--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:40:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1439/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -450.77 -454.67
2 -450.83 -453.80
--------------------------------------
TOTAL -450.80 -454.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897885 0.089295 0.344640 1.470271 0.865520 1431.14 1466.07 1.000
r(A<->C){all} 0.158490 0.018300 0.000030 0.447328 0.122683 204.86 252.11 1.004
r(A<->G){all} 0.168600 0.021490 0.000080 0.480685 0.126071 185.36 201.30 1.000
r(A<->T){all} 0.170454 0.021158 0.000090 0.450627 0.129797 212.99 240.88 1.000
r(C<->G){all} 0.169292 0.018762 0.000217 0.440570 0.137324 319.66 328.31 1.003
r(C<->T){all} 0.161160 0.018365 0.000059 0.425754 0.128294 274.33 285.68 1.000
r(G<->T){all} 0.172004 0.020828 0.000069 0.463370 0.137361 167.27 207.81 1.000
pi(A){all} 0.201059 0.000481 0.161397 0.245456 0.200608 1308.10 1362.84 1.002
pi(C){all} 0.314125 0.000643 0.265990 0.363353 0.313943 1286.38 1309.25 1.000
pi(G){all} 0.317888 0.000650 0.268543 0.368492 0.317454 1159.09 1244.19 1.000
pi(T){all} 0.166928 0.000405 0.128602 0.206059 0.166339 1208.03 1247.34 1.000
alpha{1,2} 0.417435 0.220183 0.000275 1.357397 0.262032 1176.86 1280.17 1.000
alpha{3} 0.458513 0.231589 0.000128 1.442228 0.304908 1162.95 1230.91 1.000
pinvar{all} 0.994891 0.000040 0.983881 0.999993 0.996896 892.34 1181.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -428.807985
Model 2: PositiveSelection -428.807821
Model 0: one-ratio -428.807821
Model 7: beta -428.807821
Model 8: beta&w>1 -428.807821
Model 0 vs 1 3.2799999996768747E-4
Model 2 vs 1 3.2799999996768747E-4
Model 8 vs 7 0.0
>C1
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C2
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C3
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C4
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C5
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C6
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=111
C1 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C2 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C3 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C4 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C5 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C6 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
**************************************************
C1 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C2 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C3 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C4 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C5 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C6 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
**************************************************
C1 RLDLIRSRRRG
C2 RLDLIRSRRRG
C3 RLDLIRSRRRG
C4 RLDLIRSRRRG
C5 RLDLIRSRRRG
C6 RLDLIRSRRRG
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3330]--->[3330]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.638 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C2 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C3 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C4 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C5 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
C6 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
**************************************************
C1 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C2 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C3 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C4 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C5 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
C6 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
**************************************************
C1 RLDLIRSRRRG
C2 RLDLIRSRRRG
C3 RLDLIRSRRRG
C4 RLDLIRSRRRG
C5 RLDLIRSRRRG
C6 RLDLIRSRRRG
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
C2 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
C3 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
C4 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
C5 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
C6 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
**************************************************
C1 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
C2 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
C3 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
C4 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
C5 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
C6 GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
**************************************************
C1 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
C2 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
C3 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
C4 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
C5 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
C6 CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
**************************************************
C1 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
C2 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
C3 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
C4 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
C5 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
C6 CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
**************************************************
C1 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
C2 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
C3 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
C4 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
C5 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
C6 TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
**************************************************
C1 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
C2 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
C3 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
C4 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
C5 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
C6 TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
**************************************************
C1 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
C2 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
C3 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
C4 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
C5 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
C6 CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
*********************************
>C1
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C2
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C3
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C4
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C5
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C6
ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA
GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA
CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA
CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG
TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA
TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG
CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>C1
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C2
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C3
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C4
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C5
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
>C6
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
RLDLIRSRRRG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 333 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855133
Setting output file names to "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 271178697
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5771744554
Seed = 350681708
Swapseed = 1579855133
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -745.269923 -- -24.965149
Chain 2 -- -745.269923 -- -24.965149
Chain 3 -- -745.269965 -- -24.965149
Chain 4 -- -745.269923 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -745.269965 -- -24.965149
Chain 2 -- -745.269923 -- -24.965149
Chain 3 -- -745.269923 -- -24.965149
Chain 4 -- -745.269923 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-745.270] (-745.270) (-745.270) (-745.270) * [-745.270] (-745.270) (-745.270) (-745.270)
500 -- (-461.793) [-461.325] (-470.753) (-459.912) * (-468.900) [-464.794] (-467.813) (-462.954) -- 0:00:00
1000 -- [-460.821] (-458.223) (-457.814) (-467.856) * (-461.185) [-464.859] (-468.640) (-462.664) -- 0:00:00
1500 -- (-470.072) (-462.468) (-461.775) [-462.347] * (-458.908) [-462.164] (-464.766) (-455.440) -- 0:00:00
2000 -- (-459.681) [-459.224] (-461.940) (-460.321) * [-456.808] (-459.643) (-458.898) (-464.365) -- 0:00:00
2500 -- [-459.684] (-462.179) (-456.473) (-464.770) * (-460.901) (-461.445) [-456.183] (-469.269) -- 0:00:00
3000 -- [-455.256] (-457.407) (-457.446) (-465.136) * (-461.354) [-459.839] (-465.873) (-465.396) -- 0:00:00
3500 -- (-461.662) [-455.641] (-462.411) (-456.842) * (-465.039) [-461.055] (-463.026) (-456.000) -- 0:00:00
4000 -- (-464.888) (-460.713) [-456.258] (-463.442) * [-456.460] (-456.420) (-465.725) (-456.237) -- 0:00:00
4500 -- (-474.958) (-461.186) (-459.232) [-455.099] * [-455.559] (-467.024) (-459.726) (-463.617) -- 0:00:00
5000 -- (-467.312) [-460.262] (-456.853) (-458.752) * (-458.110) [-457.650] (-457.537) (-462.291) -- 0:00:00
Average standard deviation of split frequencies: 0.099243
5500 -- [-458.205] (-461.311) (-459.803) (-465.489) * [-464.276] (-457.757) (-458.324) (-471.019) -- 0:00:00
6000 -- (-462.676) (-458.638) (-457.325) [-460.291] * (-461.962) [-460.952] (-461.225) (-467.405) -- 0:00:00
6500 -- [-458.542] (-456.936) (-456.954) (-461.979) * [-458.339] (-460.600) (-466.170) (-458.828) -- 0:00:00
7000 -- (-466.257) [-457.445] (-467.486) (-457.620) * (-465.432) (-462.225) (-471.906) [-457.211] -- 0:00:00
7500 -- [-458.846] (-464.559) (-461.878) (-466.195) * (-466.611) [-453.357] (-462.659) (-462.532) -- 0:00:00
8000 -- (-462.573) [-454.739] (-458.735) (-463.096) * (-461.282) (-460.247) [-464.961] (-463.341) -- 0:00:00
8500 -- (-458.256) (-462.047) [-471.669] (-471.783) * (-460.330) (-457.587) [-461.279] (-465.134) -- 0:00:00
9000 -- (-461.910) [-462.307] (-465.545) (-461.965) * [-453.810] (-459.046) (-459.705) (-465.954) -- 0:00:00
