902] (-485.782) * (-483.117) (-484.767) [-482.456] (-484.277) -- 0:00:06
858500 -- [-482.374] (-482.669) (-483.270) (-485.954) * (-482.839) (-481.305) (-483.132) [-481.620] -- 0:00:06
859000 -- (-481.997) [-480.960] (-482.242) (-482.938) * (-481.576) (-481.315) [-482.360] (-482.455) -- 0:00:06
859500 -- (-481.267) (-481.447) [-482.404] (-485.134) * (-484.936) (-482.695) [-482.271] (-481.300) -- 0:00:06
860000 -- (-480.445) (-480.502) (-482.731) [-482.304] * (-484.945) (-485.870) [-482.228] (-482.360) -- 0:00:06
Average standard deviation of split frequencies: 0.005477
860500 -- (-484.280) (-482.271) [-483.278] (-481.803) * [-482.261] (-482.396) (-481.840) (-485.479) -- 0:00:06
861000 -- [-481.359] (-483.123) (-482.048) (-484.551) * [-488.011] (-487.546) (-483.506) (-492.690) -- 0:00:06
861500 -- (-484.933) (-480.896) [-482.047] (-485.050) * [-481.511] (-485.390) (-482.263) (-481.195) -- 0:00:06
862000 -- (-486.050) (-483.024) [-485.609] (-483.100) * (-484.168) (-481.794) (-484.788) [-482.814] -- 0:00:06
862500 -- (-484.022) (-480.887) (-484.279) [-484.037] * (-483.278) [-483.378] (-482.465) (-480.556) -- 0:00:06
863000 -- (-486.766) [-482.999] (-481.349) (-491.529) * (-484.135) (-483.858) [-484.122] (-483.345) -- 0:00:06
863500 -- (-484.783) [-482.455] (-481.203) (-484.755) * (-483.620) [-481.155] (-487.056) (-481.753) -- 0:00:06
864000 -- (-482.013) (-486.976) (-481.944) [-486.758] * (-483.176) [-482.885] (-484.982) (-483.103) -- 0:00:06
864500 -- (-482.176) (-483.502) (-483.475) [-486.383] * (-481.909) (-483.396) [-487.932] (-480.601) -- 0:00:06
865000 -- [-484.767] (-484.037) (-483.760) (-486.194) * (-482.224) (-483.088) [-481.877] (-480.816) -- 0:00:06
Average standard deviation of split frequencies: 0.005443
865500 -- (-482.294) (-484.103) (-484.190) [-483.907] * (-481.602) (-482.740) (-483.037) [-483.252] -- 0:00:06
866000 -- [-482.027] (-482.866) (-482.438) (-482.091) * (-484.066) [-481.509] (-483.876) (-480.624) -- 0:00:06
866500 -- [-483.854] (-483.568) (-483.072) (-482.469) * (-484.255) (-483.672) [-480.918] (-483.553) -- 0:00:06
867000 -- [-484.702] (-487.707) (-485.656) (-481.811) * (-480.878) (-482.292) [-480.833] (-484.329) -- 0:00:06
867500 -- (-482.781) [-481.808] (-482.338) (-481.890) * (-480.770) (-483.597) [-480.458] (-484.179) -- 0:00:06
868000 -- [-483.862] (-483.889) (-481.383) (-484.536) * (-481.703) (-482.366) (-484.164) [-482.387] -- 0:00:06
868500 -- [-489.927] (-484.044) (-482.870) (-482.556) * (-482.399) (-483.374) [-481.653] (-482.681) -- 0:00:06
869000 -- (-481.139) (-480.934) (-487.971) [-482.918] * (-481.821) [-481.264] (-481.652) (-483.589) -- 0:00:06
869500 -- (-484.160) [-483.688] (-480.344) (-482.578) * (-481.587) [-484.712] (-482.609) (-483.737) -- 0:00:06
870000 -- [-483.341] (-482.216) (-485.141) (-484.115) * (-481.257) (-488.370) (-483.138) [-481.790] -- 0:00:05
Average standard deviation of split frequencies: 0.006858
870500 -- [-480.987] (-481.722) (-481.166) (-482.637) * (-483.788) (-483.175) (-482.988) [-481.821] -- 0:00:05
871000 -- (-484.771) [-483.004] (-483.238) (-481.017) * (-481.578) (-484.959) [-482.699] (-480.686) -- 0:00:05
871500 -- (-481.498) (-481.409) (-482.976) [-481.854] * (-480.631) (-485.651) (-485.777) [-485.653] -- 0:00:06
872000 -- (-481.328) (-480.859) [-481.230] (-482.859) * (-483.545) [-482.621] (-483.822) (-482.128) -- 0:00:06
872500 -- [-481.767] (-486.049) (-484.950) (-480.982) * (-484.486) (-481.294) [-481.048] (-481.712) -- 0:00:05
873000 -- [-481.145] (-495.707) (-481.555) (-484.738) * [-485.206] (-484.417) (-482.727) (-485.828) -- 0:00:05
873500 -- (-482.882) (-492.284) (-483.655) [-484.150] * (-482.868) (-483.251) (-483.365) [-484.139] -- 0:00:05
874000 -- [-483.150] (-483.841) (-481.744) (-481.319) * [-482.018] (-480.729) (-484.777) (-482.081) -- 0:00:05
874500 -- (-480.705) (-481.973) (-482.442) [-483.526] * (-480.595) (-485.225) [-481.704] (-484.309) -- 0:00:05
875000 -- (-481.906) (-484.467) [-483.987] (-484.005) * (-483.908) (-482.532) [-481.423] (-480.947) -- 0:00:05
Average standard deviation of split frequencies: 0.007893
875500 -- (-483.965) [-483.538] (-483.996) (-481.813) * (-481.838) (-481.342) [-482.609] (-484.360) -- 0:00:05
876000 -- (-488.068) (-482.234) (-482.041) [-481.885] * (-482.433) (-487.799) [-481.128] (-485.413) -- 0:00:05
876500 -- (-483.187) (-481.010) [-482.294] (-481.783) * (-482.912) (-481.262) [-482.220] (-483.962) -- 0:00:05
877000 -- (-483.018) (-481.056) [-483.369] (-481.313) * (-481.414) (-480.850) (-484.053) [-482.175] -- 0:00:05
877500 -- (-480.456) [-482.000] (-482.196) (-481.285) * (-483.767) (-485.735) [-481.217] (-481.259) -- 0:00:05
878000 -- [-481.355] (-484.027) (-482.335) (-481.379) * [-481.934] (-481.701) (-484.760) (-484.390) -- 0:00:05
878500 -- (-493.176) (-480.723) (-482.528) [-481.554] * (-482.296) (-480.676) [-482.818] (-481.853) -- 0:00:05
879000 -- (-485.078) (-481.370) [-481.039] (-482.873) * [-481.014] (-484.377) (-484.503) (-486.043) -- 0:00:05
879500 -- (-487.084) (-482.353) (-483.871) [-485.959] * (-480.619) (-481.387) (-484.705) [-483.535] -- 0:00:05
880000 -- [-481.739] (-481.871) (-483.992) (-481.925) * (-482.013) [-484.880] (-482.454) (-482.831) -- 0:00:05
Average standard deviation of split frequencies: 0.008565
880500 -- (-486.728) (-484.843) [-486.485] (-482.287) * (-482.975) (-483.844) [-482.606] (-483.816) -- 0:00:05
881000 -- (-484.526) (-483.805) [-482.026] (-483.380) * [-481.638] (-481.193) (-482.789) (-481.761) -- 0:00:05
881500 -- (-484.809) (-482.926) (-485.062) [-483.910] * (-482.314) (-481.269) (-484.155) [-482.138] -- 0:00:05
882000 -- [-482.750] (-486.034) (-482.846) (-481.690) * (-480.422) [-482.304] (-483.011) (-481.865) -- 0:00:05
882500 -- (-481.317) (-487.179) (-483.076) [-483.093] * (-481.574) (-482.710) (-482.627) [-483.076] -- 0:00:05
883000 -- (-482.708) (-481.792) [-484.297] (-482.387) * (-480.487) (-481.465) (-487.987) [-483.175] -- 0:00:05
883500 -- (-484.806) [-483.742] (-481.496) (-482.765) * [-480.951] (-485.578) (-481.902) (-485.595) -- 0:00:05
884000 -- (-482.013) (-481.451) (-483.734) [-482.783] * [-483.307] (-485.767) (-481.239) (-481.133) -- 0:00:05
884500 -- [-484.261] (-481.478) (-480.969) (-480.733) * (-482.041) (-485.794) [-484.087] (-484.375) -- 0:00:05
885000 -- (-482.235) (-483.785) (-482.689) [-481.734] * (-482.552) (-484.312) [-481.652] (-483.141) -- 0:00:05
Average standard deviation of split frequencies: 0.008513
885500 -- (-485.655) (-485.779) (-485.704) [-482.320] * [-482.917] (-480.547) (-481.492) (-481.753) -- 0:00:05
886000 -- [-483.663] (-484.778) (-482.601) (-488.289) * (-481.130) [-482.794] (-483.906) (-483.678) -- 0:00:05
886500 -- (-482.153) (-484.681) [-483.086] (-483.103) * (-481.801) [-482.038] (-482.282) (-484.011) -- 0:00:05
887000 -- [-482.668] (-485.880) (-481.464) (-481.477) * [-482.011] (-480.869) (-484.395) (-484.365) -- 0:00:05
887500 -- (-482.835) (-482.962) [-484.063] (-483.855) * (-481.463) [-480.910] (-484.459) (-483.647) -- 0:00:05
888000 -- (-482.753) (-483.244) (-489.336) [-484.294] * (-480.580) (-480.931) [-481.283] (-481.539) -- 0:00:05
888500 -- (-481.786) [-483.158] (-487.007) (-485.383) * (-481.907) (-481.543) (-486.422) [-483.026] -- 0:00:05
889000 -- (-482.830) (-482.839) [-481.136] (-484.774) * [-483.468] (-480.842) (-487.131) (-486.199) -- 0:00:05
889500 -- [-483.080] (-484.937) (-483.546) (-480.587) * (-481.125) (-481.143) [-484.406] (-483.266) -- 0:00:05
890000 -- (-482.686) (-482.242) [-484.644] (-482.933) * [-482.223] (-482.842) (-484.903) (-482.516) -- 0:00:05
Average standard deviation of split frequencies: 0.008468
890500 -- (-481.890) (-484.902) (-483.806) [-482.990] * (-482.550) [-480.661] (-483.469) (-486.390) -- 0:00:05
891000 -- [-482.697] (-481.974) (-481.406) (-483.528) * (-481.270) (-481.298) (-484.879) [-483.381] -- 0:00:05
891500 -- (-480.965) (-482.133) [-482.591] (-483.250) * (-480.776) (-482.843) (-485.602) [-482.096] -- 0:00:04
892000 -- [-481.848] (-483.948) (-483.521) (-486.627) * (-485.107) (-483.681) [-481.311] (-482.945) -- 0:00:04
892500 -- [-482.217] (-483.221) (-481.447) (-485.560) * (-481.891) (-480.785) (-483.134) [-482.304] -- 0:00:04
893000 -- (-483.421) (-485.639) [-481.196] (-480.639) * (-484.860) (-483.045) (-482.518) [-481.096] -- 0:00:04
893500 -- [-481.772] (-489.855) (-482.509) (-483.986) * (-485.356) (-481.732) [-483.880] (-483.239) -- 0:00:04
894000 -- (-486.165) (-483.943) [-482.451] (-483.165) * (-481.481) (-484.877) (-481.693) [-484.537] -- 0:00:04
894500 -- (-482.638) (-483.849) (-481.405) [-481.779] * (-485.404) [-484.404] (-481.573) (-486.633) -- 0:00:04
895000 -- (-483.090) [-481.282] (-482.715) (-483.460) * [-485.742] (-483.075) (-483.469) (-484.204) -- 0:00:04
Average standard deviation of split frequencies: 0.008769
895500 -- (-481.620) [-480.936] (-482.548) (-483.048) * (-482.159) [-485.435] (-486.058) (-484.598) -- 0:00:04
896000 -- (-482.162) [-482.181] (-483.668) (-482.842) * (-482.519) (-486.396) [-482.505] (-481.754) -- 0:00:04
896500 -- (-482.455) [-482.208] (-481.372) (-482.092) * [-483.196] (-484.736) (-485.498) (-482.518) -- 0:00:04
897000 -- (-482.293) (-486.737) [-481.661] (-486.005) * (-482.421) [-482.267] (-486.703) (-484.771) -- 0:00:04
897500 -- [-482.382] (-488.841) (-482.557) (-483.375) * (-480.820) (-486.845) (-484.460) [-483.831] -- 0:00:04
898000 -- [-485.346] (-481.751) (-485.219) (-483.663) * (-481.298) (-482.131) (-482.940) [-481.744] -- 0:00:04
898500 -- [-481.012] (-481.647) (-482.413) (-482.529) * [-481.547] (-488.699) (-483.570) (-481.396) -- 0:00:04
899000 -- (-483.018) [-483.996] (-483.940) (-487.285) * (-482.471) (-486.852) (-482.151) [-483.779] -- 0:00:04
899500 -- (-487.957) (-486.262) [-481.057] (-482.735) * (-481.937) [-481.094] (-481.266) (-482.083) -- 0:00:04
900000 -- (-485.385) [-484.636] (-482.178) (-484.408) * (-482.794) (-481.863) (-482.248) [-481.746] -- 0:00:04
Average standard deviation of split frequencies: 0.007676
900500 -- (-482.510) (-486.794) (-482.773) [-482.681] * [-485.479] (-482.394) (-482.510) (-480.910) -- 0:00:04
901000 -- (-482.601) (-483.612) [-482.557] (-483.906) * [-481.314] (-484.435) (-482.762) (-483.984) -- 0:00:04
901500 -- (-482.217) [-481.335] (-480.876) (-484.291) * (-484.655) [-485.608] (-482.734) (-488.514) -- 0:00:04
902000 -- (-484.864) (-486.807) [-482.723] (-481.288) * (-483.421) [-481.001] (-487.070) (-480.894) -- 0:00:04
902500 -- [-480.381] (-483.239) (-484.583) (-480.802) * (-482.980) (-480.845) [-483.119] (-481.824) -- 0:00:04
903000 -- (-481.920) (-482.589) [-484.362] (-481.312) * [-482.224] (-480.879) (-485.652) (-483.289) -- 0:00:04
903500 -- (-481.589) (-481.731) (-482.482) [-480.594] * [-482.674] (-481.217) (-483.575) (-483.786) -- 0:00:04
904000 -- (-482.645) [-482.879] (-481.570) (-483.606) * (-484.576) [-482.190] (-482.438) (-484.743) -- 0:00:04
904500 -- (-482.546) [-481.487] (-482.522) (-482.243) * (-481.871) [-485.250] (-482.298) (-481.932) -- 0:00:04
905000 -- (-482.382) [-482.256] (-484.741) (-482.246) * (-481.792) (-481.851) [-482.454] (-484.422) -- 0:00:04
Average standard deviation of split frequencies: 0.007631
905500 -- [-484.628] (-483.525) (-481.133) (-481.701) * (-484.958) (-481.258) [-483.871] (-483.267) -- 0:00:04
906000 -- (-482.741) [-481.187] (-481.889) (-482.821) * (-482.246) [-482.205] (-482.285) (-481.205) -- 0:00:04
906500 -- (-482.834) [-481.066] (-483.726) (-485.121) * (-485.464) (-484.231) (-486.615) [-483.888] -- 0:00:04
907000 -- [-483.237] (-489.162) (-483.276) (-482.763) * (-482.052) (-485.904) (-482.610) [-482.389] -- 0:00:04
907500 -- (-483.514) (-483.852) (-483.267) [-481.603] * [-483.050] (-484.404) (-480.485) (-480.923) -- 0:00:04
908000 -- [-483.320] (-484.414) (-482.532) (-484.365) * (-482.052) [-482.098] (-481.634) (-482.812) -- 0:00:04
908500 -- (-483.328) (-484.443) [-483.574] (-485.743) * [-482.694] (-485.676) (-482.355) (-481.715) -- 0:00:04
909000 -- (-481.644) [-481.826] (-484.955) (-488.072) * (-484.338) (-482.845) [-485.508] (-483.355) -- 0:00:04
909500 -- (-483.032) (-481.665) (-484.013) [-480.404] * [-485.457] (-482.157) (-484.944) (-482.891) -- 0:00:04
910000 -- (-480.628) (-483.451) [-483.734] (-483.408) * (-486.149) (-481.695) (-482.001) [-483.382] -- 0:00:04
Average standard deviation of split frequencies: 0.008627
910500 -- (-482.243) (-482.343) (-482.585) [-480.717] * [-485.511] (-482.590) (-480.869) (-480.736) -- 0:00:04
911000 -- (-482.066) (-488.320) (-482.594) [-483.703] * (-482.246) [-484.022] (-481.640) (-480.736) -- 0:00:04
911500 -- (-482.004) (-480.473) [-483.075] (-483.861) * [-489.661] (-484.958) (-482.813) (-485.552) -- 0:00:04
912000 -- [-483.046] (-482.124) (-483.423) (-481.338) * (-481.381) (-482.092) [-482.930] (-485.313) -- 0:00:04
912500 -- (-483.249) (-482.994) (-481.201) [-481.807] * (-484.934) (-484.288) [-483.403] (-483.012) -- 0:00:04
913000 -- [-483.819] (-482.583) (-481.137) (-482.205) * (-480.304) (-480.968) (-483.170) [-484.028] -- 0:00:04
913500 -- [-482.204] (-482.250) (-482.168) (-482.183) * (-480.381) [-481.361] (-481.423) (-482.431) -- 0:00:03
914000 -- (-485.682) (-482.661) (-482.951) [-483.978] * (-483.821) (-482.262) (-480.572) [-482.897] -- 0:00:03
914500 -- [-481.111] (-482.079) (-483.026) (-482.259) * (-483.057) (-482.160) [-480.739] (-483.369) -- 0:00:03
915000 -- (-482.668) [-482.186] (-483.300) (-482.147) * (-482.366) [-481.566] (-481.081) (-481.174) -- 0:00:03
Average standard deviation of split frequencies: 0.008920
915500 -- [-484.773] (-480.701) (-485.833) (-484.945) * (-485.047) (-481.284) (-480.405) [-481.286] -- 0:00:03
916000 -- (-481.926) (-481.163) [-480.632] (-481.817) * (-484.964) [-482.755] (-480.749) (-481.779) -- 0:00:03
916500 -- (-481.388) [-481.516] (-481.073) (-483.687) * [-482.344] (-484.804) (-481.809) (-482.577) -- 0:00:03
917000 -- (-488.183) [-486.255] (-491.289) (-481.813) * [-484.406] (-486.293) (-481.297) (-481.936) -- 0:00:03
917500 -- (-486.412) (-484.193) [-481.596] (-484.514) * [-482.389] (-481.360) (-483.011) (-482.599) -- 0:00:03
918000 -- (-484.004) [-482.501] (-481.086) (-484.227) * (-483.701) (-480.596) (-483.087) [-482.603] -- 0:00:03
918500 -- [-483.301] (-481.023) (-481.012) (-482.575) * [-482.347] (-481.020) (-483.625) (-489.446) -- 0:00:03
919000 -- (-483.038) (-483.104) [-482.218] (-480.652) * (-484.526) [-480.837] (-484.095) (-482.327) -- 0:00:03
919500 -- (-483.016) [-482.356] (-482.733) (-489.802) * (-481.288) [-481.071] (-481.783) (-482.848) -- 0:00:03
920000 -- (-480.963) [-480.587] (-484.812) (-484.030) * (-483.385) (-483.509) [-481.269] (-484.467) -- 0:00:03