9500 -- (-464.368) (-461.501) [-455.983] (-462.215) * (-452.309) (-458.832) (-461.643) [-456.068] -- 0:00:00
10000 -- [-459.466] (-459.435) (-465.738) (-460.399) * (-452.903) (-462.183) [-457.778] (-471.421) -- 0:00:00
Average standard deviation of split frequencies: 0.061030
10500 -- (-454.624) [-462.133] (-461.693) (-463.466) * (-455.530) (-460.301) [-457.555] (-463.404) -- 0:01:34
11000 -- (-462.142) [-469.224] (-462.340) (-461.792) * (-451.616) [-455.530] (-458.305) (-465.917) -- 0:01:29
11500 -- (-460.247) [-457.955] (-469.872) (-458.285) * (-450.734) (-463.963) (-461.462) [-460.336] -- 0:01:25
12000 -- (-462.807) (-461.362) (-460.165) [-457.491] * (-449.918) (-463.197) (-462.689) [-458.576] -- 0:01:22
12500 -- [-462.846] (-471.384) (-459.805) (-455.971) * (-450.490) (-467.678) (-470.594) [-464.420] -- 0:01:19
13000 -- (-459.594) (-474.064) (-462.675) [-458.980] * (-451.982) [-463.185] (-457.306) (-463.373) -- 0:01:15
13500 -- (-462.764) (-460.607) (-457.997) [-459.792] * (-451.858) (-458.938) [-450.248] (-455.418) -- 0:01:13
14000 -- [-454.867] (-450.939) (-463.742) (-461.856) * [-450.944] (-457.445) (-450.192) (-462.884) -- 0:01:10
14500 -- (-469.051) (-449.997) [-466.533] (-456.644) * [-453.712] (-464.794) (-453.157) (-462.305) -- 0:01:07
15000 -- (-456.357) [-450.648] (-459.064) (-460.068) * (-450.534) (-459.189) (-451.518) [-459.593] -- 0:01:05
Average standard deviation of split frequencies: 0.076931
15500 -- [-460.011] (-451.646) (-459.086) (-457.097) * [-451.688] (-462.632) (-451.803) (-469.630) -- 0:01:03
16000 -- [-457.502] (-452.159) (-465.252) (-460.366) * (-450.718) [-458.960] (-453.415) (-458.503) -- 0:01:01
16500 -- [-456.224] (-449.678) (-460.676) (-456.827) * (-451.105) (-458.318) (-451.882) [-461.886] -- 0:00:59
17000 -- (-467.282) (-452.630) [-454.235] (-457.229) * (-453.687) [-462.188] (-452.450) (-466.507) -- 0:00:57
17500 -- (-464.323) [-449.881] (-468.096) (-460.936) * (-449.294) [-460.623] (-449.638) (-462.200) -- 0:00:56
18000 -- (-473.652) (-452.363) (-463.851) [-455.135] * (-452.463) (-457.172) (-453.167) [-460.786] -- 0:00:54
18500 -- (-462.690) [-452.289] (-460.366) (-462.227) * [-450.168] (-465.149) (-452.169) (-472.383) -- 0:00:53
19000 -- (-451.181) [-454.780] (-461.713) (-456.672) * (-452.201) [-463.142] (-453.273) (-482.243) -- 0:00:51
19500 -- [-449.654] (-451.391) (-465.805) (-461.723) * (-451.635) (-460.151) [-449.508] (-480.203) -- 0:00:50
20000 -- (-450.837) [-450.583] (-464.016) (-456.466) * (-453.077) [-456.897] (-450.862) (-468.012) -- 0:00:49
Average standard deviation of split frequencies: 0.067162
20500 -- [-450.346] (-450.914) (-467.830) (-464.005) * [-450.066] (-461.655) (-449.816) (-458.065) -- 0:00:47
21000 -- [-454.177] (-454.609) (-466.007) (-457.808) * (-452.410) (-460.571) (-452.914) [-454.039] -- 0:00:46
21500 -- (-450.506) [-450.435] (-461.335) (-468.423) * (-455.507) (-467.136) [-450.200] (-450.952) -- 0:00:45
22000 -- [-450.213] (-456.920) (-467.475) (-464.883) * (-454.376) (-459.417) [-451.753] (-451.828) -- 0:00:44
22500 -- (-450.912) (-453.532) (-464.790) [-458.675] * [-449.903] (-462.524) (-450.048) (-450.677) -- 0:00:43
23000 -- [-455.958] (-450.401) (-468.468) (-463.918) * (-454.920) [-461.295] (-455.624) (-450.990) -- 0:00:42
23500 -- [-450.018] (-451.535) (-465.433) (-460.163) * (-450.975) (-465.015) (-449.820) [-449.817] -- 0:00:41
24000 -- [-449.537] (-450.921) (-459.939) (-465.067) * (-450.774) (-466.037) [-451.010] (-451.430) -- 0:00:40
24500 -- [-450.128] (-451.174) (-454.963) (-461.535) * [-449.454] (-461.610) (-452.328) (-457.081) -- 0:00:39
25000 -- (-453.079) (-452.336) [-455.188] (-462.336) * (-451.359) (-462.612) [-452.395] (-453.562) -- 0:00:39
Average standard deviation of split frequencies: 0.051673
25500 -- (-452.018) (-450.988) (-465.933) [-458.635] * (-451.457) [-460.787] (-452.696) (-453.420) -- 0:00:38
26000 -- (-450.037) (-450.723) (-464.133) [-459.005] * (-451.157) [-459.530] (-452.897) (-451.338) -- 0:00:37
26500 -- (-450.904) (-452.085) [-461.977] (-458.806) * [-451.762] (-465.646) (-451.185) (-451.581) -- 0:00:36
27000 -- (-451.950) (-451.864) [-460.675] (-458.273) * (-451.277) (-468.367) (-454.235) [-449.915] -- 0:00:36
27500 -- [-450.983] (-451.096) (-461.718) (-458.086) * [-451.466] (-462.601) (-450.590) (-450.455) -- 0:01:10
28000 -- (-452.682) (-452.234) (-461.274) [-456.931] * (-451.774) (-468.802) (-450.902) [-453.179] -- 0:01:09
28500 -- [-450.477] (-452.307) (-462.763) (-457.603) * (-450.081) [-461.703] (-451.814) (-454.109) -- 0:01:08
29000 -- (-451.221) (-450.983) [-460.578] (-458.539) * (-451.000) (-465.983) [-451.176] (-454.606) -- 0:01:06
29500 -- (-452.884) (-452.572) (-469.851) [-461.104] * (-452.958) (-460.948) [-451.070] (-449.709) -- 0:01:05
30000 -- (-450.162) (-450.186) [-463.362] (-458.783) * (-450.081) (-466.783) [-450.950] (-450.194) -- 0:01:04
Average standard deviation of split frequencies: 0.041724
30500 -- (-451.122) (-449.836) [-457.902] (-453.596) * (-458.511) [-461.502] (-451.273) (-452.048) -- 0:01:03
31000 -- (-452.256) (-450.854) (-462.588) [-454.677] * (-454.487) [-460.453] (-452.118) (-451.830) -- 0:01:02
31500 -- (-454.460) (-450.902) [-462.305] (-468.479) * (-452.944) (-457.931) (-450.556) [-450.038] -- 0:01:01
32000 -- [-449.645] (-453.291) (-459.882) (-470.260) * (-449.377) [-466.374] (-453.258) (-450.361) -- 0:01:00
32500 -- (-453.260) [-451.676] (-465.145) (-465.135) * (-450.352) [-459.036] (-452.303) (-450.137) -- 0:00:59
33000 -- (-452.812) (-450.563) (-464.392) [-466.007] * (-451.671) [-462.195] (-453.177) (-449.939) -- 0:00:58
33500 -- (-449.842) (-454.497) (-458.981) [-460.398] * (-455.049) (-465.056) (-452.629) [-450.587] -- 0:00:57
34000 -- [-451.719] (-451.464) (-463.451) (-459.076) * (-453.444) (-468.892) (-450.893) [-450.822] -- 0:00:56
34500 -- [-452.665] (-449.546) (-466.100) (-464.651) * (-450.618) (-470.535) [-451.146] (-450.807) -- 0:00:55
35000 -- (-454.563) [-452.496] (-461.782) (-456.399) * [-450.215] (-459.584) (-449.732) (-450.013) -- 0:00:55
Average standard deviation of split frequencies: 0.049261
35500 -- [-450.886] (-451.127) (-457.985) (-464.755) * [-452.861] (-469.012) (-451.269) (-450.227) -- 0:00:54
36000 -- [-452.260] (-453.352) (-469.956) (-474.572) * (-453.141) [-457.859] (-450.237) (-452.745) -- 0:00:53
36500 -- (-452.290) [-449.537] (-460.237) (-464.606) * (-451.383) (-459.217) [-450.397] (-451.568) -- 0:00:52
37000 -- (-450.038) (-450.351) [-458.269] (-450.468) * (-452.804) [-461.009] (-456.170) (-456.811) -- 0:00:52
37500 -- (-451.601) [-452.397] (-454.262) (-450.688) * [-453.236] (-466.167) (-452.033) (-456.447) -- 0:00:51
38000 -- (-451.255) (-450.535) (-449.764) [-451.640] * (-450.207) [-456.541] (-454.907) (-459.115) -- 0:00:50
38500 -- (-454.329) (-450.534) (-450.824) [-453.816] * (-451.744) [-468.497] (-452.318) (-451.509) -- 0:00:49
39000 -- (-454.726) (-450.327) (-452.023) [-450.749] * (-451.188) [-456.173] (-451.508) (-449.275) -- 0:00:49
39500 -- (-455.154) [-449.803] (-450.514) (-450.186) * (-451.420) (-460.629) [-450.173] (-449.578) -- 0:00:48
40000 -- (-455.721) [-452.103] (-450.876) (-449.891) * (-453.198) (-462.041) [-450.683] (-451.778) -- 0:00:48
Average standard deviation of split frequencies: 0.050056
40500 -- [-451.254] (-453.196) (-457.190) (-452.527) * (-451.497) (-453.815) [-452.283] (-452.705) -- 0:00:47
41000 -- (-451.877) (-454.303) (-454.805) [-451.866] * [-452.707] (-460.173) (-454.362) (-450.583) -- 0:00:46
41500 -- (-452.390) (-453.622) [-451.189] (-451.911) * (-452.415) [-460.634] (-450.566) (-454.211) -- 0:00:46
42000 -- (-450.570) (-455.649) (-454.927) [-451.380] * (-451.885) (-461.706) [-451.212] (-452.636) -- 0:00:45
42500 -- (-451.340) (-461.372) [-452.382] (-450.183) * (-452.163) [-460.460] (-452.265) (-454.142) -- 0:00:45
43000 -- (-451.744) (-452.009) (-451.620) [-452.273] * (-450.472) (-469.685) (-455.358) [-452.501] -- 0:00:44
43500 -- (-452.402) (-453.772) [-450.073] (-450.819) * [-449.717] (-459.798) (-452.286) (-451.711) -- 0:00:43
44000 -- [-450.510] (-452.093) (-451.665) (-451.212) * (-454.525) (-474.998) [-451.488] (-454.122) -- 0:00:43
44500 -- (-450.301) (-449.472) (-454.217) [-449.565] * (-451.477) (-460.380) (-452.216) [-453.521] -- 0:01:04
45000 -- (-449.843) (-452.666) [-453.154] (-449.273) * [-452.115] (-457.012) (-450.648) (-452.229) -- 0:01:03
Average standard deviation of split frequencies: 0.041923
45500 -- (-455.721) (-456.196) [-452.641] (-450.800) * (-452.836) [-461.518] (-452.367) (-451.304) -- 0:01:02
46000 -- (-450.337) (-454.602) (-452.939) [-449.816] * (-451.682) (-459.394) [-451.886] (-450.262) -- 0:01:02
46500 -- (-452.466) (-451.162) [-454.621] (-451.582) * [-450.206] (-452.702) (-451.945) (-451.076) -- 0:01:01
47000 -- (-451.123) (-451.423) [-452.331] (-450.516) * [-450.128] (-466.904) (-452.634) (-449.442) -- 0:01:00
47500 -- [-451.335] (-450.252) (-450.556) (-454.523) * (-450.964) (-458.518) (-450.898) [-450.946] -- 0:01:00
48000 -- (-450.326) [-450.512] (-460.641) (-453.097) * (-452.888) (-460.354) [-455.898] (-451.188) -- 0:00:59
48500 -- (-451.555) [-451.546] (-450.526) (-455.228) * (-452.298) [-459.796] (-457.062) (-452.913) -- 0:00:58
49000 -- (-451.270) (-452.575) [-451.211] (-456.968) * (-450.989) [-465.331] (-451.101) (-451.881) -- 0:00:58
49500 -- [-451.438] (-450.554) (-452.629) (-449.032) * (-450.598) [-467.647] (-450.065) (-451.890) -- 0:00:57
50000 -- (-453.142) (-455.261) (-452.437) [-450.274] * (-450.646) (-463.963) [-450.670] (-451.926) -- 0:00:57
Average standard deviation of split frequencies: 0.034679
50500 -- (-450.315) (-449.822) (-452.448) [-452.724] * [-453.246] (-455.095) (-451.029) (-451.259) -- 0:00:56
51000 -- (-451.758) [-450.293] (-450.684) (-453.539) * (-453.230) [-469.257] (-451.591) (-449.993) -- 0:00:55
51500 -- (-450.576) (-451.705) [-453.837] (-459.202) * (-452.568) (-456.648) (-450.567) [-450.293] -- 0:00:55
52000 -- [-452.434] (-451.246) (-451.013) (-454.288) * (-451.015) (-468.861) [-449.875] (-451.732) -- 0:00:54
52500 -- (-450.744) (-454.972) [-454.280] (-451.945) * (-450.442) [-454.847] (-450.328) (-456.132) -- 0:00:54
53000 -- (-455.242) (-452.575) [-452.261] (-450.675) * (-454.015) (-479.313) [-450.674] (-454.667) -- 0:00:53
53500 -- (-450.575) (-450.805) (-451.170) [-450.048] * [-453.543] (-464.348) (-450.086) (-452.446) -- 0:00:53
54000 -- (-449.684) (-451.286) (-452.901) [-452.923] * (-453.966) [-454.647] (-451.505) (-449.626) -- 0:00:52
54500 -- (-451.107) [-450.959] (-455.136) (-452.106) * (-452.802) (-452.050) (-450.352) [-449.986] -- 0:00:52