Average standard deviation of split frequencies: 0.009558
920500 -- (-483.997) (-484.465) [-481.900] (-481.716) * [-484.300] (-486.577) (-482.867) (-482.520) -- 0:00:03
921000 -- (-481.209) (-482.353) [-481.779] (-484.229) * (-481.862) [-483.861] (-482.632) (-483.593) -- 0:00:03
921500 -- (-481.615) [-483.702] (-484.159) (-481.517) * [-481.995] (-481.073) (-480.383) (-483.839) -- 0:00:03
922000 -- [-480.843] (-483.942) (-482.356) (-483.500) * (-482.287) (-481.026) [-483.699] (-481.597) -- 0:00:03
922500 -- (-482.833) [-484.099] (-482.502) (-481.705) * (-482.088) (-483.357) (-484.779) [-485.901] -- 0:00:03
923000 -- (-481.793) (-481.495) (-483.583) [-482.778] * (-483.139) (-482.274) [-481.686] (-483.526) -- 0:00:03
923500 -- (-483.497) [-484.876] (-481.909) (-481.556) * (-483.494) (-482.807) [-481.216] (-487.232) -- 0:00:03
924000 -- [-482.566] (-481.798) (-489.862) (-483.060) * (-482.926) (-481.128) (-481.591) [-482.296] -- 0:00:03
924500 -- (-483.641) (-482.175) (-481.966) [-481.229] * [-480.373] (-481.186) (-484.895) (-483.796) -- 0:00:03
925000 -- [-481.730] (-483.703) (-482.144) (-481.699) * [-483.963] (-484.985) (-482.961) (-481.113) -- 0:00:03
Average standard deviation of split frequencies: 0.009163
925500 -- (-480.734) (-481.726) (-482.882) [-481.363] * (-483.200) (-486.153) (-481.537) [-481.840] -- 0:00:03
926000 -- (-481.126) [-481.575] (-482.028) (-482.739) * (-488.598) (-482.858) [-481.574] (-484.821) -- 0:00:03
926500 -- (-483.334) [-481.610] (-480.923) (-482.670) * (-484.970) (-481.196) (-481.700) [-484.540] -- 0:00:03
927000 -- (-483.217) [-484.058] (-483.543) (-482.131) * (-485.120) [-486.987] (-481.222) (-482.635) -- 0:00:03
927500 -- (-480.817) (-486.569) (-482.374) [-482.656] * [-485.010] (-482.565) (-481.114) (-484.395) -- 0:00:03
928000 -- [-481.644] (-483.430) (-482.294) (-483.739) * [-482.618] (-483.070) (-485.245) (-480.799) -- 0:00:03
928500 -- (-482.970) (-482.420) [-483.218] (-482.874) * (-484.409) (-481.175) [-481.876] (-481.337) -- 0:00:03
929000 -- (-482.432) (-482.934) [-481.359] (-484.130) * (-484.752) (-482.268) (-482.733) [-483.776] -- 0:00:03
929500 -- (-482.856) (-483.351) (-482.044) [-485.585] * (-482.338) (-484.418) (-483.911) [-481.671] -- 0:00:03
930000 -- [-483.552] (-480.863) (-483.031) (-483.879) * (-480.943) (-484.307) (-486.191) [-488.252] -- 0:00:03
Average standard deviation of split frequencies: 0.009793
930500 -- (-482.341) (-481.031) (-484.797) [-482.224] * (-482.453) [-480.672] (-485.996) (-488.278) -- 0:00:03
931000 -- (-485.855) [-481.392] (-481.488) (-481.998) * (-482.943) (-481.561) [-480.745] (-482.751) -- 0:00:03
931500 -- (-487.139) (-480.764) [-483.108] (-482.967) * [-483.161] (-484.955) (-481.183) (-485.692) -- 0:00:03
932000 -- [-481.841] (-482.988) (-482.565) (-480.583) * (-482.970) (-484.140) (-483.273) [-481.939] -- 0:00:03
932500 -- (-480.640) (-485.076) [-487.544] (-484.633) * [-486.721] (-482.480) (-485.488) (-483.015) -- 0:00:03
933000 -- (-480.604) (-485.241) (-481.655) [-482.261] * (-485.120) (-483.182) (-487.659) [-481.332] -- 0:00:03
933500 -- (-482.418) (-481.037) (-481.990) [-483.484] * [-481.291] (-484.859) (-484.602) (-482.313) -- 0:00:03
934000 -- (-482.615) (-482.370) [-483.322] (-485.661) * [-481.802] (-483.351) (-486.341) (-483.659) -- 0:00:03
934500 -- (-482.912) [-481.109] (-484.460) (-481.054) * (-484.474) (-484.013) [-483.388] (-481.898) -- 0:00:03
935000 -- (-482.807) (-486.097) [-486.483] (-483.457) * (-484.140) (-481.998) [-481.150] (-485.279) -- 0:00:02
Average standard deviation of split frequencies: 0.010073
935500 -- (-488.531) [-481.930] (-484.099) (-482.071) * (-481.939) [-481.611] (-480.824) (-485.430) -- 0:00:02
936000 -- (-484.263) (-482.587) (-482.656) [-482.230] * (-482.729) (-480.711) [-483.737] (-483.198) -- 0:00:02
936500 -- (-481.679) (-481.583) [-483.355] (-483.408) * (-484.291) (-481.275) (-483.659) [-482.304] -- 0:00:02
937000 -- (-488.008) [-484.743] (-483.316) (-482.574) * (-482.062) (-481.130) (-484.889) [-481.707] -- 0:00:02
937500 -- (-489.174) (-486.246) [-482.057] (-481.623) * (-488.330) (-482.553) (-487.490) [-481.754] -- 0:00:02
938000 -- (-490.027) [-483.540] (-481.488) (-482.846) * (-482.306) (-487.634) [-483.589] (-482.616) -- 0:00:02
938500 -- (-489.239) [-483.407] (-484.153) (-482.857) * (-480.586) (-484.335) (-483.592) [-483.235] -- 0:00:02
939000 -- (-483.023) (-486.747) [-484.150] (-483.448) * (-480.948) (-483.540) [-483.449] (-483.457) -- 0:00:02
939500 -- (-480.515) (-485.535) (-481.980) [-484.839] * (-484.156) (-483.280) (-487.578) [-482.623] -- 0:00:02
940000 -- (-480.697) [-483.811] (-480.823) (-485.852) * (-481.257) [-483.453] (-483.271) (-483.796) -- 0:00:02
Average standard deviation of split frequencies: 0.010023
940500 -- (-484.452) (-480.965) [-483.356] (-481.854) * [-482.750] (-482.603) (-483.826) (-481.806) -- 0:00:02
941000 -- (-483.636) (-481.708) (-483.963) [-481.186] * (-483.354) (-483.237) [-485.708] (-483.301) -- 0:00:02
941500 -- [-482.243] (-483.469) (-483.138) (-488.635) * (-483.173) [-483.545] (-483.832) (-481.064) -- 0:00:02
942000 -- (-482.431) (-485.503) (-484.120) [-483.298] * [-486.206] (-482.578) (-485.669) (-482.162) -- 0:00:02
942500 -- [-483.735] (-483.786) (-485.052) (-482.630) * (-481.748) [-481.302] (-483.825) (-485.458) -- 0:00:02
943000 -- (-483.837) (-483.650) [-485.661] (-482.622) * (-481.512) (-482.793) (-483.059) [-484.322] -- 0:00:02
943500 -- (-485.113) [-482.296] (-483.377) (-483.679) * (-481.036) [-484.299] (-490.369) (-484.683) -- 0:00:02
944000 -- (-484.745) (-481.133) [-482.729] (-482.199) * (-483.203) (-481.544) [-482.283] (-483.554) -- 0:00:02
944500 -- (-486.498) (-480.926) [-482.767] (-481.051) * (-481.422) (-484.273) (-484.739) [-482.925] -- 0:00:02
945000 -- (-486.793) (-482.699) (-483.290) [-485.813] * (-480.612) [-483.751] (-483.202) (-482.885) -- 0:00:02
Average standard deviation of split frequencies: 0.010631
945500 -- (-483.856) [-485.104] (-482.179) (-483.116) * (-480.933) (-482.805) (-483.078) [-482.974] -- 0:00:02
946000 -- [-482.488] (-482.489) (-483.444) (-485.644) * (-481.678) (-482.108) (-481.017) [-482.426] -- 0:00:02
946500 -- [-481.428] (-481.941) (-482.382) (-481.453) * [-480.372] (-482.474) (-482.957) (-480.493) -- 0:00:02
947000 -- [-482.439] (-480.683) (-480.642) (-480.682) * (-482.873) (-482.489) (-483.710) [-482.436] -- 0:00:02
947500 -- (-485.792) [-483.169] (-483.732) (-482.054) * (-485.654) (-482.720) (-482.004) [-481.773] -- 0:00:02
948000 -- (-482.697) (-482.307) [-482.876] (-482.442) * (-480.720) (-481.146) (-482.055) [-481.394] -- 0:00:02
948500 -- (-482.804) [-480.690] (-481.958) (-483.721) * (-483.522) [-482.330] (-483.486) (-482.665) -- 0:00:02
949000 -- (-482.102) (-481.526) (-484.581) [-484.461] * [-488.062] (-485.174) (-482.675) (-481.375) -- 0:00:02
949500 -- (-482.193) (-482.326) (-484.816) [-484.833] * (-483.799) [-482.292] (-483.829) (-482.928) -- 0:00:02
950000 -- [-482.638] (-481.828) (-483.369) (-487.931) * (-483.930) (-483.738) (-481.771) [-481.586] -- 0:00:02
Average standard deviation of split frequencies: 0.010909
950500 -- (-482.688) (-485.369) [-485.356] (-482.395) * (-485.129) [-481.869] (-482.172) (-483.886) -- 0:00:02
951000 -- (-482.735) [-481.329] (-485.426) (-485.827) * (-483.532) (-487.214) [-482.454] (-484.858) -- 0:00:02