55000 -- (-450.873) (-449.397) (-455.040) [-453.382] * (-453.488) [-451.164] (-458.561) (-449.738) -- 0:00:51
Average standard deviation of split frequencies: 0.030725
55500 -- (-451.020) (-452.987) [-453.811] (-452.645) * [-452.628] (-451.233) (-450.554) (-450.497) -- 0:00:51
56000 -- [-450.488] (-450.828) (-453.067) (-449.271) * (-451.413) (-453.711) [-453.352] (-450.614) -- 0:00:50
56500 -- (-453.144) [-451.076] (-450.624) (-451.819) * [-452.970] (-456.442) (-454.171) (-452.012) -- 0:00:50
57000 -- (-451.782) [-451.342] (-451.311) (-450.693) * [-450.929] (-451.460) (-453.949) (-453.708) -- 0:00:49
57500 -- (-450.380) (-452.845) [-449.973] (-452.485) * (-449.844) (-453.108) [-450.469] (-449.635) -- 0:00:49
58000 -- (-451.589) (-449.382) (-453.984) [-450.494] * (-452.247) (-449.688) (-454.081) [-449.940] -- 0:00:48
58500 -- (-452.060) [-452.574] (-452.326) (-450.762) * (-452.478) (-450.998) (-449.564) [-451.301] -- 0:00:48
59000 -- [-450.086] (-450.725) (-453.176) (-449.661) * (-450.603) (-451.985) [-450.012] (-450.152) -- 0:00:47
59500 -- (-451.376) (-455.550) (-452.467) [-451.530] * (-455.433) [-451.825] (-450.247) (-455.296) -- 0:00:47
60000 -- (-452.028) [-453.684] (-450.572) (-450.258) * (-450.156) (-449.973) [-452.084] (-452.099) -- 0:00:47
Average standard deviation of split frequencies: 0.032562
60500 -- [-451.238] (-451.957) (-449.868) (-454.144) * [-449.550] (-457.046) (-449.601) (-450.122) -- 0:00:46
61000 -- [-451.033] (-453.247) (-450.561) (-454.168) * [-451.201] (-454.824) (-451.339) (-452.790) -- 0:00:46
61500 -- (-451.424) [-452.489] (-450.763) (-453.082) * [-452.736] (-450.822) (-450.926) (-451.673) -- 0:01:01
62000 -- (-452.250) (-450.968) [-453.260] (-453.066) * (-452.352) (-452.227) [-454.006] (-450.130) -- 0:01:00
62500 -- [-449.529] (-450.552) (-450.597) (-451.899) * (-451.646) (-453.015) (-456.283) [-450.745] -- 0:01:00
63000 -- [-449.659] (-451.738) (-451.162) (-451.235) * (-453.464) [-450.530] (-454.738) (-450.299) -- 0:00:59
63500 -- (-450.821) (-455.226) (-449.894) [-452.341] * [-454.377] (-449.845) (-452.851) (-451.090) -- 0:00:58
64000 -- (-451.147) (-452.314) [-451.394] (-452.901) * [-449.869] (-449.496) (-454.359) (-451.085) -- 0:00:58
64500 -- [-452.035] (-450.531) (-450.587) (-451.462) * [-450.902] (-453.669) (-450.065) (-450.858) -- 0:00:58
65000 -- (-450.224) [-450.343] (-451.149) (-451.324) * (-449.921) [-453.558] (-449.269) (-451.186) -- 0:00:57
Average standard deviation of split frequencies: 0.031291
65500 -- (-449.930) (-451.311) (-452.356) [-449.605] * (-449.799) (-450.725) [-453.306] (-449.422) -- 0:00:57
66000 -- [-450.768] (-452.350) (-450.761) (-451.977) * (-452.619) [-451.513] (-450.267) (-450.912) -- 0:00:56
66500 -- (-456.704) (-449.774) (-449.444) [-452.317] * (-450.333) [-452.596] (-450.735) (-450.347) -- 0:00:56
67000 -- (-453.514) [-449.118] (-450.028) (-452.885) * (-452.039) (-449.262) [-452.021] (-450.601) -- 0:00:55
67500 -- (-453.406) (-452.891) [-451.588] (-451.056) * [-450.932] (-452.316) (-450.924) (-451.071) -- 0:00:55
68000 -- [-450.094] (-450.916) (-452.796) (-451.646) * (-451.283) (-454.311) [-453.050] (-451.269) -- 0:00:54
68500 -- [-451.110] (-454.418) (-452.531) (-450.382) * [-453.074] (-450.756) (-455.808) (-451.898) -- 0:00:54
69000 -- (-450.181) [-451.605] (-452.216) (-450.155) * (-450.099) [-451.442] (-450.750) (-449.159) -- 0:00:53
69500 -- [-450.931] (-452.090) (-450.604) (-455.737) * [-450.079] (-449.725) (-449.455) (-449.155) -- 0:00:53
70000 -- [-453.459] (-460.301) (-449.690) (-451.450) * (-453.043) (-450.101) (-452.341) [-452.247] -- 0:00:53
Average standard deviation of split frequencies: 0.028503
70500 -- (-455.704) (-451.198) (-452.857) [-449.542] * [-452.687] (-450.357) (-452.580) (-450.559) -- 0:00:52
71000 -- (-451.724) [-452.400] (-452.052) (-454.811) * (-452.752) (-451.456) [-451.838] (-449.806) -- 0:00:52
71500 -- [-451.650] (-452.224) (-456.488) (-454.169) * (-450.713) (-451.725) [-457.549] (-451.815) -- 0:00:51
72000 -- (-451.212) (-450.699) [-455.675] (-453.041) * (-450.614) (-451.846) (-454.007) [-451.400] -- 0:00:51
72500 -- (-451.598) [-450.198] (-450.322) (-452.774) * (-452.476) (-452.039) [-452.577] (-453.735) -- 0:00:51
73000 -- (-451.131) (-452.464) [-450.511] (-451.050) * [-452.067] (-453.393) (-449.562) (-450.586) -- 0:00:50
73500 -- (-454.377) (-451.903) (-450.039) [-451.438] * (-452.654) [-450.163] (-450.044) (-454.956) -- 0:00:50
74000 -- [-451.910] (-453.709) (-451.400) (-450.281) * (-451.475) [-451.230] (-451.137) (-457.321) -- 0:00:50
74500 -- [-451.790] (-452.512) (-450.323) (-451.829) * [-449.623] (-452.156) (-451.996) (-456.378) -- 0:00:49
75000 -- [-452.147] (-452.459) (-451.098) (-453.026) * (-451.718) (-451.290) (-451.049) [-450.087] -- 0:00:49
Average standard deviation of split frequencies: 0.030393
75500 -- (-450.079) (-454.591) [-449.979] (-451.704) * (-452.501) (-453.322) (-451.829) [-450.484] -- 0:00:48
76000 -- (-454.141) [-452.822] (-452.174) (-450.117) * (-451.050) [-454.069] (-451.898) (-451.619) -- 0:00:48
76500 -- (-453.235) (-455.530) [-454.304] (-449.875) * (-451.733) (-451.910) [-451.763] (-452.408) -- 0:00:48
77000 -- (-449.866) [-453.908] (-452.335) (-451.393) * (-454.918) (-458.642) (-450.165) [-452.629] -- 0:00:47
77500 -- (-451.189) (-453.442) [-450.257] (-452.237) * [-454.567] (-453.436) (-451.207) (-451.205) -- 0:00:47
78000 -- (-452.118) (-450.020) (-450.532) [-455.478] * (-451.551) (-452.574) [-452.020] (-450.203) -- 0:00:47
78500 -- (-451.683) (-450.987) (-455.528) [-453.709] * [-452.308] (-452.822) (-453.940) (-451.069) -- 0:00:46
79000 -- (-450.561) (-451.124) (-453.725) [-451.551] * (-450.380) [-449.263] (-455.898) (-451.990) -- 0:00:58
79500 -- [-449.724] (-453.259) (-456.760) (-451.864) * [-450.794] (-450.077) (-450.067) (-450.445) -- 0:00:57
80000 -- (-453.515) [-450.828] (-450.786) (-452.001) * [-452.340] (-452.168) (-452.598) (-452.911) -- 0:00:57
Average standard deviation of split frequencies: 0.034414
80500 -- [-449.402] (-452.785) (-453.168) (-452.739) * (-450.517) (-452.810) (-455.499) [-451.032] -- 0:00:57
81000 -- (-452.346) (-452.449) [-451.061] (-450.501) * [-450.061] (-451.714) (-452.177) (-454.209) -- 0:00:56
81500 -- (-449.549) (-453.314) (-453.299) [-450.814] * (-452.274) [-450.407] (-451.646) (-455.616) -- 0:00:56
82000 -- (-451.465) (-449.879) [-450.196] (-452.494) * (-453.534) (-451.607) [-450.850] (-449.909) -- 0:00:55
82500 -- (-451.299) (-449.625) (-450.167) [-455.213] * (-454.061) (-452.618) (-450.234) [-451.563] -- 0:00:55
83000 -- (-450.332) (-456.340) [-449.335] (-453.262) * (-452.228) [-452.619] (-453.211) (-451.137) -- 0:00:55
83500 -- (-450.339) (-453.706) (-450.944) [-449.319] * (-453.822) [-451.639] (-453.118) (-449.863) -- 0:00:54
84000 -- (-449.130) (-452.982) [-456.489] (-449.445) * (-450.128) (-449.504) (-455.276) [-449.785] -- 0:00:54
84500 -- (-451.350) (-463.102) (-451.673) [-454.106] * [-450.599] (-449.552) (-452.204) (-449.360) -- 0:00:54
85000 -- (-449.428) [-451.318] (-451.173) (-451.657) * (-451.036) (-451.140) [-451.684] (-451.204) -- 0:00:53
Average standard deviation of split frequencies: 0.031792
85500 -- (-450.782) [-451.036] (-450.524) (-449.806) * [-452.077] (-452.405) (-453.900) (-452.375) -- 0:00:53
86000 -- (-450.359) (-450.722) (-456.750) [-451.276] * (-452.258) (-451.272) (-452.475) [-451.602] -- 0:00:53
86500 -- (-451.961) (-454.748) [-453.424] (-450.194) * (-452.648) [-450.499] (-450.862) (-450.548) -- 0:00:52
87000 -- (-455.173) (-452.128) [-451.439] (-458.536) * (-450.181) (-452.453) [-450.402] (-459.263) -- 0:00:52
87500 -- [-454.128] (-452.933) (-451.079) (-452.492) * (-454.584) (-451.745) (-449.975) [-450.396] -- 0:00:52
88000 -- (-451.248) [-449.456] (-451.729) (-450.683) * (-450.368) (-451.442) (-450.783) [-450.772] -- 0:00:51
88500 -- [-450.786] (-449.365) (-451.275) (-451.828) * [-449.913] (-449.337) (-451.905) (-451.008) -- 0:00:51
89000 -- (-454.773) (-449.147) (-450.132) [-456.938] * [-451.233] (-452.023) (-450.202) (-454.715) -- 0:00:51
89500 -- (-456.822) [-450.534] (-452.569) (-452.209) * (-450.683) (-456.080) (-449.998) [-452.343] -- 0:00:50
90000 -- (-452.556) [-450.953] (-451.437) (-449.830) * [-450.646] (-451.385) (-450.453) (-450.820) -- 0:00:50
Average standard deviation of split frequencies: 0.029305
90500 -- (-450.493) [-454.385] (-451.145) (-450.785) * (-452.618) [-452.674] (-452.966) (-451.044) -- 0:00:50
91000 -- [-449.972] (-455.275) (-450.105) (-450.482) * (-455.983) [-450.190] (-456.053) (-451.974) -- 0:00:49
91500 -- [-450.278] (-454.549) (-450.719) (-452.469) * [-451.120] (-450.634) (-451.314) (-455.936) -- 0:00:49
92000 -- (-451.598) (-450.073) [-449.320] (-454.162) * (-449.907) (-452.062) [-449.827] (-455.208) -- 0:00:49
92500 -- [-449.930] (-449.627) (-451.963) (-451.821) * (-450.324) [-451.422] (-451.381) (-451.388) -- 0:00:49
93000 -- (-453.295) (-452.069) [-451.221] (-452.804) * (-451.329) (-451.071) [-452.012] (-451.445) -- 0:00:48
93500 -- (-453.485) (-452.370) [-451.450] (-451.093) * (-451.618) (-451.728) [-449.831] (-451.126) -- 0:00:48
94000 -- (-450.733) (-454.465) [-452.366] (-459.017) * (-450.132) [-452.856] (-451.245) (-451.197) -- 0:00:48
94500 -- [-449.339] (-452.153) (-449.746) (-453.040) * [-450.188] (-453.255) (-450.127) (-454.210) -- 0:00:47
95000 -- (-450.326) (-451.095) [-457.379] (-452.787) * (-451.503) [-450.205] (-450.616) (-450.887) -- 0:00:47
Average standard deviation of split frequencies: 0.027912
95500 -- [-450.060] (-454.310) (-452.158) (-451.805) * (-453.350) (-452.398) [-451.623] (-452.493) -- 0:00:47
96000 -- (-450.853) (-453.009) [-449.785] (-450.461) * (-454.075) (-454.099) (-451.804) [-451.741] -- 0:00:56
96500 -- (-449.849) [-451.843] (-449.490) (-451.456) * (-450.293) (-450.194) (-450.687) [-450.925] -- 0:00:56
97000 -- (-452.696) (-451.900) (-449.214) [-450.365] * (-453.166) (-451.757) [-449.510] (-450.041) -- 0:00:55
97500 -- (-452.133) (-450.143) [-449.908] (-452.375) * (-451.997) [-450.375] (-451.035) (-452.257) -- 0:00:55
98000 -- (-452.591) (-451.296) (-449.188) [-452.095] * (-455.417) [-449.228] (-452.123) (-451.918) -- 0:00:55
98500 -- (-452.159) [-450.513] (-450.963) (-451.407) * (-451.491) (-450.624) [-450.309] (-451.919) -- 0:00:54
99000 -- (-450.382) [-456.310] (-450.080) (-452.427) * [-457.752] (-450.362) (-451.295) (-453.936) -- 0:00:54
99500 -- [-452.986] (-455.447) (-450.100) (-450.727) * (-452.245) (-450.704) [-451.278] (-451.510) -- 0:00:54
100000 -- (-454.999) [-452.012] (-450.550) (-451.487) * (-451.470) (-451.197) (-452.634) [-453.821] -- 0:00:54
Average standard deviation of split frequencies: 0.025990
100500 -- (-450.114) [-454.847] (-455.384) (-451.567) * (-453.311) [-451.913] (-456.046) (-449.973) -- 0:00:53
101000 -- (-451.613) (-450.961) (-452.723) [-450.809] * (-450.610) [-449.428] (-452.061) (-452.541) -- 0:00:53
101500 -- (-450.417) (-453.762) [-455.234] (-451.134) * (-450.930) [-453.217] (-452.657) (-449.658) -- 0:00:53
102000 -- (-451.251) (-451.690) [-451.769] (-449.927) * (-450.849) [-451.948] (-452.808) (-449.353) -- 0:00:52
102500 -- (-453.826) [-451.775] (-453.007) (-450.152) * (-450.420) [-453.018] (-450.714) (-450.248) -- 0:00:52
103000 -- (-459.446) [-451.635] (-450.156) (-452.770) * (-449.953) [-451.661] (-451.177) (-452.598) -- 0:00:52
103500 -- (-460.593) [-449.490] (-450.934) (-450.790) * (-452.844) (-452.638) [-451.038] (-451.333) -- 0:00:51
104000 -- [-449.303] (-449.861) (-453.171) (-452.582) * (-451.535) (-453.017) [-450.630] (-450.806) -- 0:00:51
104500 -- [-450.408] (-451.164) (-452.227) (-453.388) * (-451.882) (-452.968) (-450.259) [-451.049] -- 0:00:51
105000 -- [-451.159] (-453.863) (-452.723) (-451.377) * (-449.934) (-450.605) (-450.244) [-449.949] -- 0:00:51
Average standard deviation of split frequencies: 0.026048
105500 -- (-452.957) [-453.758] (-449.531) (-452.300) * (-450.083) [-450.448] (-454.268) (-452.438) -- 0:00:50
106000 -- [-453.769] (-456.121) (-450.954) (-453.379) * (-454.910) (-449.757) (-452.168) [-453.639] -- 0:00:50
106500 -- (-451.514) (-451.121) [-451.262] (-452.716) * (-452.238) [-452.182] (-449.765) (-453.779) -- 0:00:50
107000 -- (-452.750) [-450.712] (-450.474) (-455.828) * (-454.138) [-450.939] (-449.687) (-455.763) -- 0:00:50
107500 -- (-451.606) (-451.907) [-450.331] (-453.809) * (-449.704) [-450.386] (-450.103) (-451.849) -- 0:00:49
108000 -- (-451.629) (-454.423) [-449.706] (-451.857) * (-451.856) [-453.872] (-451.648) (-452.224) -- 0:00:49
108500 -- [-451.975] (-455.965) (-451.750) (-450.457) * [-450.927] (-452.892) (-456.850) (-452.598) -- 0:00:49
109000 -- (-451.997) (-459.913) [-450.984] (-451.529) * [-450.787] (-454.107) (-452.765) (-450.563) -- 0:00:49
109500 -- (-451.516) [-451.526] (-450.637) (-455.495) * [-452.282] (-452.415) (-450.055) (-450.492) -- 0:00:48
110000 -- [-450.428] (-452.016) (-451.281) (-453.423) * (-453.979) [-450.542] (-450.382) (-452.930) -- 0:00:48
Average standard deviation of split frequencies: 0.020487
110500 -- (-451.534) (-449.867) [-450.712] (-451.577) * [-451.359] (-450.569) (-451.960) (-449.412) -- 0:00:48
111000 -- (-453.166) (-450.555) [-450.938] (-451.243) * (-453.263) [-452.106] (-450.527) (-452.272) -- 0:00:48
111500 -- [-450.566] (-450.692) (-451.887) (-452.290) * [-449.428] (-452.113) (-451.182) (-452.108) -- 0:00:47
112000 -- (-451.490) (-453.373) (-454.375) [-451.629] * (-451.339) (-454.304) [-449.728] (-453.835) -- 0:00:47
112500 -- [-451.134] (-450.775) (-457.555) (-450.578) * [-451.230] (-453.855) (-453.810) (-452.756) -- 0:00:55
113000 -- [-449.533] (-450.790) (-452.516) (-451.829) * [-451.402] (-450.113) (-453.778) (-451.096) -- 0:00:54
113500 -- (-450.695) (-449.967) [-451.381] (-460.240) * (-453.931) (-450.017) (-449.892) [-452.073] -- 0:00:54
114000 -- (-450.110) [-452.826] (-451.216) (-454.969) * (-453.093) (-450.970) [-449.894] (-450.385) -- 0:00:54
114500 -- (-451.811) (-450.854) (-450.664) [-449.679] * (-453.858) (-454.864) [-452.840] (-450.191) -- 0:00:54
115000 -- (-452.541) (-450.082) (-453.336) [-451.847] * (-452.526) (-451.410) (-451.435) [-452.899] -- 0:00:53
Average standard deviation of split frequencies: 0.019932
115500 -- (-451.258) [-449.250] (-451.966) (-453.068) * (-450.035) (-450.341) (-451.149) [-451.932] -- 0:00:53
116000 -- (-451.632) (-451.214) (-451.109) [-453.409] * [-450.225] (-450.763) (-459.314) (-449.654) -- 0:00:53
116500 -- (-450.926) (-450.456) (-450.059) [-449.900] * [-450.106] (-451.662) (-450.037) (-451.008) -- 0:00:53
117000 -- (-451.905) (-451.616) [-449.880] (-452.070) * (-453.521) (-450.430) [-450.869] (-453.673) -- 0:00:52
117500 -- (-450.712) (-450.155) (-450.517) [-449.605] * (-452.370) [-449.422] (-450.858) (-452.010) -- 0:00:52
118000 -- (-450.282) (-450.744) (-450.078) [-453.509] * (-455.347) (-451.664) (-451.339) [-451.439] -- 0:00:52
118500 -- (-450.160) [-449.986] (-450.206) (-451.567) * (-451.097) [-449.920] (-451.495) (-451.086) -- 0:00:52
119000 -- (-454.291) [-449.814] (-450.914) (-452.157) * [-450.465] (-453.771) (-451.068) (-452.147) -- 0:00:51
119500 -- (-456.778) (-453.963) [-451.201] (-453.063) * (-451.280) [-450.877] (-452.587) (-453.860) -- 0:00:51
120000 -- (-454.554) (-452.227) [-452.476] (-451.176) * (-451.128) (-451.397) (-451.107) [-449.772] -- 0:00:51
Average standard deviation of split frequencies: 0.019099
120500 -- [-453.344] (-455.202) (-450.424) (-450.646) * (-451.465) [-450.018] (-450.618) (-451.778) -- 0:00:51
121000 -- (-456.800) (-455.673) [-450.076] (-451.493) * (-450.266) [-450.662] (-451.993) (-451.605) -- 0:00:50
121500 -- (-450.622) (-451.203) (-452.700) [-449.856] * (-451.816) [-453.192] (-451.822) (-450.707) -- 0:00:50
122000 -- (-450.803) (-454.266) (-450.343) [-452.201] * [-452.072] (-458.117) (-449.668) (-451.239) -- 0:00:50
122500 -- [-451.078] (-455.115) (-455.405) (-450.627) * (-455.650) (-454.298) (-450.016) [-451.181] -- 0:00:50
123000 -- [-450.961] (-451.788) (-455.157) (-452.090) * (-450.888) (-453.322) (-458.221) [-450.729] -- 0:00:49
123500 -- (-452.159) (-454.724) [-451.130] (-452.327) * (-451.709) (-453.835) (-452.185) [-452.359] -- 0:00:49
124000 -- (-450.037) (-452.756) (-451.782) [-450.610] * [-452.350] (-454.265) (-452.136) (-451.287) -- 0:00:49
124500 -- (-449.403) [-452.000] (-452.101) (-453.714) * [-450.674] (-451.244) (-449.640) (-452.606) -- 0:00:49
125000 -- (-452.667) (-450.616) [-451.704] (-452.706) * (-450.821) (-455.377) [-453.086] (-453.617) -- 0:00:49
Average standard deviation of split frequencies: 0.018172
125500 -- (-450.286) (-450.441) [-452.282] (-451.675) * (-450.141) (-449.984) (-455.974) [-452.150] -- 0:00:48
126000 -- (-450.481) [-450.132] (-451.212) (-450.054) * [-450.266] (-449.655) (-453.877) (-453.098) -- 0:00:48
126500 -- [-451.223] (-449.671) (-452.089) (-449.990) * (-452.097) (-452.164) [-450.253] (-454.006) -- 0:00:48
127000 -- (-456.826) [-451.445] (-451.782) (-454.388) * (-451.624) (-450.545) (-452.129) [-455.730] -- 0:00:48
127500 -- [-450.301] (-454.304) (-454.153) (-452.033) * (-454.421) (-449.513) (-451.090) [-451.778] -- 0:00:47
128000 -- [-452.000] (-452.704) (-451.921) (-451.582) * (-452.815) (-450.479) (-454.020) [-450.359] -- 0:00:47
128500 -- (-451.435) (-455.187) (-449.579) [-451.143] * (-451.386) (-450.015) [-451.195] (-452.503) -- 0:00:47
129000 -- (-449.979) (-449.763) (-452.975) [-450.194] * [-451.564] (-451.359) (-451.497) (-450.186) -- 0:00:47
129500 -- (-450.285) (-450.059) [-449.593] (-454.685) * (-450.326) (-449.303) [-454.391] (-450.879) -- 0:00:53
130000 -- (-450.762) [-450.454] (-453.091) (-450.495) * [-451.928] (-451.597) (-451.239) (-450.889) -- 0:00:53
Average standard deviation of split frequencies: 0.017858
130500 -- (-452.011) [-450.908] (-450.083) (-449.534) * (-452.927) [-451.959] (-450.673) (-450.385) -- 0:00:53
131000 -- (-450.666) (-454.742) [-452.022] (-453.920) * (-451.400) [-450.236] (-453.017) (-452.908) -- 0:00:53
131500 -- (-455.065) [-451.337] (-451.216) (-452.167) * (-452.461) (-452.041) [-451.801] (-453.612) -- 0:00:52
132000 -- (-454.838) (-451.783) (-451.807) [-451.611] * [-454.741] (-450.818) (-454.646) (-450.191) -- 0:00:52
132500 -- (-454.387) (-451.933) (-453.932) [-450.182] * (-450.288) (-451.082) [-456.031] (-452.961) -- 0:00:52
133000 -- (-451.594) (-459.061) (-450.741) [-451.121] * (-449.611) (-450.590) (-450.735) [-450.686] -- 0:00:52
133500 -- (-451.726) (-461.039) (-449.938) [-453.012] * (-451.803) [-450.793] (-458.661) (-450.153) -- 0:00:51
134000 -- [-450.797] (-462.403) (-449.693) (-450.511) * (-449.580) [-452.391] (-450.202) (-451.449) -- 0:00:51
134500 -- (-452.021) (-452.592) [-449.595] (-453.550) * (-451.210) (-451.085) [-449.144] (-452.754) -- 0:00:51
135000 -- [-450.477] (-451.745) (-449.765) (-453.982) * [-451.685] (-450.976) (-450.873) (-451.517) -- 0:00:51
Average standard deviation of split frequencies: 0.016984
135500 -- (-451.934) (-456.348) (-450.867) [-449.813] * (-452.372) (-453.741) (-451.205) [-451.421] -- 0:00:51
136000 -- [-454.011] (-450.333) (-453.558) (-451.373) * (-453.180) (-452.446) (-451.656) [-451.006] -- 0:00:50
136500 -- [-453.701] (-449.784) (-453.552) (-452.916) * [-450.736] (-453.845) (-452.162) (-452.521) -- 0:00:50
137000 -- (-451.104) [-450.650] (-452.202) (-452.726) * (-449.608) [-452.537] (-452.200) (-450.489) -- 0:00:50
137500 -- (-450.812) (-451.802) [-451.397] (-450.990) * (-450.801) [-452.091] (-451.475) (-450.348) -- 0:00:50
138000 -- (-451.169) (-450.456) (-452.559) [-450.062] * [-453.142] (-452.187) (-452.214) (-457.834) -- 0:00:49
138500 -- [-449.297] (-450.993) (-450.230) (-455.852) * (-450.692) (-451.811) [-453.650] (-454.426) -- 0:00:49
139000 -- (-449.898) (-452.856) (-452.420) [-452.163] * [-450.517] (-452.399) (-451.882) (-451.769) -- 0:00:49
139500 -- [-451.921] (-453.101) (-453.769) (-449.363) * (-456.526) (-451.621) (-453.306) [-452.492] -- 0:00:49
140000 -- (-451.551) (-451.952) (-450.092) [-449.550] * (-449.928) (-450.617) (-450.370) [-451.849] -- 0:00:49
Average standard deviation of split frequencies: 0.019437
140500 -- (-451.175) (-457.763) [-451.227] (-449.619) * (-456.622) (-451.563) (-450.370) [-452.155] -- 0:00:48
141000 -- (-449.648) (-454.499) (-451.187) [-449.883] * (-454.987) (-451.815) (-450.054) [-452.062] -- 0:00:48
141500 -- (-454.640) (-453.659) (-449.749) [-453.178] * (-451.339) [-450.297] (-454.296) (-452.135) -- 0:00:48
142000 -- (-453.425) (-450.429) (-451.056) [-449.359] * (-454.231) [-453.274] (-449.743) (-450.102) -- 0:00:48
142500 -- [-451.816] (-452.089) (-452.158) (-449.761) * [-453.303] (-449.953) (-451.339) (-451.604) -- 0:00:48
143000 -- (-453.525) (-450.661) [-449.567] (-453.639) * [-452.496] (-453.949) (-455.195) (-452.285) -- 0:00:47
143500 -- (-451.417) (-453.343) [-451.027] (-453.755) * (-449.876) (-451.054) [-451.574] (-450.947) -- 0:00:47
144000 -- (-449.604) (-449.354) [-451.823] (-451.190) * (-452.564) (-450.511) [-449.680] (-454.489) -- 0:00:47
144500 -- [-452.387] (-451.887) (-451.095) (-449.931) * (-451.530) [-450.785] (-451.513) (-452.673) -- 0:00:47