951500 -- [-481.112] (-480.509) (-484.083) (-485.883) * (-484.135) [-486.876] (-483.772) (-481.135) -- 0:00:02
952000 -- (-481.587) (-483.494) [-481.074] (-483.693) * (-482.343) (-483.121) [-484.561] (-482.349) -- 0:00:02
952500 -- [-481.689] (-490.678) (-485.391) (-482.942) * (-482.637) (-482.412) (-484.226) [-483.982] -- 0:00:02
953000 -- (-485.072) (-483.228) (-487.848) [-483.110] * (-480.743) (-481.158) [-482.497] (-482.281) -- 0:00:02
953500 -- (-484.343) (-483.734) (-481.875) [-481.212] * (-482.957) (-481.510) (-482.352) [-485.781] -- 0:00:02
954000 -- (-487.219) (-483.087) [-483.769] (-484.557) * [-481.639] (-487.406) (-483.386) (-484.876) -- 0:00:02
954500 -- [-483.504] (-480.788) (-482.266) (-483.679) * (-482.641) [-486.895] (-484.604) (-485.161) -- 0:00:02
955000 -- (-482.644) (-481.953) [-481.863] (-487.823) * (-482.049) (-484.690) (-482.099) [-481.738] -- 0:00:02
Average standard deviation of split frequencies: 0.010519
955500 -- (-481.391) (-485.593) (-484.581) [-484.389] * [-482.143] (-483.238) (-483.986) (-482.919) -- 0:00:02
956000 -- (-480.914) [-482.334] (-482.975) (-484.049) * (-484.676) (-484.211) (-484.486) [-482.163] -- 0:00:02
956500 -- (-482.364) [-483.074] (-482.545) (-482.264) * (-482.492) (-483.683) [-483.342] (-481.862) -- 0:00:02
957000 -- [-481.445] (-484.358) (-483.434) (-481.854) * [-481.800] (-481.779) (-484.084) (-481.888) -- 0:00:01
957500 -- [-482.416] (-481.970) (-482.521) (-480.614) * (-482.879) [-481.577] (-481.655) (-490.758) -- 0:00:01
958000 -- (-483.656) (-481.785) (-482.152) [-480.773] * (-484.417) (-483.754) (-481.456) [-481.647] -- 0:00:01
958500 -- (-486.042) (-481.378) (-480.593) [-480.474] * [-484.517] (-486.070) (-482.954) (-484.937) -- 0:00:01
959000 -- [-483.027] (-483.701) (-480.865) (-482.051) * (-481.688) (-485.652) [-483.845] (-487.357) -- 0:00:01
959500 -- [-481.816] (-483.051) (-482.898) (-482.079) * (-483.533) (-482.424) [-483.459] (-482.093) -- 0:00:01
960000 -- [-483.272] (-482.531) (-483.041) (-481.088) * [-482.106] (-485.360) (-482.023) (-484.386) -- 0:00:01
Average standard deviation of split frequencies: 0.010141
960500 -- (-481.315) [-481.702] (-480.845) (-482.778) * [-480.788] (-481.981) (-484.201) (-481.796) -- 0:00:01
961000 -- [-480.525] (-481.916) (-485.441) (-484.435) * (-483.505) (-483.140) (-481.278) [-480.838] -- 0:00:01
961500 -- (-481.956) [-487.260] (-489.771) (-484.252) * (-482.198) (-483.813) [-484.187] (-482.262) -- 0:00:01
962000 -- (-485.739) [-484.918] (-484.906) (-480.987) * (-482.885) (-484.940) [-481.080] (-483.361) -- 0:00:01
962500 -- (-480.980) (-481.571) [-482.762] (-481.236) * [-481.689] (-483.138) (-480.885) (-483.735) -- 0:00:01
963000 -- (-484.548) [-481.221] (-481.866) (-481.007) * [-483.873] (-484.624) (-484.166) (-484.321) -- 0:00:01
963500 -- (-482.524) [-482.110] (-483.199) (-481.200) * (-485.382) (-482.112) (-482.579) [-485.060] -- 0:00:01
964000 -- [-483.041] (-480.699) (-483.105) (-482.625) * (-481.960) (-481.666) [-483.222] (-483.365) -- 0:00:01
964500 -- (-483.132) (-482.309) (-482.142) [-484.530] * [-482.474] (-482.354) (-485.134) (-483.230) -- 0:00:01
965000 -- (-484.153) (-481.585) [-481.975] (-486.566) * (-485.263) (-483.708) [-482.439] (-483.283) -- 0:00:01
Average standard deviation of split frequencies: 0.009435
965500 -- [-481.579] (-484.291) (-482.318) (-482.729) * [-485.207] (-486.238) (-484.442) (-481.246) -- 0:00:01
966000 -- (-481.582) [-480.744] (-482.848) (-481.936) * [-487.135] (-480.870) (-484.030) (-481.092) -- 0:00:01
966500 -- (-488.012) (-481.475) (-482.862) [-481.261] * (-486.462) (-481.056) (-483.330) [-482.033] -- 0:00:01
967000 -- (-481.812) (-482.052) [-481.775] (-482.471) * (-487.006) [-481.372] (-483.707) (-482.319) -- 0:00:01
967500 -- (-483.285) [-483.952] (-483.925) (-481.354) * [-483.284] (-481.691) (-483.829) (-481.959) -- 0:00:01
968000 -- [-481.961] (-481.915) (-481.928) (-481.151) * [-483.571] (-481.960) (-482.998) (-482.236) -- 0:00:01
968500 -- [-481.568] (-482.646) (-483.334) (-485.228) * (-490.619) [-482.710] (-481.676) (-484.230) -- 0:00:01
969000 -- [-487.145] (-483.554) (-481.449) (-484.463) * [-484.666] (-485.106) (-486.842) (-483.471) -- 0:00:01
969500 -- (-482.898) [-485.622] (-481.592) (-481.802) * [-483.205] (-481.856) (-480.868) (-484.020) -- 0:00:01
970000 -- (-481.002) (-480.536) [-480.967] (-481.479) * (-487.411) [-481.357] (-481.726) (-482.820) -- 0:00:01
Average standard deviation of split frequencies: 0.009389
970500 -- (-482.051) (-487.530) [-482.299] (-481.832) * (-484.721) [-482.765] (-481.104) (-482.944) -- 0:00:01
971000 -- (-481.946) [-480.532] (-483.255) (-481.772) * (-481.410) [-486.057] (-482.838) (-486.916) -- 0:00:01
971500 -- (-483.598) [-481.507] (-482.543) (-482.348) * (-480.345) (-481.584) [-482.856] (-496.356) -- 0:00:01
972000 -- (-482.409) [-484.835] (-483.223) (-483.034) * (-482.095) [-483.797] (-485.574) (-498.869) -- 0:00:01
972500 -- (-481.943) (-486.193) (-483.264) [-480.597] * (-485.925) (-481.707) [-486.868] (-483.589) -- 0:00:01
973000 -- (-483.507) (-484.609) (-483.380) [-481.872] * (-481.151) (-482.111) (-485.689) [-481.765] -- 0:00:01
973500 -- (-484.659) [-484.293] (-482.129) (-481.839) * (-480.936) [-482.049] (-483.462) (-480.688) -- 0:00:01
974000 -- (-483.772) (-482.704) [-482.953] (-481.299) * [-481.843] (-483.297) (-481.604) (-486.043) -- 0:00:01
974500 -- (-482.690) (-482.394) (-481.712) [-481.324] * (-483.860) [-481.574] (-481.207) (-482.601) -- 0:00:01
975000 -- (-481.238) (-486.008) (-482.441) [-482.120] * [-482.890] (-481.880) (-483.262) (-482.196) -- 0:00:01
Average standard deviation of split frequencies: 0.009338
975500 -- (-482.285) (-488.021) (-481.986) [-483.761] * (-482.078) [-480.828] (-481.572) (-485.456) -- 0:00:01
976000 -- (-482.453) (-483.671) [-480.827] (-480.739) * (-481.624) (-484.273) (-488.103) [-482.428] -- 0:00:01
976500 -- (-481.876) [-483.090] (-483.152) (-484.749) * [-482.533] (-485.044) (-488.942) (-487.060) -- 0:00:01
977000 -- [-482.043] (-481.301) (-481.682) (-482.954) * (-482.356) (-482.949) [-482.922] (-484.221) -- 0:00:01
977500 -- (-487.529) (-481.732) (-483.577) [-482.971] * (-482.578) (-484.530) (-484.444) [-483.758] -- 0:00:01
978000 -- (-487.147) (-481.660) [-482.263] (-481.755) * (-483.910) (-484.029) (-483.049) [-482.522] -- 0:00:01
978500 -- (-481.780) (-483.616) (-485.609) [-483.749] * (-486.374) [-482.495] (-483.721) (-488.209) -- 0:00:00
979000 -- (-483.289) (-486.871) (-482.907) [-482.883] * [-482.583] (-485.744) (-482.956) (-483.799) -- 0:00:00
979500 -- (-480.813) (-483.001) (-483.468) [-482.791] * [-484.158] (-480.305) (-486.681) (-480.772) -- 0:00:00
980000 -- (-482.754) (-486.251) (-482.243) [-483.288] * (-483.653) [-480.791] (-483.205) (-484.010) -- 0:00:00
Average standard deviation of split frequencies: 0.009614
980500 -- (-481.625) [-482.744] (-481.642) (-482.665) * (-483.746) (-481.234) (-482.813) [-482.561] -- 0:00:00
981000 -- (-482.566) (-480.826) [-484.300] (-485.082) * (-483.630) [-481.113] (-482.563) (-481.420) -- 0:00:00
981500 -- (-484.470) [-483.213] (-482.914) (-484.763) * [-482.946] (-483.418) (-480.815) (-486.488) -- 0:00:00
982000 -- [-481.473] (-483.725) (-482.726) (-484.004) * (-481.841) [-480.669] (-481.332) (-483.982) -- 0:00:00