145000 -- (-452.629) (-450.604) (-451.667) [-451.837] * (-452.033) [-452.705] (-453.085) (-457.239) -- 0:00:47
Average standard deviation of split frequencies: 0.020019
145500 -- (-450.181) (-451.416) [-450.976] (-450.346) * (-452.418) (-449.773) (-451.668) [-454.759] -- 0:00:46
146000 -- (-449.831) (-450.215) (-450.718) [-450.642] * (-449.979) (-454.112) [-451.630] (-449.255) -- 0:00:46
146500 -- (-451.031) (-454.350) (-450.235) [-451.942] * [-453.237] (-451.032) (-451.159) (-455.063) -- 0:00:52
147000 -- [-450.988] (-451.890) (-454.333) (-454.253) * (-454.089) [-449.842] (-454.070) (-454.196) -- 0:00:52
147500 -- (-450.198) (-453.631) [-451.742] (-453.983) * (-449.923) (-450.099) (-453.819) [-451.034] -- 0:00:52
148000 -- [-449.388] (-456.844) (-449.449) (-451.477) * (-453.150) (-450.695) [-453.913] (-450.473) -- 0:00:51
148500 -- [-450.063] (-450.947) (-451.483) (-451.660) * (-457.282) [-451.981] (-452.595) (-451.388) -- 0:00:51
149000 -- (-450.694) (-452.526) [-451.880] (-451.251) * (-454.876) [-450.708] (-451.258) (-449.678) -- 0:00:51
149500 -- (-453.046) (-451.533) [-450.040] (-450.556) * (-450.976) (-451.328) (-453.104) [-451.052] -- 0:00:51
150000 -- (-449.475) (-455.711) (-449.462) [-453.090] * (-451.053) [-449.974] (-449.436) (-451.328) -- 0:00:51
Average standard deviation of split frequencies: 0.020024
150500 -- (-449.883) (-452.471) (-450.505) [-449.193] * (-452.545) (-450.071) [-449.342] (-449.970) -- 0:00:50
151000 -- (-449.978) [-456.354] (-451.573) (-456.855) * (-453.148) [-449.342] (-452.799) (-451.924) -- 0:00:50
151500 -- (-450.461) (-450.613) (-451.746) [-455.357] * (-451.226) (-452.910) [-451.798] (-452.863) -- 0:00:50
152000 -- [-450.689] (-452.218) (-454.727) (-457.466) * (-451.009) [-451.369] (-453.871) (-450.709) -- 0:00:50
152500 -- (-451.864) (-454.593) (-451.386) [-451.500] * (-456.222) (-452.662) (-450.686) [-452.279] -- 0:00:50
153000 -- (-450.841) (-451.517) (-454.363) [-451.346] * (-453.505) (-450.059) [-450.891] (-449.890) -- 0:00:49
153500 -- (-451.998) (-453.253) (-453.228) [-450.162] * (-452.316) (-450.782) (-450.986) [-453.777] -- 0:00:49
154000 -- [-449.754] (-451.216) (-450.663) (-454.916) * (-451.747) (-452.804) (-451.570) [-452.660] -- 0:00:49
154500 -- (-451.497) (-450.193) [-450.339] (-451.201) * (-451.685) [-451.898] (-450.547) (-451.437) -- 0:00:49
155000 -- (-455.622) (-451.235) (-451.650) [-452.098] * (-452.491) (-452.665) [-451.283] (-452.535) -- 0:00:49
Average standard deviation of split frequencies: 0.020548
155500 -- [-454.491] (-451.213) (-453.182) (-455.739) * (-451.143) [-450.028] (-451.945) (-452.430) -- 0:00:48
156000 -- [-455.478] (-451.907) (-451.783) (-453.129) * (-450.440) [-450.368] (-454.698) (-450.903) -- 0:00:48
156500 -- [-453.001] (-453.939) (-450.469) (-449.940) * (-449.864) (-457.226) (-453.398) [-451.589] -- 0:00:48
157000 -- [-452.135] (-455.089) (-451.607) (-451.409) * (-451.028) [-451.722] (-457.059) (-450.973) -- 0:00:48
157500 -- [-453.341] (-455.989) (-455.197) (-453.458) * (-452.469) [-453.347] (-453.170) (-450.134) -- 0:00:48
158000 -- (-449.900) (-455.473) (-451.547) [-453.849] * (-453.218) (-455.147) (-450.153) [-453.535] -- 0:00:47
158500 -- (-454.270) (-453.342) (-450.869) [-451.441] * (-452.083) [-449.955] (-450.203) (-457.648) -- 0:00:47
159000 -- [-458.750] (-457.707) (-449.930) (-451.362) * [-450.291] (-450.230) (-451.956) (-449.841) -- 0:00:47
159500 -- (-460.046) (-456.643) (-451.489) [-450.786] * [-450.234] (-451.235) (-454.487) (-451.211) -- 0:00:47
160000 -- (-451.023) [-458.281] (-454.479) (-451.586) * (-449.908) [-449.368] (-450.088) (-452.347) -- 0:00:47
Average standard deviation of split frequencies: 0.023619
160500 -- (-449.990) [-450.186] (-455.118) (-452.191) * (-450.155) [-450.736] (-455.972) (-451.221) -- 0:00:47
161000 -- [-455.442] (-454.315) (-452.436) (-453.010) * (-451.279) [-453.283] (-451.742) (-455.957) -- 0:00:46
161500 -- [-454.526] (-457.842) (-450.570) (-450.921) * [-452.228] (-452.047) (-456.641) (-450.433) -- 0:00:46
162000 -- [-451.900] (-451.512) (-453.492) (-454.464) * (-449.280) (-451.989) [-453.782] (-451.482) -- 0:00:46
162500 -- (-452.623) (-449.821) [-453.542] (-458.331) * (-449.918) (-454.121) (-450.354) [-450.221] -- 0:00:46
163000 -- (-451.539) [-450.148] (-450.709) (-453.056) * (-450.380) (-454.441) [-451.943] (-451.135) -- 0:00:51
163500 -- (-451.383) [-449.810] (-452.279) (-452.758) * (-450.033) (-451.657) [-451.309] (-452.037) -- 0:00:51
164000 -- [-451.103] (-451.779) (-452.450) (-452.791) * (-449.237) [-455.537] (-452.341) (-454.363) -- 0:00:50
164500 -- [-453.689] (-454.826) (-453.105) (-458.620) * (-451.280) (-455.988) (-453.567) [-452.101] -- 0:00:50
165000 -- (-450.178) (-450.901) (-451.534) [-453.252] * [-450.035] (-455.361) (-452.579) (-453.112) -- 0:00:50
Average standard deviation of split frequencies: 0.023428
165500 -- (-450.918) (-453.382) (-451.079) [-450.049] * (-451.574) (-454.698) (-451.206) [-453.109] -- 0:00:50
166000 -- [-450.562] (-451.698) (-453.685) (-454.007) * (-454.263) [-451.507] (-450.765) (-451.278) -- 0:00:50
166500 -- [-449.506] (-454.262) (-453.754) (-452.172) * [-450.706] (-450.956) (-454.113) (-450.774) -- 0:00:50
167000 -- [-450.401] (-449.981) (-453.859) (-451.845) * (-451.500) [-450.176] (-452.675) (-451.564) -- 0:00:49
167500 -- [-451.290] (-453.559) (-451.781) (-457.678) * (-452.021) (-454.890) (-451.204) [-451.984] -- 0:00:49
168000 -- (-450.433) (-451.415) [-450.805] (-450.706) * (-454.548) (-454.272) (-449.736) [-450.577] -- 0:00:49
168500 -- [-451.015] (-450.803) (-450.684) (-450.932) * [-453.703] (-450.710) (-450.767) (-452.584) -- 0:00:49
169000 -- (-451.224) [-451.510] (-455.983) (-450.597) * [-449.985] (-454.138) (-450.490) (-452.369) -- 0:00:49
169500 -- (-450.123) (-449.828) [-450.126] (-450.363) * (-451.251) (-457.090) (-451.135) [-450.410] -- 0:00:48
170000 -- (-450.467) (-452.483) (-452.904) [-451.419] * (-450.736) (-449.324) (-454.655) [-450.457] -- 0:00:48
Average standard deviation of split frequencies: 0.021079
170500 -- [-449.978] (-451.234) (-453.563) (-451.740) * [-450.070] (-450.942) (-453.955) (-452.416) -- 0:00:48
171000 -- (-450.009) (-450.065) (-452.815) [-452.088] * (-452.164) [-450.178] (-453.681) (-450.437) -- 0:00:48
171500 -- (-450.703) (-453.191) [-449.645] (-455.122) * [-452.056] (-449.981) (-454.684) (-450.731) -- 0:00:48
172000 -- [-450.637] (-449.842) (-450.276) (-452.453) * (-450.424) [-451.142] (-453.824) (-452.480) -- 0:00:48
172500 -- [-451.387] (-450.700) (-451.622) (-450.020) * (-452.116) [-449.491] (-451.246) (-452.550) -- 0:00:47
173000 -- [-451.602] (-449.387) (-453.942) (-452.471) * (-451.302) (-450.233) [-454.110] (-454.854) -- 0:00:47
173500 -- (-449.865) (-451.417) (-452.858) [-449.933] * [-450.169] (-450.923) (-451.538) (-453.911) -- 0:00:47
174000 -- (-450.763) (-451.806) (-450.775) [-450.390] * (-449.470) (-458.934) [-450.933] (-452.850) -- 0:00:47
174500 -- (-450.778) (-454.802) (-450.256) [-454.011] * (-450.661) (-455.131) (-450.736) [-453.178] -- 0:00:47
175000 -- (-450.922) [-452.209] (-450.345) (-455.742) * (-453.666) (-452.267) (-450.234) [-450.761] -- 0:00:47
Average standard deviation of split frequencies: 0.019047
175500 -- (-450.912) (-455.780) [-450.863] (-451.857) * (-451.990) (-450.053) (-452.079) [-450.665] -- 0:00:46
176000 -- (-452.150) [-449.821] (-451.984) (-450.013) * (-451.511) (-451.182) (-450.020) [-450.625] -- 0:00:46
176500 -- (-452.893) (-451.443) [-453.433] (-451.450) * (-451.397) [-455.609] (-452.110) (-453.976) -- 0:00:46
177000 -- [-450.635] (-451.013) (-449.628) (-450.733) * (-454.680) (-450.348) (-450.101) [-449.938] -- 0:00:46
177500 -- (-453.965) (-453.236) [-450.385] (-449.859) * (-451.811) [-449.079] (-457.921) (-452.744) -- 0:00:46
178000 -- (-451.627) (-456.563) (-450.063) [-451.046] * (-452.027) (-451.303) [-454.925] (-454.159) -- 0:00:46
178500 -- [-449.254] (-452.389) (-452.167) (-451.373) * (-453.006) (-450.868) [-452.175] (-450.115) -- 0:00:46
179000 -- (-449.146) [-452.821] (-450.982) (-450.658) * (-450.575) (-455.287) (-451.116) [-450.761] -- 0:00:45
179500 -- (-451.181) (-451.451) (-451.466) [-449.690] * (-450.282) [-455.087] (-455.533) (-454.130) -- 0:00:45
180000 -- [-452.472] (-449.483) (-452.599) (-449.300) * (-451.259) [-452.755] (-457.158) (-452.165) -- 0:00:45
Average standard deviation of split frequencies: 0.019714
180500 -- (-456.418) (-450.723) [-450.726] (-449.839) * (-454.171) (-450.491) (-453.129) [-450.973] -- 0:00:49
181000 -- (-449.418) [-450.412] (-450.233) (-449.562) * [-451.492] (-451.524) (-452.644) (-459.223) -- 0:00:49
181500 -- (-451.331) (-452.014) [-455.298] (-449.665) * [-452.847] (-450.524) (-449.691) (-451.501) -- 0:00:49
182000 -- (-452.751) [-452.437] (-452.561) (-449.500) * (-454.179) [-450.747] (-453.916) (-452.027) -- 0:00:49
182500 -- (-450.372) (-451.393) (-455.253) [-452.124] * (-449.943) [-450.596] (-452.131) (-454.902) -- 0:00:49
183000 -- (-451.995) [-450.832] (-452.274) (-453.415) * (-451.217) (-453.694) (-450.245) [-452.983] -- 0:00:49
183500 -- (-450.093) (-451.227) (-450.884) [-449.943] * (-449.862) [-450.084] (-455.284) (-454.631) -- 0:00:48
184000 -- (-451.714) [-450.202] (-453.639) (-450.040) * (-450.153) (-450.963) (-454.810) [-451.699] -- 0:00:48
184500 -- (-453.392) (-454.288) (-452.581) [-450.657] * (-449.992) (-455.768) [-453.268] (-451.401) -- 0:00:48
185000 -- (-451.490) (-451.868) [-451.493] (-453.330) * (-453.248) (-453.923) (-451.356) [-450.276] -- 0:00:48
Average standard deviation of split frequencies: 0.018867
185500 -- (-453.336) (-451.504) (-451.082) [-453.324] * (-451.323) (-453.893) [-450.882] (-451.760) -- 0:00:48
186000 -- (-451.414) [-452.697] (-452.150) (-453.131) * (-450.407) [-453.491] (-456.343) (-449.710) -- 0:00:48
186500 -- (-450.423) (-449.561) (-455.160) [-450.927] * (-450.919) (-450.286) (-453.721) [-451.458] -- 0:00:47
187000 -- (-452.307) (-449.759) [-452.136] (-449.703) * (-449.795) (-453.444) (-455.531) [-451.006] -- 0:00:47
187500 -- (-451.130) (-450.537) (-452.224) [-452.288] * [-453.495] (-450.767) (-449.754) (-453.925) -- 0:00:47
188000 -- (-449.496) (-450.627) (-452.245) [-452.115] * (-453.579) (-451.781) (-450.078) [-458.681] -- 0:00:47
188500 -- [-449.901] (-450.679) (-451.833) (-450.292) * (-453.818) (-449.832) (-451.237) [-454.617] -- 0:00:47
189000 -- [-450.463] (-451.348) (-453.824) (-451.660) * (-452.409) [-450.265] (-451.188) (-455.158) -- 0:00:47
189500 -- (-451.079) (-455.149) (-450.742) [-452.104] * (-453.725) (-450.914) [-450.405] (-452.313) -- 0:00:47