982500 -- [-483.555] (-483.108) (-481.512) (-481.598) * [-482.936] (-484.569) (-480.445) (-483.555) -- 0:00:00
983000 -- [-481.563] (-483.757) (-485.221) (-482.889) * [-481.065] (-481.406) (-487.650) (-481.920) -- 0:00:00
983500 -- (-482.737) [-481.729] (-486.376) (-482.733) * (-483.667) [-482.371] (-481.604) (-482.141) -- 0:00:00
984000 -- (-485.150) (-481.511) [-482.721] (-484.233) * (-483.570) (-480.916) (-484.076) [-481.058] -- 0:00:00
984500 -- (-482.515) [-483.328] (-482.600) (-483.526) * (-484.618) [-483.471] (-483.852) (-480.577) -- 0:00:00
985000 -- (-482.782) [-482.641] (-487.973) (-481.233) * (-486.419) (-482.443) (-484.071) [-480.571] -- 0:00:00
Average standard deviation of split frequencies: 0.010199
985500 -- (-484.936) (-482.722) (-487.044) [-481.540] * (-484.226) [-485.622] (-485.568) (-480.522) -- 0:00:00
986000 -- [-485.149] (-483.623) (-488.404) (-482.748) * [-482.241] (-482.558) (-481.805) (-481.965) -- 0:00:00
986500 -- (-481.289) [-481.466] (-484.724) (-483.055) * (-482.871) [-482.233] (-482.505) (-481.821) -- 0:00:00
987000 -- [-483.178] (-483.598) (-481.671) (-482.420) * (-481.775) (-480.614) (-482.785) [-481.501] -- 0:00:00
987500 -- (-484.869) (-483.230) (-482.320) [-482.815] * (-484.286) (-482.959) [-481.869] (-484.844) -- 0:00:00
988000 -- [-481.259] (-485.019) (-481.824) (-481.321) * (-483.949) (-481.270) [-483.959] (-484.018) -- 0:00:00
988500 -- (-485.743) (-482.045) [-481.508] (-482.550) * (-483.047) (-481.209) [-483.066] (-484.469) -- 0:00:00
989000 -- (-485.645) [-481.706] (-481.796) (-481.980) * (-482.206) (-480.981) [-485.250] (-484.948) -- 0:00:00
989500 -- (-487.532) (-481.720) [-482.854] (-486.881) * (-485.803) (-481.182) (-481.223) [-481.759] -- 0:00:00
990000 -- (-484.332) (-481.303) (-484.071) [-481.583] * (-480.590) (-483.180) [-482.318] (-481.889) -- 0:00:00
Average standard deviation of split frequencies: 0.010469
990500 -- (-484.621) (-490.011) [-482.709] (-482.502) * [-482.948] (-481.542) (-480.934) (-485.488) -- 0:00:00
991000 -- (-488.159) [-483.349] (-484.423) (-484.758) * [-480.783] (-481.572) (-486.656) (-482.084) -- 0:00:00
991500 -- [-486.225] (-483.588) (-484.833) (-483.415) * (-483.756) (-482.585) (-484.926) [-480.842] -- 0:00:00
992000 -- (-483.641) (-483.446) (-482.359) [-483.155] * [-486.830] (-484.522) (-481.238) (-484.541) -- 0:00:00
992500 -- (-482.509) (-483.747) (-482.471) [-482.539] * (-486.010) [-480.698] (-480.881) (-484.741) -- 0:00:00
993000 -- (-484.539) (-480.911) [-482.014] (-485.056) * [-484.323] (-480.874) (-483.062) (-485.791) -- 0:00:00
993500 -- (-483.248) (-484.139) [-483.714] (-483.317) * (-481.982) (-480.719) (-489.923) [-482.938] -- 0:00:00
994000 -- [-484.341] (-483.559) (-485.009) (-482.398) * (-482.454) (-484.485) (-482.522) [-487.523] -- 0:00:00
994500 -- (-486.349) (-484.130) (-481.799) [-481.715] * (-485.374) (-480.822) [-481.154] (-480.976) -- 0:00:00
995000 -- (-484.393) (-482.287) [-485.715] (-481.792) * (-485.177) (-481.104) (-483.029) [-482.223] -- 0:00:00
Average standard deviation of split frequencies: 0.011044
995500 -- (-485.832) (-484.503) [-482.347] (-481.175) * [-482.024] (-484.783) (-488.126) (-480.895) -- 0:00:00
996000 -- (-483.140) (-483.230) (-482.538) [-480.469] * [-482.188] (-482.059) (-482.445) (-481.821) -- 0:00:00
996500 -- (-484.457) [-481.890] (-484.460) (-483.129) * (-484.256) [-481.097] (-482.171) (-485.259) -- 0:00:00
997000 -- (-481.145) [-481.601] (-481.401) (-482.899) * (-482.450) (-482.927) [-481.341] (-482.844) -- 0:00:00
997500 -- [-481.252] (-481.805) (-482.436) (-483.823) * (-480.743) [-481.873] (-482.167) (-482.710) -- 0:00:00
998000 -- (-486.301) [-484.537] (-482.819) (-484.829) * (-481.809) (-483.488) [-484.743] (-484.207) -- 0:00:00
998500 -- (-482.942) (-482.436) [-480.722] (-483.931) * (-484.879) (-481.685) (-484.055) [-482.234] -- 0:00:00
999000 -- (-482.535) (-485.154) [-484.638] (-482.794) * (-480.858) [-481.983] (-481.423) (-483.617) -- 0:00:00
999500 -- (-485.000) [-482.355] (-484.710) (-480.913) * [-481.583] (-481.603) (-484.865) (-483.691) -- 0:00:00
1000000 -- (-486.532) (-481.049) [-484.383] (-481.336) * (-483.566) (-480.901) [-483.101] (-483.250) -- 0:00:00
Average standard deviation of split frequencies: 0.010678
Analysis completed in 46 seconds
Analysis used 45.21 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -480.20
Likelihood of best state for "cold" chain of run 2 was -480.20
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
73.5 % ( 62 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
35.1 % ( 29 %) Dirichlet(Pi{all})
34.4 % ( 32 %) Slider(Pi{all})
70.6 % ( 27 %) Multiplier(Alpha{1,2})
70.5 % ( 40 %) Multiplier(Alpha{3})
26.5 % ( 23 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.5 % ( 70 %) ParsSPR(Tau{all},V{all})
27.6 % ( 29 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
32.0 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.4 % ( 66 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
34.4 % ( 32 %) Dirichlet(Pi{all})
33.9 % ( 29 %) Slider(Pi{all})
70.6 % ( 29 %) Multiplier(Alpha{1,2})
69.7 % ( 34 %) Multiplier(Alpha{3})
25.9 % ( 23 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.9 % ( 65 %) ParsSPR(Tau{all},V{all})
27.6 % ( 33 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
31.8 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.57
2 | 166470 0.85 0.72
3 | 166426 167725 0.86
4 | 166602 166654 166123
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.57
2 | 166288 0.85 0.72
3 | 166796 166340 0.86
4 | 166985 167342 166249
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -482.15
| 2 2 1 1 1 |
|11 2 1 1 21 1 1 2 |
| 1 121 2 2 1 2 2 2 12 |
| 2 2 1 1 1 *1 2 1 11 |
| 1 21 1 1 1 1 2 1 |
| 1 2 2 *1 2 1 2 *2 1*|
| 21 1 2 1 1 1 2 12 12 1 2 |
| 1 1 22 2 22 2 1 2 * 2 |
| 2 1 1 1 2 22 2 22 1 |
| 2 2 1 1 1 2 |
|2 1 2 2 1 |
| 2 2 2 |
| 2 |
| 1 1 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -483.72
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -481.94 -484.96
2 -482.00 -485.52
--------------------------------------
TOTAL -481.97 -485.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.493803 0.049979 0.098319 0.908808 0.460375 1422.46 1461.73 1.000
r(A<->C){all} 0.164120 0.019562 0.000023 0.450320 0.126580 248.53 318.83 1.003
r(A<->G){all} 0.163431 0.019302 0.000048 0.446966 0.128991 189.08 361.80 1.001
r(A<->T){all} 0.177890 0.023232 0.000032 0.479470 0.134280 281.18 312.63 1.000
r(C<->G){all} 0.169087 0.021450 0.000182 0.465745 0.129519 138.23 288.20 1.000
r(C<->T){all} 0.153732 0.017696 0.000039 0.424237 0.118670 202.68 263.50 1.001
r(G<->T){all} 0.171741 0.020661 0.000174 0.445715 0.134153 126.24 263.56 1.012
pi(A){all} 0.202650 0.000456 0.161798 0.244154 0.202081 1176.33 1338.66 1.000
pi(C){all} 0.279945 0.000561 0.235559 0.327422 0.279044 1101.89 1301.45 1.000
pi(G){all} 0.311842 0.000606 0.267041 0.361533 0.311002 1425.76 1443.77 1.000
pi(T){all} 0.205564 0.000465 0.164795 0.250492 0.205013 1344.52 1345.62 1.000
alpha{1,2} 0.414742 0.231755 0.000284 1.393955 0.242907 1266.71 1348.71 1.000
alpha{3} 0.455360 0.247029 0.000145 1.418264 0.290845 1162.31 1223.88 1.000
pinvar{all} 0.994866 0.000038 0.983631 0.999997 0.996803 1215.45 1295.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- ..**
6 -- .*.*
7 -- .**.