190000 -- [-450.708] (-451.085) (-452.869) (-450.355) * [-451.255] (-451.652) (-451.985) (-453.420) -- 0:00:46
Average standard deviation of split frequencies: 0.018406
190500 -- [-451.257] (-452.026) (-450.186) (-450.678) * (-451.138) [-451.810] (-450.036) (-451.940) -- 0:00:46
191000 -- (-449.893) (-456.071) [-453.168] (-450.010) * (-451.226) [-454.001] (-454.525) (-451.870) -- 0:00:46
191500 -- (-449.589) (-451.084) [-453.952] (-452.391) * (-451.032) (-451.353) [-450.939] (-450.455) -- 0:00:46
192000 -- [-451.566] (-451.801) (-451.410) (-450.607) * (-453.114) (-453.897) [-450.394] (-451.068) -- 0:00:46
192500 -- (-452.495) (-452.161) (-451.131) [-451.025] * (-455.072) (-453.406) (-452.654) [-449.661] -- 0:00:46
193000 -- (-454.157) (-453.569) (-452.174) [-449.653] * [-449.884] (-451.767) (-451.479) (-450.178) -- 0:00:45
193500 -- (-455.722) (-452.366) (-453.569) [-449.630] * (-452.991) (-456.596) (-454.630) [-450.137] -- 0:00:45
194000 -- (-451.101) (-449.841) (-459.048) [-449.581] * (-450.206) (-451.242) (-450.296) [-452.530] -- 0:00:45
194500 -- (-453.878) (-450.109) (-451.528) [-455.581] * (-452.375) (-452.334) [-450.564] (-452.631) -- 0:00:45
195000 -- (-451.148) (-451.316) [-450.118] (-453.208) * (-451.537) [-450.000] (-450.053) (-450.043) -- 0:00:45
Average standard deviation of split frequencies: 0.017370
195500 -- (-453.769) (-450.309) (-452.895) [-449.662] * (-450.748) [-451.269] (-452.007) (-452.025) -- 0:00:45
196000 -- (-450.981) [-451.586] (-453.042) (-451.218) * (-452.816) (-450.636) (-451.316) [-449.955] -- 0:00:45
196500 -- [-451.063] (-452.536) (-452.818) (-451.548) * (-450.075) (-453.232) (-453.701) [-451.620] -- 0:00:44
197000 -- (-454.124) [-453.377] (-451.525) (-454.720) * (-450.844) (-455.573) (-450.875) [-450.013] -- 0:00:48
197500 -- [-451.963] (-454.377) (-451.794) (-450.597) * (-456.206) [-457.054] (-451.883) (-450.198) -- 0:00:48
198000 -- (-449.442) [-450.957] (-450.247) (-453.011) * (-451.871) [-453.024] (-452.208) (-453.736) -- 0:00:48
198500 -- (-449.868) (-450.696) (-449.787) [-450.794] * (-452.103) (-451.008) (-451.101) [-454.464] -- 0:00:48
199000 -- (-449.076) (-450.480) [-453.246] (-453.894) * [-451.660] (-454.370) (-452.293) (-455.799) -- 0:00:48
199500 -- [-449.156] (-451.145) (-450.626) (-450.280) * (-455.299) [-451.297] (-458.896) (-453.943) -- 0:00:48
200000 -- (-451.924) [-451.339] (-449.793) (-453.069) * [-450.103] (-453.154) (-452.273) (-454.860) -- 0:00:48
Average standard deviation of split frequencies: 0.020866
200500 -- (-452.649) (-450.415) (-451.150) [-451.165] * (-451.532) (-453.669) (-455.035) [-453.191] -- 0:00:47
201000 -- (-453.716) [-451.018] (-452.171) (-449.626) * (-451.277) [-453.933] (-451.555) (-449.938) -- 0:00:47
201500 -- (-454.624) [-455.423] (-450.922) (-450.788) * [-454.006] (-453.514) (-450.912) (-452.017) -- 0:00:47
202000 -- (-449.451) (-453.191) [-454.801] (-450.930) * (-450.116) (-453.369) (-454.474) [-449.794] -- 0:00:47
202500 -- (-449.555) (-450.336) [-450.343] (-450.915) * [-452.376] (-451.832) (-449.855) (-453.002) -- 0:00:47
203000 -- [-451.159] (-450.288) (-450.232) (-450.911) * (-451.913) (-452.828) (-451.050) [-449.964] -- 0:00:47
203500 -- (-451.450) (-453.099) (-449.448) [-453.002] * (-451.268) (-450.468) [-451.784] (-450.668) -- 0:00:46
204000 -- (-450.925) (-449.937) (-449.854) [-455.386] * [-451.073] (-450.653) (-450.570) (-455.952) -- 0:00:46
204500 -- [-452.794] (-450.095) (-449.952) (-458.460) * [-451.455] (-451.007) (-450.197) (-453.898) -- 0:00:46
205000 -- (-451.634) [-449.999] (-450.830) (-455.759) * (-451.733) (-450.019) (-449.591) [-452.226] -- 0:00:46
Average standard deviation of split frequencies: 0.020850
205500 -- (-450.545) (-451.024) [-449.746] (-459.122) * (-451.640) [-452.667] (-453.317) (-449.922) -- 0:00:46
206000 -- (-452.712) [-453.535] (-450.228) (-453.398) * (-450.385) (-451.818) (-452.150) [-449.497] -- 0:00:46
206500 -- (-451.997) (-449.931) (-450.842) [-449.629] * (-450.466) (-450.756) (-452.867) [-451.128] -- 0:00:46
207000 -- (-449.747) (-450.806) [-453.776] (-452.970) * (-452.641) [-453.534] (-456.061) (-455.900) -- 0:00:45
207500 -- [-450.142] (-449.319) (-449.987) (-452.243) * (-453.807) [-450.760] (-453.954) (-452.887) -- 0:00:45
208000 -- (-452.480) (-451.399) [-452.659] (-454.432) * (-451.987) (-449.493) [-451.525] (-452.175) -- 0:00:45
208500 -- (-451.339) (-455.015) [-452.002] (-452.158) * (-451.628) (-450.476) (-450.974) [-452.561] -- 0:00:45
209000 -- (-451.675) (-450.109) [-453.399] (-453.236) * (-450.247) [-450.156] (-450.783) (-450.219) -- 0:00:45
209500 -- (-451.640) [-451.105] (-452.346) (-450.097) * (-451.160) (-453.937) (-455.670) [-449.899] -- 0:00:45
210000 -- (-450.600) (-451.033) (-451.036) [-451.998] * (-455.464) [-452.115] (-454.803) (-449.339) -- 0:00:45
Average standard deviation of split frequencies: 0.020015
210500 -- (-451.644) (-450.878) [-451.695] (-452.993) * (-451.926) (-449.564) [-453.968] (-449.936) -- 0:00:45
211000 -- (-450.171) (-454.780) [-455.385] (-453.961) * (-452.360) (-451.621) (-453.979) [-451.194] -- 0:00:44
211500 -- (-458.857) [-452.360] (-452.771) (-450.254) * (-454.752) (-450.727) (-452.119) [-451.131] -- 0:00:44
212000 -- (-453.469) (-454.441) [-451.929] (-450.290) * (-450.616) (-449.898) (-451.663) [-452.340] -- 0:00:44
212500 -- (-450.773) (-451.794) [-457.666] (-450.854) * (-451.588) (-452.035) [-452.042] (-451.294) -- 0:00:44
213000 -- (-451.643) (-451.185) (-452.573) [-452.802] * (-450.616) [-451.978] (-454.643) (-450.260) -- 0:00:44
213500 -- (-450.275) (-454.297) (-453.351) [-451.071] * (-450.475) (-452.840) (-451.754) [-451.526] -- 0:00:44
214000 -- (-449.592) (-451.588) [-451.526] (-451.460) * (-450.399) [-450.498] (-451.122) (-449.695) -- 0:00:47
214500 -- (-449.749) (-451.664) [-451.377] (-454.626) * (-450.215) (-454.064) (-452.363) [-453.045] -- 0:00:47
215000 -- [-449.645] (-450.404) (-450.668) (-451.194) * (-451.937) [-450.657] (-452.206) (-454.919) -- 0:00:47
Average standard deviation of split frequencies: 0.020248
215500 -- [-450.111] (-451.144) (-450.178) (-450.995) * (-453.506) [-449.351] (-454.636) (-449.745) -- 0:00:47
216000 -- (-449.673) (-455.033) (-455.347) [-451.735] * (-453.140) [-451.409] (-450.199) (-450.220) -- 0:00:47
216500 -- (-450.665) (-450.616) [-451.615] (-451.617) * (-452.510) (-452.389) (-449.183) [-453.274] -- 0:00:47
217000 -- (-450.957) (-452.269) [-450.094] (-452.257) * (-450.662) (-451.416) (-457.315) [-452.794] -- 0:00:46
217500 -- [-452.654] (-449.833) (-451.008) (-452.223) * [-452.246] (-452.582) (-456.342) (-454.805) -- 0:00:46
218000 -- (-450.037) (-450.910) [-451.587] (-450.116) * (-453.287) [-451.431] (-452.270) (-454.049) -- 0:00:46
218500 -- (-452.193) (-452.336) [-452.879] (-452.449) * (-450.591) [-452.270] (-453.929) (-452.369) -- 0:00:46
219000 -- [-451.400] (-450.824) (-455.521) (-451.857) * (-451.634) (-453.403) [-454.079] (-449.958) -- 0:00:46
219500 -- (-454.830) (-450.097) (-451.718) [-451.463] * (-453.128) [-453.191] (-451.184) (-450.612) -- 0:00:46
220000 -- [-451.471] (-451.055) (-450.135) (-450.608) * (-452.944) (-451.161) [-450.272] (-457.735) -- 0:00:46
Average standard deviation of split frequencies: 0.021600
220500 -- [-453.783] (-451.701) (-450.030) (-450.868) * (-449.299) (-451.906) [-451.848] (-453.619) -- 0:00:45
221000 -- (-454.702) (-451.472) [-452.042] (-452.006) * [-450.970] (-452.172) (-452.624) (-450.702) -- 0:00:45
221500 -- [-451.434] (-450.605) (-451.193) (-452.284) * (-453.412) [-449.896] (-451.905) (-452.051) -- 0:00:45
222000 -- (-453.490) (-452.990) [-450.802] (-449.582) * (-451.620) [-450.063] (-451.031) (-453.992) -- 0:00:45
222500 -- (-451.976) [-456.979] (-451.346) (-451.678) * (-449.992) (-449.813) (-452.042) [-454.462] -- 0:00:45
223000 -- [-451.986] (-451.527) (-451.939) (-450.268) * (-450.358) (-452.551) [-450.764] (-456.556) -- 0:00:45
223500 -- (-455.567) (-452.631) (-452.137) [-449.640] * (-450.284) [-449.660] (-449.717) (-451.137) -- 0:00:45
224000 -- [-450.340] (-452.910) (-451.018) (-450.545) * (-450.356) (-451.214) (-451.317) [-450.835] -- 0:00:45
224500 -- (-453.930) (-449.865) (-450.077) [-451.582] * (-453.917) (-450.411) (-450.495) [-450.921] -- 0:00:44
225000 -- (-451.779) [-452.683] (-452.272) (-452.651) * [-451.602] (-452.932) (-451.748) (-449.980) -- 0:00:44
Average standard deviation of split frequencies: 0.022286
225500 -- (-451.406) [-449.933] (-453.538) (-451.694) * [-450.812] (-450.729) (-452.190) (-454.194) -- 0:00:44
226000 -- (-450.480) [-452.340] (-451.013) (-453.806) * [-451.035] (-453.011) (-453.880) (-453.188) -- 0:00:44
226500 -- (-452.221) (-452.480) (-450.899) [-452.749] * [-452.120] (-452.123) (-452.204) (-450.469) -- 0:00:44
227000 -- (-451.096) [-451.213] (-451.503) (-455.033) * [-449.153] (-451.557) (-452.870) (-451.590) -- 0:00:44
227500 -- (-451.550) (-450.386) [-450.061] (-451.477) * (-450.386) (-451.159) (-451.789) [-450.402] -- 0:00:44
228000 -- (-453.053) [-452.019] (-451.840) (-451.241) * (-450.413) (-456.028) [-449.612] (-450.070) -- 0:00:44
228500 -- (-449.554) [-454.140] (-453.471) (-453.120) * (-452.900) (-453.815) [-450.683] (-457.482) -- 0:00:43
229000 -- [-451.093] (-455.543) (-449.853) (-450.021) * [-450.432] (-451.267) (-454.754) (-451.189) -- 0:00:43
229500 -- (-451.569) (-454.054) [-450.453] (-450.899) * [-452.009] (-454.710) (-450.627) (-451.071) -- 0:00:43
230000 -- (-453.001) [-451.557] (-452.227) (-453.693) * (-449.948) [-449.747] (-450.852) (-451.842) -- 0:00:43
Average standard deviation of split frequencies: 0.021082
230500 -- (-451.764) (-453.147) (-452.580) [-450.673] * (-452.415) (-455.022) (-449.334) [-449.886] -- 0:00:46
231000 -- [-450.928] (-452.210) (-449.766) (-453.630) * (-452.355) (-451.390) (-450.558) [-450.352] -- 0:00:46
231500 -- (-449.734) (-450.615) [-449.646] (-451.874) * (-452.500) (-451.431) (-450.106) [-450.311] -- 0:00:46
232000 -- (-451.185) (-450.445) [-450.708] (-451.956) * (-451.054) [-453.163] (-451.008) (-451.256) -- 0:00:46
232500 -- (-450.462) (-451.128) (-450.856) [-453.367] * (-452.565) [-449.842] (-451.569) (-450.197) -- 0:00:46
233000 -- (-454.641) [-449.802] (-450.942) (-457.228) * [-451.628] (-452.900) (-450.493) (-449.921) -- 0:00:46
233500 -- (-452.575) (-449.834) [-452.251] (-455.354) * (-449.400) (-453.579) (-451.344) [-449.457] -- 0:00:45
234000 -- [-455.288] (-450.844) (-450.074) (-451.423) * (-450.351) (-450.474) [-451.214] (-449.457) -- 0:00:45