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1030 0.343105 0.016017 0.331779 0.354430 2
6 1024 0.341106 0.011306 0.333111 0.349101 2
7 948 0.315789 0.004711 0.312458 0.319121 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.097171 0.009362 0.000024 0.288143 0.067487 1.000 2
length{all}[2] 0.100039 0.009817 0.000045 0.298297 0.068971 1.001 2
length{all}[3] 0.098268 0.010029 0.000055 0.295804 0.068644 1.001 2
length{all}[4] 0.100041 0.010680 0.000092 0.307546 0.067704 1.000 2
length{all}[5] 0.098632 0.009112 0.000277 0.292056 0.069579 0.999 2
length{all}[6] 0.098914 0.010323 0.000052 0.299698 0.070951 0.999 2
length{all}[7] 0.097226 0.010469 0.000110 0.287544 0.065610 1.002 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010678
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\----------------------------------------------------------------------- C4 (4)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 4 ls = 351
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 117 / 117 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 117 / 117 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4); MP score: 0
0.097440 0.085218 0.014045 0.079730 0.300000 1.300000
ntime & nrate & np: 4 2 6
Bounds (np=6):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 6
lnL0 = -500.793618
Iterating by ming2
Initial: fx= 500.793618
x= 0.09744 0.08522 0.01404 0.07973 0.30000 1.30000
1 h-m-p 0.0000 0.0001 228.4250 ++ 494.430780 m 0.0001 11 | 1/6
2 h-m-p 0.0014 0.0224 16.7844 -----------.. | 1/6
3 h-m-p 0.0000 0.0006 197.6712 +++ 471.792943 m 0.0006 39 | 2/6
4 h-m-p 0.0085 0.0486 10.8957 -------------.. | 2/6
5 h-m-p 0.0000 0.0000 163.0888 ++ 470.510724 m 0.0000 68 | 3/6
6 h-m-p 0.0008 0.4144 6.6880 -----------.. | 3/6
7 h-m-p 0.0000 0.0001 115.3088 ++ 469.079425 m 0.0001 95 | 4/6
8 h-m-p 0.3810 8.0000 0.0000 +++ 469.079425 m 8.0000 105 | 4/6
9 h-m-p 0.1136 8.0000 0.0001 --C 469.079425 0 0.0027 118 | 4/6
10 h-m-p 0.0160 8.0000 0.0000 ---C 469.079425 0 0.0001 132
Out..
lnL = -469.079425
133 lfun, 133 eigenQcodon, 532 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 0
0.067649 0.079802 0.093360 0.011518 0.299956 0.648794 0.388197
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.365890
np = 7
lnL0 = -497.530387
Iterating by ming2
Initial: fx= 497.530387
x= 0.06765 0.07980 0.09336 0.01152 0.29996 0.64879 0.38820
1 h-m-p 0.0000 0.0001 221.4407 ++ 492.462993 m 0.0001 12 | 1/7
2 h-m-p 0.0002 0.0021 107.8388 ++ 473.387217 m 0.0021 22 | 2/7
3 h-m-p 0.0000 0.0000 26273.4619 ++ 470.634233 m 0.0000 32 | 3/7
4 h-m-p 0.0001 0.0006 219.3768 ++ 469.079414 m 0.0006 42 | 4/7
5 h-m-p 1.6000 8.0000 0.0001 ++ 469.079414 m 8.0000 52 | 4/7
6 h-m-p 0.0132 0.3641 0.0428 +++ 469.079414 m 0.3641 66 | 5/7
7 h-m-p 0.0560 8.0000 0.0778 -------------C 469.079414 0 0.0000 92 | 5/7
8 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079414 m 8.0000 107 | 5/7
9 h-m-p 0.0021 1.0570 0.4585 ------------.. | 5/7
10 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079414 m 8.0000 144 | 5/7
11 h-m-p 0.0047 2.3569 0.2903 ---------Y 469.079414 0 0.0000 165 | 5/7
12 h-m-p 0.0160 8.0000 0.0005 +++++ 469.079414 m 8.0000 180 | 5/7
13 h-m-p 0.0124 2.3885 0.3145 ----------Y 469.079414 0 0.0000 202 | 5/7
14 h-m-p 0.0160 8.0000 0.0000 --Y 469.079414 0 0.0003 216 | 5/7
15 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079414 m 8.0000 231 | 5/7
16 h-m-p 0.0047 2.3437 0.3849 ------------.. | 5/7
17 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079414 m 8.0000 268 | 5/7
18 h-m-p 0.0045 2.2351 0.3080 --------Y 469.079414 0 0.0000 288 | 5/7
19 h-m-p 0.0160 8.0000 0.0077 +++++ 469.079412 m 8.0000 303 | 5/7
20 h-m-p 0.1901 2.3417 0.3249 -----------N 469.079412 0 0.0000 326 | 5/7
21 h-m-p 0.0160 8.0000 0.0015 +++++ 469.079411 m 8.0000 341 | 5/7
22 h-m-p 0.0416 2.6903 0.2828 ----------C 469.079411 0 0.0000 363 | 5/7
23 h-m-p 0.0160 8.0000 0.0001 -----Y 469.079411 0 0.0000 380 | 5/7
24 h-m-p 0.0160 8.0000 0.0002 +++++ 469.079411 m 8.0000 395 | 5/7
25 h-m-p 0.0064 2.9729 0.2847 ------------.. | 5/7
26 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 432 | 5/7
27 h-m-p 0.0059 2.9410 0.2596 ------------.. | 5/7
28 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 469 | 5/7
29 h-m-p 0.0054 2.7139 0.2814 ------------.. | 5/7
30 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 506 | 5/7
31 h-m-p 0.0056 2.7815 0.2747 --------C 469.079411 0 0.0000 526 | 5/7
32 h-m-p 0.0160 8.0000 0.0007 +++++ 469.079411 m 8.0000 541 | 5/7
33 h-m-p 0.0198 2.8913 0.2773 -------------.. | 5/7
34 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 579 | 5/7
35 h-m-p 0.0056 2.8124 0.2737 ----------C 469.079411 0 0.0000 601 | 5/7
36 h-m-p 0.0160 8.0000 0.0008 +++++ 469.079411 m 8.0000 616 | 5/7
37 h-m-p 0.0215 3.0180 0.2794 ---------C 469.079411 0 0.0000 637 | 5/7
38 h-m-p 0.0160 8.0000 0.0011 +++++ 469.079411 m 8.0000 652 | 5/7
39 h-m-p 0.0323 3.0636 0.2776 ----------C 469.079411 0 0.0000 674 | 5/7
40 h-m-p 0.0160 8.0000 0.0001 ------Y 469.079411 0 0.0000 692 | 5/7
41 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 707 | 5/7
42 h-m-p 0.0058 2.9209 0.2600 -----------C 469.079411 0 0.0000 730 | 5/7
43 h-m-p 0.0160 8.0000 0.0000 ---C 469.079411 0 0.0001 745 | 5/7
44 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079411 m 8.0000 760 | 5/7
45 h-m-p 0.0063 3.1680 0.2415 ----------Y 469.079411 0 0.0000 782 | 5/7
46 h-m-p 0.0160 8.0000 0.0000 -------C 469.079411 0 0.0000 801 | 5/7
47 h-m-p 0.0160 8.0000 0.0000 ------------Y 469.079411 0 0.0000 825
Out..
lnL = -469.079411
826 lfun, 2478 eigenQcodon, 6608 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 0
0.106708 0.050810 0.027712 0.076027 0.226186 0.925309 0.586644 0.136117 1.423329
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.936221
np = 9
lnL0 = -497.660589
Iterating by ming2
Initial: fx= 497.660589
x= 0.10671 0.05081 0.02771 0.07603 0.22619 0.92531 0.58664 0.13612 1.42333
1 h-m-p 0.0000 0.0003 208.2211 +++ 485.975146 m 0.0003 15 | 1/9
2 h-m-p 0.0004 0.0020 67.1609 ++ 478.126141 m 0.0020 27 | 2/9
3 h-m-p 0.0000 0.0000 1844.8660 ++ 477.539970 m 0.0000 39 | 3/9
4 h-m-p 0.0005 0.0195 9.6669 -----------.. | 3/9
5 h-m-p 0.0000 0.0002 155.2477 +++ 472.580204 m 0.0002 73 | 4/9
6 h-m-p 0.0040 0.0882 5.5535 ------------.. | 4/9
7 h-m-p 0.0000 0.0003 112.4648 +++ 469.079419 m 0.0003 108 | 5/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 469.079419 m 8.0000 120 | 5/9
9 h-m-p 0.0802 8.0000 0.0004 ++++ 469.079419 m 8.0000 138 | 5/9
10 h-m-p 0.0160 8.0000 1.4667 ---------Y 469.079419 0 0.0000 163 | 5/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 469.079419 m 8.0000 178 | 5/9
12 h-m-p 0.0160 8.0000 1.3438 --------Y 469.079419 0 0.0000 202 | 5/9
13 h-m-p 0.0436 8.0000 0.0000 ++++ 469.079419 m 8.0000 216 | 5/9
14 h-m-p 0.0495 8.0000 0.0003 ++++ 469.079419 m 8.0000 234 | 5/9
15 h-m-p 0.0039 1.9264 1.8074 -------C 469.079419 0 0.0000 257 | 5/9
16 h-m-p 0.0164 8.0000 0.0000 ---Y 469.079419 0 0.0001 272 | 5/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079419 m 8.0000 291 | 5/9
18 h-m-p 0.0036 1.8076 0.4212 +++++ 469.079418 m 1.8076 310 | 6/9
19 h-m-p 1.6000 8.0000 0.0802 Y 469.079418 0 0.9355 326 | 6/9
20 h-m-p 1.6000 8.0000 0.0006 ------N 469.079418 0 0.0001 347 | 6/9
21 h-m-p 0.5669 8.0000 0.0000 -----C 469.079418 0 0.0001 367
Out..
lnL = -469.079418
368 lfun, 1472 eigenQcodon, 4416 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -469.084489 S = -469.078493 -0.002292
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:04
did 20 / 51 patterns 0:04
did 30 / 51 patterns 0:04
did 40 / 51 patterns 0:04
did 50 / 51 patterns 0:04
did 51 / 51 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 0
0.065616 0.035327 0.033547 0.078632 0.558553 0.633449 1.905264
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.521115
np = 7
lnL0 = -492.954698
Iterating by ming2
Initial: fx= 492.954698
x= 0.06562 0.03533 0.03355 0.07863 0.55855 0.63345 1.90526
1 h-m-p 0.0000 0.0003 218.9997 +++ 478.118544 m 0.0003 13 | 1/7
2 h-m-p 0.0047 0.0629 12.2506 ------------.. | 1/7
3 h-m-p 0.0000 0.0000 195.0455 ++ 477.515388 m 0.0000 43 | 2/7
4 h-m-p 0.0003 0.0980 7.9177 ----------.. | 2/7
5 h-m-p 0.0000 0.0003 158.9663 +++ 470.595405 m 0.0003 72 | 3/7
6 h-m-p 0.0055 0.1431 5.5434 ------------.. | 3/7
7 h-m-p 0.0000 0.0001 114.2180 ++ 469.079414 m 0.0001 102 | 4/7
8 h-m-p 1.6000 8.0000 0.0000 ++ 469.079414 m 8.0000 112 | 4/7
9 h-m-p 0.1483 8.0000 0.0000 ---Y 469.079414 0 0.0006 128 | 4/7
10 h-m-p 0.0160 8.0000 0.0000 -------------.. | 4/7
11 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079414 m 8.0000 168 | 4/7
12 h-m-p 0.0160 8.0000 0.6462 ----------N 469.079414 0 0.0000 191 | 4/7
13 h-m-p 0.0160 8.0000 0.0036 +++++ 469.079413 m 8.0000 207 | 4/7
14 h-m-p 0.0459 8.0000 0.6350 ----------C 469.079413 0 0.0000 230 | 4/7
15 h-m-p 0.0160 8.0000 0.0002 -----Y 469.079413 0 0.0000 248 | 4/7
16 h-m-p 0.0160 8.0000 0.0000 Y 469.079413 0 0.0040 261
Out..
lnL = -469.079413
262 lfun, 2882 eigenQcodon, 10480 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 0
0.075546 0.105597 0.086143 0.032893 0.539077 0.900000 1.126834 1.481451 1.299965
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.324960
np = 9
lnL0 = -502.410050
Iterating by ming2
Initial: fx= 502.410050
x= 0.07555 0.10560 0.08614 0.03289 0.53908 0.90000 1.12683 1.48145 1.29996
1 h-m-p 0.0000 0.0003 214.6174 +++ 488.195092 m 0.0003 15 | 1/9
2 h-m-p 0.0010 0.0060 54.2824 ++ 473.664951 m 0.0060 27 | 2/9
3 h-m-p 0.0000 0.0000 3428.1819 ++ 471.267389 m 0.0000 39 | 3/9
4 h-m-p 0.0016 0.0080 65.1230 -----------.. | 3/9
5 h-m-p 0.0000 0.0002 114.4218 +++ 469.079422 m 0.0002 73 | 4/9
6 h-m-p 0.8117 8.0000 0.0000 ++ 469.079422 m 8.0000 85 | 4/9
7 h-m-p 0.0299 8.0000 0.0011 +++++ 469.079422 m 8.0000 105 | 4/9
8 h-m-p 0.0015 0.5393 5.8845 ---------Y 469.079422 0 0.0000 131 | 4/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 469.079422 m 8.0000 146 | 4/9
10 h-m-p 0.0006 0.3036 3.9040 -------C 469.079422 0 0.0000 170 | 4/9
11 h-m-p 0.0266 8.0000 0.0000 C 469.079422 0 0.0266 182 | 4/9
12 h-m-p 0.1895 8.0000 0.0000 -------Y 469.079422 0 0.0000 206
Out..
lnL = -469.079422
207 lfun, 2484 eigenQcodon, 9108 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -469.083148 S = -469.078152 -0.002189
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:11
did 20 / 51 patterns 0:11
did 30 / 51 patterns 0:11
did 40 / 51 patterns 0:11
did 50 / 51 patterns 0:11
did 51 / 51 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=117
NC_011896_1_WP_010908331_1_1500_MLBR_RS07100 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
NC_002677_1_NP_302010_1_882_ML1420 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV
**************************************************
NC_011896_1_WP_010908331_1_1500_MLBR_RS07100 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
NC_002677_1_NP_302010_1_882_ML1420 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510 GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT
**************************************************
NC_011896_1_WP_010908331_1_1500_MLBR_RS07100 SHTPCCRYRLYRNKAAQ
NC_002677_1_NP_302010_1_882_ML1420 SHTPCCRYRLYRNKAAQ
NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960 SHTPCCRYRLYRNKAAQ
NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510 SHTPCCRYRLYRNKAAQ
*****************
>NC_011896_1_WP_010908331_1_1500_MLBR_RS07100 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA G >NC_002677_1_NP_302010_1_882_ML1420 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA G >NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA G >NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510 TTGAGCGGGAAGCCACCTGCCACCCTGCTATGGCTGGCTCAGGTTAGCGA TGTGATGTACAGTGATCCTGACGACGAAGCCAGCCTTGCGGCGCGCGAAG CAATCACCTACCTATGCGTTGGAGCCCGGATGGACTCCGGCCAACAGGTG GGCGTGGTCCATGAGGTTGTCGTGTCTGAGCTCGAGGAATGGGGGAACGT CCACTGCCAGGACGGTGGACGGCGTCGAGTCCGCGACTATCTCGTTCTGA TGCCGTCCAGACCGGTGTCGCTGCTGATGCAGGAATACCGAGGTCTCACC TCACATACACCGTGTTGTCGGTACCGTCTATATCGAAATAAAGCCGCACA G
>NC_011896_1_WP_010908331_1_1500_MLBR_RS07100 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT SHTPCCRYRLYRNKAAQ >NC_002677_1_NP_302010_1_882_ML1420 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT SHTPCCRYRLYRNKAAQ >NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT SHTPCCRYRLYRNKAAQ >NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510 LSGKPPATLLWLAQVSDVMYSDPDDEASLAAREAITYLCVGARMDSGQQV GVVHEVVVSELEEWGNVHCQDGGRRRVRDYLVLMPSRPVSLLMQEYRGLT SHTPCCRYRLYRNKAAQ
#NEXUS
[ID: 5412164775]
begin taxa;
dimensions ntax=4;
taxlabels
NC_011896_1_WP_010908331_1_1500_MLBR_RS07100
NC_002677_1_NP_302010_1_882_ML1420
NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960
NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908331_1_1500_MLBR_RS07100,
2 NC_002677_1_NP_302010_1_882_ML1420,
3 NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960,
4 NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06748744,2:0.06897141,3:0.06864386,4:0.0677037);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06748744,2:0.06897141,3:0.06864386,4:0.0677037);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -481.94 -484.96
2 -482.00 -485.52
--------------------------------------
TOTAL -481.97 -485.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1420/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.493803 0.049979 0.098319 0.908808 0.460375 1422.46 1461.73 1.000
r(A<->C){all} 0.164120 0.019562 0.000023 0.450320 0.126580 248.53 318.83 1.003
r(A<->G){all} 0.163431 0.019302 0.000048 0.446966 0.128991 189.08 361.80 1.001
r(A<->T){all} 0.177890 0.023232 0.000032 0.479470 0.134280 281.18 312.63 1.000
r(C<->G){all} 0.169087 0.021450 0.000182 0.465745 0.129519 138.23 288.20 1.000
r(C<->T){all} 0.153732 0.017696 0.000039 0.424237 0.118670 202.68 263.50 1.001
r(G<->T){all} 0.171741 0.020661 0.000174 0.445715 0.134153 126.24 263.56 1.012