234500 -- (-452.879) (-453.248) (-450.485) [-451.813] * (-453.881) (-450.456) [-455.486] (-454.279) -- 0:00:45
235000 -- (-452.700) [-452.209] (-458.201) (-453.354) * [-451.135] (-451.018) (-450.123) (-451.332) -- 0:00:45
Average standard deviation of split frequencies: 0.020197
235500 -- (-450.468) (-452.404) [-451.254] (-450.896) * [-451.233] (-451.383) (-452.505) (-450.105) -- 0:00:45
236000 -- (-449.967) [-452.671] (-450.472) (-452.608) * (-451.122) (-449.803) (-449.873) [-453.802] -- 0:00:45
236500 -- (-454.073) [-449.499] (-449.856) (-451.022) * (-451.439) (-450.433) [-458.696] (-455.734) -- 0:00:45
237000 -- (-452.333) (-452.123) [-451.848] (-454.270) * (-452.936) (-451.042) [-454.643] (-449.790) -- 0:00:45
237500 -- (-451.729) [-452.146] (-451.673) (-452.951) * (-456.015) [-449.578] (-453.185) (-449.668) -- 0:00:44
238000 -- (-450.131) (-455.252) (-458.574) [-452.938] * [-451.596] (-450.490) (-453.646) (-451.990) -- 0:00:44
238500 -- [-450.341] (-454.931) (-453.390) (-450.851) * (-451.261) (-452.003) (-455.089) [-450.680] -- 0:00:44
239000 -- (-451.276) (-450.655) (-452.550) [-451.434] * (-452.488) (-451.809) (-454.496) [-450.514] -- 0:00:44
239500 -- (-451.575) (-450.834) [-451.736] (-450.327) * [-449.656] (-450.404) (-451.503) (-451.457) -- 0:00:44
240000 -- [-449.919] (-452.726) (-451.893) (-455.697) * [-453.905] (-450.073) (-455.124) (-454.554) -- 0:00:44
Average standard deviation of split frequencies: 0.018608
240500 -- (-450.979) (-451.680) [-449.594] (-449.807) * (-454.314) (-449.805) (-449.876) [-450.894] -- 0:00:44
241000 -- [-449.646] (-452.211) (-450.052) (-450.816) * (-449.953) (-450.503) [-449.194] (-451.526) -- 0:00:44
241500 -- (-452.562) (-451.592) [-449.632] (-450.256) * (-451.551) (-452.267) [-449.428] (-450.545) -- 0:00:43
242000 -- [-451.912] (-452.748) (-453.683) (-449.853) * (-451.311) (-452.576) [-450.961] (-453.006) -- 0:00:43
242500 -- (-452.195) (-454.163) [-452.791] (-449.576) * [-450.163] (-452.301) (-450.035) (-453.425) -- 0:00:43
243000 -- (-452.947) (-449.500) [-454.451] (-449.934) * (-451.464) (-454.597) [-451.167] (-452.565) -- 0:00:43
243500 -- (-451.731) (-451.114) [-454.763] (-454.672) * (-450.056) [-449.283] (-452.642) (-450.734) -- 0:00:43
244000 -- (-451.567) (-451.722) (-452.385) [-452.155] * (-452.414) (-449.253) [-451.016] (-452.179) -- 0:00:43
244500 -- (-451.045) (-452.697) (-450.234) [-451.251] * [-450.425] (-449.296) (-450.668) (-451.687) -- 0:00:43
245000 -- [-450.146] (-450.802) (-450.027) (-451.325) * (-451.143) (-453.521) (-453.542) [-451.734] -- 0:00:43
Average standard deviation of split frequencies: 0.016683
245500 -- [-449.431] (-450.160) (-452.234) (-451.089) * (-452.074) (-449.568) (-452.999) [-450.745] -- 0:00:43
246000 -- (-450.127) (-452.590) [-449.794] (-450.680) * (-452.371) (-453.520) (-450.181) [-450.762] -- 0:00:42
246500 -- [-450.565] (-450.564) (-449.236) (-454.649) * [-450.726] (-451.304) (-456.204) (-450.156) -- 0:00:42
247000 -- [-451.312] (-451.289) (-454.533) (-455.613) * (-451.121) (-452.198) [-450.827] (-451.043) -- 0:00:42
247500 -- (-452.040) (-451.223) (-451.091) [-451.244] * [-453.410] (-453.620) (-449.334) (-451.065) -- 0:00:45
248000 -- (-451.222) (-453.404) (-451.932) [-451.841] * [-449.880] (-450.306) (-450.165) (-450.009) -- 0:00:45
248500 -- (-449.592) [-450.313] (-450.605) (-455.178) * [-451.367] (-452.995) (-452.323) (-449.284) -- 0:00:45
249000 -- (-449.714) (-450.906) [-450.207] (-452.958) * (-451.939) [-449.919] (-451.080) (-451.717) -- 0:00:45
249500 -- (-452.067) (-452.864) (-450.815) [-452.796] * (-454.962) [-449.672] (-451.867) (-452.367) -- 0:00:45
250000 -- (-452.416) (-452.023) (-453.049) [-450.007] * (-451.735) (-451.230) [-451.933] (-450.319) -- 0:00:45
Average standard deviation of split frequencies: 0.014824
250500 -- (-451.245) (-451.580) [-451.032] (-450.893) * (-449.223) [-455.434] (-452.528) (-452.035) -- 0:00:44
251000 -- (-452.638) (-454.963) [-449.067] (-451.033) * (-454.032) (-453.771) [-452.431] (-449.363) -- 0:00:44
251500 -- (-452.322) (-452.853) (-449.384) [-449.450] * [-451.670] (-453.455) (-452.957) (-450.539) -- 0:00:44
252000 -- (-449.841) (-449.775) (-451.524) [-451.191] * [-450.334] (-451.501) (-451.869) (-453.625) -- 0:00:44
252500 -- (-449.303) (-450.762) [-451.732] (-456.548) * (-450.803) [-450.541] (-450.262) (-454.531) -- 0:00:44
253000 -- (-453.008) (-456.373) [-452.646] (-453.918) * (-450.100) (-449.213) [-450.339] (-449.362) -- 0:00:44
253500 -- (-457.462) (-450.298) [-452.404] (-450.206) * (-452.566) (-452.705) [-450.634] (-451.049) -- 0:00:44
254000 -- (-456.757) (-452.054) (-450.897) [-450.163] * (-450.079) (-451.746) (-450.115) [-452.190] -- 0:00:44
254500 -- [-450.319] (-449.176) (-450.791) (-449.182) * [-449.519] (-450.186) (-450.205) (-454.598) -- 0:00:43
255000 -- [-451.688] (-449.401) (-449.750) (-450.040) * [-451.192] (-450.339) (-450.884) (-452.158) -- 0:00:43
Average standard deviation of split frequencies: 0.012782
255500 -- [-449.537] (-451.912) (-449.276) (-452.899) * [-451.475] (-450.697) (-452.216) (-450.975) -- 0:00:43
256000 -- (-450.694) (-452.043) (-452.726) [-451.752] * (-450.606) [-451.355] (-452.891) (-450.934) -- 0:00:43
256500 -- (-449.870) (-449.656) (-454.897) [-452.393] * (-452.347) (-451.748) (-453.860) [-451.429] -- 0:00:43
257000 -- (-455.763) [-449.636] (-450.522) (-453.439) * [-450.202] (-450.201) (-454.049) (-453.728) -- 0:00:43
257500 -- (-455.883) (-452.611) (-450.783) [-451.293] * (-451.829) (-450.719) [-455.345] (-452.493) -- 0:00:43
258000 -- (-454.509) [-451.589] (-452.580) (-449.207) * (-453.264) (-455.401) [-454.842] (-449.785) -- 0:00:43
258500 -- (-452.267) (-456.240) (-451.194) [-451.067] * (-451.780) (-451.612) (-456.128) [-451.308] -- 0:00:43
259000 -- (-457.760) (-451.306) [-450.111] (-453.408) * (-453.109) [-452.952] (-452.822) (-451.065) -- 0:00:42
259500 -- [-452.737] (-450.517) (-452.473) (-450.977) * [-449.549] (-451.264) (-450.592) (-450.871) -- 0:00:42
260000 -- (-453.921) (-452.565) (-451.923) [-449.992] * [-450.351] (-452.526) (-452.706) (-453.656) -- 0:00:42
Average standard deviation of split frequencies: 0.013404
260500 -- (-451.264) [-451.979] (-452.928) (-451.003) * (-455.468) [-453.836] (-449.228) (-453.391) -- 0:00:42
261000 -- (-451.516) [-453.429] (-450.820) (-453.772) * (-451.028) [-452.111] (-451.135) (-451.508) -- 0:00:42
261500 -- [-450.379] (-453.183) (-453.868) (-451.700) * [-449.672] (-454.199) (-450.030) (-454.839) -- 0:00:42
262000 -- (-453.617) (-451.770) [-451.143] (-454.424) * (-450.811) (-452.343) [-451.589] (-457.505) -- 0:00:42
262500 -- (-452.486) (-449.598) (-449.528) [-450.996] * (-450.888) (-455.507) (-451.939) [-455.733] -- 0:00:42
263000 -- (-451.261) (-451.415) [-450.185] (-452.463) * (-450.686) [-452.328] (-453.991) (-455.275) -- 0:00:42
263500 -- (-452.583) [-450.678] (-452.035) (-450.423) * [-451.370] (-452.429) (-450.432) (-452.096) -- 0:00:41
264000 -- (-455.008) (-452.633) (-455.660) [-452.592] * (-452.261) (-451.537) [-450.235] (-454.086) -- 0:00:44
264500 -- [-451.453] (-452.743) (-454.146) (-451.584) * (-452.231) [-452.111] (-451.030) (-453.249) -- 0:00:44
265000 -- (-451.008) [-452.238] (-455.527) (-450.456) * [-450.750] (-451.698) (-452.891) (-451.787) -- 0:00:44
Average standard deviation of split frequencies: 0.014079
265500 -- [-449.725] (-453.682) (-450.120) (-453.921) * (-450.660) (-449.858) (-450.280) [-449.957] -- 0:00:44
266000 -- (-452.212) (-452.076) (-450.943) [-450.815] * (-454.571) (-453.124) (-451.686) [-449.948] -- 0:00:44
266500 -- (-450.451) (-450.691) (-455.934) [-450.359] * (-457.933) (-450.270) [-454.097] (-452.272) -- 0:00:44
267000 -- (-452.622) [-451.087] (-450.266) (-451.996) * (-453.532) (-451.310) [-454.299] (-449.456) -- 0:00:43
267500 -- [-451.196] (-454.356) (-451.871) (-452.879) * (-452.073) (-451.946) [-450.030] (-450.411) -- 0:00:43
268000 -- (-452.534) (-453.778) [-450.745] (-451.385) * (-453.587) (-451.129) (-451.286) [-451.299] -- 0:00:43
268500 -- (-451.498) [-454.181] (-452.693) (-452.129) * (-449.383) (-452.309) (-452.015) [-451.334] -- 0:00:43
269000 -- (-450.461) [-451.000] (-453.375) (-450.911) * (-451.928) [-453.131] (-452.140) (-452.241) -- 0:00:43
269500 -- [-449.990] (-450.442) (-450.972) (-452.356) * (-456.479) (-450.055) [-455.097] (-454.033) -- 0:00:43
270000 -- (-451.127) (-451.226) [-451.009] (-452.555) * (-451.030) [-449.957] (-455.527) (-450.005) -- 0:00:43
Average standard deviation of split frequencies: 0.013062
270500 -- (-452.604) [-449.459] (-454.061) (-450.608) * (-450.731) (-454.189) (-456.772) [-450.678] -- 0:00:43
271000 -- [-451.173] (-449.691) (-450.807) (-449.960) * (-450.180) (-452.862) (-449.131) [-455.974] -- 0:00:43
271500 -- (-451.087) (-450.959) [-451.452] (-454.231) * [-450.173] (-451.922) (-454.061) (-452.160) -- 0:00:42
272000 -- (-454.148) [-450.374] (-450.699) (-451.132) * [-450.691] (-452.986) (-449.414) (-451.774) -- 0:00:42
272500 -- (-455.294) [-454.397] (-453.946) (-451.886) * (-451.111) (-451.365) (-450.143) [-449.966] -- 0:00:42
273000 -- [-454.273] (-452.661) (-451.393) (-451.439) * (-452.574) [-450.655] (-450.769) (-453.390) -- 0:00:42
273500 -- [-451.741] (-450.271) (-453.604) (-451.792) * (-450.399) (-449.591) (-449.325) [-451.960] -- 0:00:42
274000 -- (-451.326) [-452.368] (-452.738) (-453.788) * [-452.866] (-452.832) (-450.677) (-459.985) -- 0:00:42
274500 -- (-450.238) (-454.518) [-454.021] (-454.961) * (-449.944) (-457.835) [-450.568] (-449.751) -- 0:00:42
275000 -- (-450.261) [-452.570] (-450.581) (-450.855) * (-453.537) [-454.197] (-451.508) (-453.254) -- 0:00:42
Average standard deviation of split frequencies: 0.013965
275500 -- [-453.656] (-453.282) (-452.136) (-449.732) * (-451.728) [-449.702] (-451.190) (-449.461) -- 0:00:42
276000 -- (-454.573) (-453.037) (-450.332) [-450.670] * (-449.714) (-455.790) [-449.795] (-450.433) -- 0:00:41
276500 -- (-451.704) (-451.201) [-449.342] (-452.718) * [-451.891] (-452.840) (-449.949) (-449.642) -- 0:00:41
277000 -- [-450.315] (-450.868) (-452.536) (-450.537) * (-451.500) (-451.043) (-451.180) [-450.084] -- 0:00:41
277500 -- [-455.311] (-451.877) (-453.881) (-451.281) * (-452.660) (-451.199) [-453.168] (-450.822) -- 0:00:41
278000 -- (-450.829) [-450.092] (-455.133) (-453.217) * (-450.538) [-450.928] (-452.595) (-450.501) -- 0:00:41
278500 -- [-452.630] (-449.834) (-457.189) (-451.671) * [-451.922] (-454.225) (-451.013) (-451.202) -- 0:00:41
279000 -- (-449.717) [-449.733] (-455.200) (-456.023) * (-455.442) [-452.206] (-453.551) (-453.445) -- 0:00:41