pi(A){all} 0.202650 0.000456 0.161798 0.244154 0.202081 1176.33 1338.66 1.000
pi(C){all} 0.279945 0.000561 0.235559 0.327422 0.279044 1101.89 1301.45 1.000
pi(G){all} 0.311842 0.000606 0.267041 0.361533 0.311002 1425.76 1443.77 1.000
pi(T){all} 0.205564 0.000465 0.164795 0.250492 0.205013 1344.52 1345.62 1.000
alpha{1,2} 0.414742 0.231755 0.000284 1.393955 0.242907 1266.71 1348.71 1.000
alpha{3} 0.455360 0.247029 0.000145 1.418264 0.290845 1162.31 1223.88 1.000
pinvar{all} 0.994866 0.000038 0.983631 0.999997 0.996803 1215.45 1295.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1420/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 117
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 | Ser TCT 1 1 1 1 | Tyr TAT 2 2 2 2 | Cys TGT 2 2 2 2
TTC 0 0 0 0 | TCC 2 2 2 2 | TAC 4 4 4 4 | TGC 2 2 2 2
Leu TTA 0 0 0 0 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 1 1 1 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 | Pro CCT 2 2 2 2 | His CAT 2 2 2 2 | Arg CGT 2 2 2 2
CTC 3 3 3 3 | CCC 0 0 0 0 | CAC 1 1 1 1 | CGC 2 2 2 2
CTA 3 3 3 3 | CCA 1 1 1 1 | Gln CAA 1 1 1 1 | CGA 3 3 3 3
CTG 5 5 5 5 | CCG 3 3 3 3 | CAG 5 5 5 5 | CGG 3 3 3 3
------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 | Thr ACT 0 0 0 0 | Asn AAT 1 1 1 1 | Ser AGT 1 1 1 1
ATC 1 1 1 1 | ACC 3 3 3 3 | AAC 1 1 1 1 | AGC 3 3 3 3
ATA 0 0 0 0 | ACA 1 1 1 1 | Lys AAA 1 1 1 1 | Arg AGA 1 1 1 1
Met ATG 4 4 4 4 | ACG 0 0 0 0 | AAG 1 1 1 1 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 | Ala GCT 1 1 1 1 | Asp GAT 2 2 2 2 | Gly GGT 2 2 2 2
GTC 4 4 4 4 | GCC 4 4 4 4 | GAC 5 5 5 5 | GGC 2 2 2 2
GTA 0 0 0 0 | GCA 2 2 2 2 | Glu GAA 4 4 4 4 | GGA 2 2 2 2
GTG 5 5 5 5 | GCG 2 2 2 2 | GAG 3 3 3 3 | GGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908331_1_1500_MLBR_RS07100
position 1: T:0.15385 C:0.31624 A:0.15385 G:0.37607
position 2: T:0.26496 C:0.20513 A:0.28205 G:0.24786
position 3: T:0.19658 C:0.31624 A:0.17094 G:0.31624
Average T:0.20513 C:0.27920 A:0.20228 G:0.31339
#2: NC_002677_1_NP_302010_1_882_ML1420
position 1: T:0.15385 C:0.31624 A:0.15385 G:0.37607
position 2: T:0.26496 C:0.20513 A:0.28205 G:0.24786
position 3: T:0.19658 C:0.31624 A:0.17094 G:0.31624
Average T:0.20513 C:0.27920 A:0.20228 G:0.31339
#3: NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960
position 1: T:0.15385 C:0.31624 A:0.15385 G:0.37607
position 2: T:0.26496 C:0.20513 A:0.28205 G:0.24786
position 3: T:0.19658 C:0.31624 A:0.17094 G:0.31624
Average T:0.20513 C:0.27920 A:0.20228 G:0.31339
#4: NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510
position 1: T:0.15385 C:0.31624 A:0.15385 G:0.37607
position 2: T:0.26496 C:0.20513 A:0.28205 G:0.24786
position 3: T:0.19658 C:0.31624 A:0.17094 G:0.31624
Average T:0.20513 C:0.27920 A:0.20228 G:0.31339
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 4 | Tyr Y TAT 8 | Cys C TGT 8
TTC 0 | TCC 8 | TAC 16 | TGC 8
Leu L TTA 0 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 4 | TCG 4 | TAG 0 | Trp W TGG 8
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 8 | His H CAT 8 | Arg R CGT 8
CTC 12 | CCC 0 | CAC 4 | CGC 8
CTA 12 | CCA 4 | Gln Q CAA 4 | CGA 12
CTG 20 | CCG 12 | CAG 20 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 4 | Ser S AGT 4
ATC 4 | ACC 12 | AAC 4 | AGC 12
ATA 0 | ACA 4 | Lys K AAA 4 | Arg R AGA 4
Met M ATG 16 | ACG 0 | AAG 4 | AGG 0
------------------------------------------------------------------------------
Val V GTT 16 | Ala A GCT 4 | Asp D GAT 8 | Gly G GGT 8
GTC 16 | GCC 16 | GAC 20 | GGC 8
GTA 0 | GCA 8 | Glu E GAA 16 | GGA 8
GTG 20 | GCG 8 | GAG 12 | GGG 8
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15385 C:0.31624 A:0.15385 G:0.37607
position 2: T:0.26496 C:0.20513 A:0.28205 G:0.24786
position 3: T:0.19658 C:0.31624 A:0.17094 G:0.31624
Average T:0.20513 C:0.27920 A:0.20228 G:0.31339
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 6): -469.079425 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.299956 1.299965
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908331_1_1500_MLBR_RS07100: 0.000004, NC_002677_1_NP_302010_1_882_ML1420: 0.000004, NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960: 0.000004, NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.29996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 268.0 83.0 1.3000 0.0000 0.0000 0.0 0.0
5..2 0.000 268.0 83.0 1.3000 0.0000 0.0000 0.0 0.0
5..3 0.000 268.0 83.0 1.3000 0.0000 0.0000 0.0 0.0
5..4 0.000 268.0 83.0 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -469.079411 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.226186 0.758817 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908331_1_1500_MLBR_RS07100: 0.000004, NC_002677_1_NP_302010_1_882_ML1420: 0.000004, NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960: 0.000004, NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.22619
MLEs of dN/dS (w) for site classes (K=2)
p: 0.75882 0.24118
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 269.3 81.7 0.2412 0.0000 0.0000 0.0 0.0
5..2 0.000 269.3 81.7 0.2412 0.0000 0.0000 0.0 0.0
5..3 0.000 269.3 81.7 0.2412 0.0000 0.0000 0.0 0.0
5..4 0.000 269.3 81.7 0.2412 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -469.079418 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.558553 0.572878 0.231424 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908331_1_1500_MLBR_RS07100: 0.000004, NC_002677_1_NP_302010_1_882_ML1420: 0.000004, NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960: 0.000004, NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.55855
MLEs of dN/dS (w) for site classes (K=3)
p: 0.57288 0.23142 0.19570
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 264.0 87.0 0.4271 0.0000 0.0000 0.0 0.0
5..2 0.000 264.0 87.0 0.4271 0.0000 0.0000 0.0 0.0
5..3 0.000 264.0 87.0 0.4271 0.0000 0.0000 0.0 0.0
5..4 0.000 264.0 87.0 0.4271 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908331_1_1500_MLBR_RS07100)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -469.079413 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.539077 0.612669 1.912487
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908331_1_1500_MLBR_RS07100: 0.000004, NC_002677_1_NP_302010_1_882_ML1420: 0.000004, NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960: 0.000004, NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.53908
Parameters in M7 (beta):
p = 0.61267 q = 1.91249
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00363 0.02204 0.05159 0.09145 0.14203 0.20474 0.28233 0.38016 0.51014 0.71311
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 264.3 86.7 0.2401 0.0000 0.0000 0.0 0.0
5..2 0.000 264.3 86.7 0.2401 0.0000 0.0000 0.0 0.0
5..3 0.000 264.3 86.7 0.2401 0.0000 0.0000 0.0 0.0
5..4 0.000 264.3 86.7 0.2401 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -469.079422 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.485607 0.549631 0.977305 1.547796 1.443642
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908331_1_1500_MLBR_RS07100: 0.000004, NC_002677_1_NP_302010_1_882_ML1420: 0.000004, NZ_LVXE01000004_1_WP_010908331_1_1765_A3216_RS02960: 0.000004, NZ_LYPH01000077_1_WP_010908331_1_2598_A8144_RS12510: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.48561
Parameters in M8 (beta&w>1):
p0 = 0.54963 p = 0.97730 q = 1.54780
(p1 = 0.45037) w = 1.44364
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05496 0.05496 0.05496 0.05496 0.05496 0.05496 0.05496 0.05496 0.05496 0.05496 0.45037
w: 0.03030 0.09499 0.16352 0.23603 0.31310 0.39574 0.48559 0.58553 0.70162 0.85303 1.44364
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 265.1 85.9 0.8623 0.0000 0.0000 0.0 0.0
5..2 0.000 265.1 85.9 0.8623 0.0000 0.0000 0.0 0.0
5..3 0.000 265.1 85.9 0.8623 0.0000 0.0000 0.0 0.0
5..4 0.000 265.1 85.9 0.8623 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908331_1_1500_MLBR_RS07100)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908331_1_1500_MLBR_RS07100)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:11
Model 1: NearlyNeutral -469.079411 Model 2: PositiveSelection -469.079418 Model 0: one-ratio -469.079425 Model 7: beta -469.079413 Model 8: beta&w>1 -469.079422 Model 0 vs 1 2.8000000042993634E-5 Model 2 vs 1 1.3999999964653398E-5 Model 8 vs 7 1.8000000068241206E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