279500 -- [-451.751] (-450.904) (-452.516) (-452.096) * (-450.832) [-451.057] (-452.854) (-451.619) -- 0:00:41
280000 -- (-450.951) (-450.756) [-454.301] (-452.182) * [-450.411] (-451.358) (-454.615) (-451.037) -- 0:00:41
Average standard deviation of split frequencies: 0.013647
280500 -- (-451.555) (-450.682) (-454.924) [-451.607] * (-452.916) (-455.236) [-454.600] (-451.939) -- 0:00:43
281000 -- [-451.479] (-449.705) (-451.697) (-451.470) * (-451.355) (-450.745) (-452.505) [-450.511] -- 0:00:43
281500 -- (-455.056) (-451.617) [-450.351] (-452.086) * [-453.803] (-451.398) (-452.721) (-450.088) -- 0:00:43
282000 -- (-454.697) [-450.659] (-451.662) (-456.773) * (-450.717) (-453.394) (-452.510) [-450.727] -- 0:00:43
282500 -- (-453.182) (-450.679) (-454.893) [-453.252] * [-452.002] (-453.477) (-451.937) (-450.905) -- 0:00:43
283000 -- (-452.398) [-450.885] (-454.279) (-453.708) * [-452.291] (-451.661) (-449.803) (-452.450) -- 0:00:43
283500 -- (-454.257) [-453.972] (-453.414) (-450.086) * (-451.513) (-452.001) [-453.726] (-450.981) -- 0:00:42
284000 -- (-450.130) [-449.943] (-452.397) (-452.530) * (-450.034) (-451.449) [-452.559] (-451.634) -- 0:00:42
284500 -- (-451.129) (-454.994) (-452.444) [-450.490] * (-452.581) [-449.949] (-452.252) (-454.129) -- 0:00:42
285000 -- (-451.854) (-450.359) [-453.427] (-456.828) * (-451.669) (-449.610) [-452.601] (-453.752) -- 0:00:42
Average standard deviation of split frequencies: 0.014447
285500 -- [-450.370] (-451.520) (-451.287) (-451.001) * [-451.268] (-451.167) (-451.296) (-451.146) -- 0:00:42
286000 -- (-449.583) (-450.223) [-453.022] (-451.978) * (-449.922) [-450.253] (-453.336) (-452.474) -- 0:00:42
286500 -- (-453.951) (-452.035) (-453.545) [-451.620] * (-453.066) (-452.008) (-452.071) [-450.789] -- 0:00:42
287000 -- (-453.400) (-451.059) [-451.903] (-453.060) * [-453.808] (-453.177) (-451.469) (-450.373) -- 0:00:42
287500 -- (-452.339) [-449.884] (-451.139) (-450.930) * (-450.169) (-451.699) (-455.844) [-452.673] -- 0:00:42
288000 -- [-450.446] (-450.770) (-452.535) (-449.325) * (-450.899) (-450.838) (-451.997) [-452.288] -- 0:00:42
288500 -- (-451.969) [-450.866] (-451.795) (-452.005) * [-451.119] (-455.224) (-449.942) (-451.179) -- 0:00:41
289000 -- (-451.381) (-453.113) [-450.005] (-452.663) * (-450.071) (-452.283) [-451.995] (-457.395) -- 0:00:41
289500 -- (-451.046) [-451.431] (-451.094) (-452.485) * (-452.416) [-452.404] (-456.096) (-450.860) -- 0:00:41
290000 -- (-451.513) (-451.767) (-451.613) [-449.330] * (-451.412) (-450.240) [-453.287] (-454.302) -- 0:00:41
Average standard deviation of split frequencies: 0.012569
290500 -- [-451.383] (-450.994) (-451.128) (-451.833) * (-449.721) (-451.377) (-449.652) [-453.085] -- 0:00:41
291000 -- (-453.944) (-451.054) (-450.129) [-451.189] * (-458.405) [-450.643] (-450.896) (-451.325) -- 0:00:41
291500 -- (-453.582) [-449.630] (-454.633) (-452.876) * (-451.212) (-450.742) (-449.728) [-450.808] -- 0:00:41
292000 -- (-453.816) (-453.481) [-454.642] (-451.474) * (-453.521) [-450.074] (-455.828) (-449.879) -- 0:00:41
292500 -- (-451.862) (-453.795) [-452.490] (-451.340) * (-451.498) (-450.124) [-451.973] (-451.163) -- 0:00:41
293000 -- (-451.834) [-452.562] (-450.154) (-455.512) * (-450.819) (-452.596) (-450.771) [-450.746] -- 0:00:41
293500 -- (-451.251) (-449.800) (-450.737) [-450.493] * (-451.061) (-452.234) [-449.705] (-451.869) -- 0:00:40
294000 -- (-454.562) (-450.601) [-452.924] (-450.423) * (-449.116) (-450.445) (-449.442) [-452.498] -- 0:00:40
294500 -- (-450.461) (-453.578) [-451.020] (-452.717) * (-450.796) (-452.020) [-449.600] (-451.261) -- 0:00:40
295000 -- (-450.099) [-451.393] (-450.573) (-453.800) * (-450.775) (-453.540) [-451.209] (-453.587) -- 0:00:40
Average standard deviation of split frequencies: 0.014234
295500 -- (-449.663) (-456.229) (-452.434) [-452.114] * (-456.047) (-450.842) [-451.042] (-452.140) -- 0:00:40
296000 -- (-451.254) [-451.061] (-454.450) (-450.016) * [-450.674] (-452.526) (-454.888) (-452.036) -- 0:00:40
296500 -- [-449.224] (-453.587) (-452.942) (-451.078) * (-450.281) (-453.118) (-456.580) [-455.481] -- 0:00:40
297000 -- (-452.732) (-454.352) (-449.757) [-452.243] * (-450.942) (-450.842) [-450.199] (-453.082) -- 0:00:42
297500 -- (-452.454) (-451.449) [-450.923] (-450.963) * [-450.053] (-452.187) (-451.753) (-453.178) -- 0:00:42
298000 -- (-451.169) (-451.637) (-454.087) [-450.732] * [-449.654] (-449.879) (-451.560) (-455.196) -- 0:00:42
298500 -- (-450.689) (-451.825) [-451.891] (-451.476) * (-452.424) (-455.763) [-450.456] (-454.218) -- 0:00:42
299000 -- [-450.975] (-452.105) (-453.504) (-452.673) * (-457.765) (-450.111) (-450.155) [-454.931] -- 0:00:42
299500 -- (-450.470) (-453.350) (-452.038) [-451.449] * (-453.140) (-449.546) (-450.630) [-450.450] -- 0:00:42
300000 -- [-450.097] (-454.336) (-450.795) (-453.849) * [-450.924] (-449.700) (-451.557) (-451.401) -- 0:00:42
Average standard deviation of split frequencies: 0.014503
300500 -- (-451.843) [-449.772] (-449.448) (-452.311) * [-453.430] (-449.147) (-451.320) (-452.623) -- 0:00:41
301000 -- [-453.278] (-450.656) (-455.094) (-462.518) * (-455.585) (-451.287) [-450.605] (-453.844) -- 0:00:41
301500 -- [-450.955] (-454.417) (-453.942) (-454.397) * (-455.542) [-451.431] (-449.843) (-451.481) -- 0:00:41
302000 -- [-452.635] (-450.243) (-453.720) (-453.483) * [-450.126] (-451.177) (-449.911) (-455.910) -- 0:00:41
302500 -- (-453.168) (-450.000) [-450.469] (-450.693) * (-452.890) (-451.899) [-451.624] (-450.441) -- 0:00:41
303000 -- (-451.074) (-454.381) (-451.503) [-452.843] * (-453.318) (-454.288) (-452.663) [-451.499] -- 0:00:41
303500 -- [-452.974] (-452.503) (-451.784) (-451.916) * (-452.268) (-449.991) [-456.232] (-454.035) -- 0:00:41
304000 -- (-449.834) [-450.957] (-455.975) (-450.142) * [-450.876] (-449.716) (-449.606) (-452.163) -- 0:00:41
304500 -- (-449.767) (-451.536) (-455.214) [-451.221] * (-450.633) [-451.730] (-452.253) (-450.782) -- 0:00:41
305000 -- [-450.110] (-451.059) (-450.139) (-451.831) * (-451.804) (-454.564) (-449.272) [-454.972] -- 0:00:41
Average standard deviation of split frequencies: 0.014137
305500 -- (-453.254) [-450.043] (-453.022) (-451.986) * (-451.380) (-449.728) [-449.201] (-453.845) -- 0:00:40
306000 -- (-455.169) [-452.127] (-451.637) (-458.005) * (-451.582) (-452.364) (-452.648) [-450.439] -- 0:00:40
306500 -- (-449.712) (-451.456) (-449.796) [-450.541] * (-449.419) (-453.901) [-453.729] (-449.913) -- 0:00:40
307000 -- (-451.534) [-453.686] (-452.372) (-450.738) * (-452.765) (-452.448) [-451.630] (-453.778) -- 0:00:40
307500 -- (-450.909) (-455.041) [-450.439] (-452.227) * (-451.649) (-450.182) [-451.087] (-452.845) -- 0:00:40
308000 -- (-450.595) (-453.512) [-450.318] (-450.697) * [-453.063] (-450.848) (-449.981) (-455.762) -- 0:00:40
308500 -- (-453.475) (-450.922) (-449.889) [-450.028] * (-450.760) [-450.084] (-450.441) (-451.348) -- 0:00:40
309000 -- [-450.676] (-451.801) (-449.752) (-451.626) * (-450.165) (-455.558) [-450.207] (-453.228) -- 0:00:40
309500 -- (-451.314) (-453.515) [-450.634] (-449.838) * (-450.884) (-450.762) [-451.077] (-451.034) -- 0:00:40
310000 -- (-452.149) (-454.185) (-453.846) [-450.383] * (-452.440) [-450.900] (-450.166) (-451.126) -- 0:00:40
Average standard deviation of split frequencies: 0.013121
310500 -- (-457.003) (-452.160) (-458.846) [-450.377] * (-450.845) (-451.678) (-450.251) [-450.762] -- 0:00:39
311000 -- [-449.706] (-452.931) (-451.839) (-452.796) * (-449.372) [-453.289] (-450.041) (-450.933) -- 0:00:39
311500 -- (-452.801) (-450.092) (-449.290) [-454.246] * (-451.912) (-453.142) [-451.388] (-450.727) -- 0:00:39
312000 -- (-452.899) (-449.844) [-450.842] (-452.959) * [-450.183] (-453.249) (-450.912) (-450.547) -- 0:00:39
312500 -- [-452.649] (-450.660) (-452.379) (-453.646) * (-452.431) (-451.850) (-449.466) [-450.908] -- 0:00:39
313000 -- [-451.174] (-450.774) (-450.352) (-456.783) * [-452.793] (-455.216) (-451.560) (-450.032) -- 0:00:39
313500 -- (-452.608) (-450.105) (-451.309) [-449.499] * (-450.500) (-451.702) [-452.555] (-451.249) -- 0:00:41
314000 -- (-450.780) (-451.898) (-453.401) [-451.380] * (-451.946) [-449.850] (-454.730) (-450.602) -- 0:00:41
314500 -- (-452.484) [-450.874] (-451.913) (-449.517) * (-450.747) [-449.552] (-450.909) (-449.595) -- 0:00:41
315000 -- [-453.244] (-452.455) (-449.892) (-449.809) * (-451.809) [-452.642] (-451.440) (-449.378) -- 0:00:41
Average standard deviation of split frequencies: 0.013338
315500 -- (-451.257) [-449.871] (-455.070) (-452.379) * (-453.844) (-450.449) [-449.574] (-449.106) -- 0:00:41
316000 -- (-451.570) (-450.781) (-451.760) [-451.627] * (-454.798) (-455.243) (-450.703) [-451.310] -- 0:00:41
316500 -- (-452.794) (-451.880) [-450.454] (-453.075) * (-452.281) [-454.148] (-450.832) (-451.781) -- 0:00:41
317000 -- [-450.297] (-453.536) (-450.295) (-451.786) * (-451.602) [-452.398] (-450.742) (-449.751) -- 0:00:40
317500 -- (-452.489) (-452.463) (-450.830) [-451.513] * [-454.757] (-450.046) (-449.758) (-451.218) -- 0:00:40
318000 -- [-449.704] (-452.472) (-451.357) (-450.702) * [-452.977] (-452.706) (-454.369) (-452.761) -- 0:00:40
318500 -- (-450.106) (-452.257) (-457.919) [-452.970] * (-452.263) [-452.149] (-451.388) (-452.437) -- 0:00:40
319000 -- (-449.610) (-451.642) [-452.002] (-454.135) * [-451.078] (-454.143) (-450.568) (-452.871) -- 0:00:40
319500 -- (-451.678) (-451.647) (-449.748) [-450.994] * [-451.591] (-452.958) (-453.342) (-455.361) -- 0:00:40
320000 -- (-450.137) (-451.238) (-452.071) [-450.076] * (-449.883) (-450.595) (-451.662) [-450.350] -- 0:00:40
Average standard deviation of split frequencies: 0.012863
320500 -- (-451.690) (-451.201) [-452.615] (-452.421) * (-451.958) (-452.019) (-454.387) [-450.879] -- 0:00:40
321000 -- [-451.343] (-451.118) (-449.674) (-451.140) * (-453.504) [-451.199] (-455.901) (-452.593) -- 0:00:40
321500 -- (-453.609) (-453.570) (-455.160) [-450.112] * [-451.610] (-452.695) (-452.424) (-450.713) -- 0:00:40
322000 -- (-451.895) (-452.840) [-453.765] (-452.823) * [-450.281] (-450.921) (-453.761) (-452.304) -- 0:00:40
322500 -- (-449.699) (-452.678) (-453.365) [-449.856] * (-450.741) (-450.838) [-456.678] (-449.424) -- 0:00:39
323000 -- (-450.183) (-454.136) (-450.401) [-450.060] * (-453.242) (-452.213) (-452.687) [-451.600] -- 0:00:39
323500 -- (-452.151) (-454.132) [-449.958] (-449.901) * (-452.171) (-451.494) (-450.139) [-450.709] -- 0:00:39
324000 -- (-449.996) [-450.238] (-455.587) (-450.670) * (-452.712) [-451.062] (-450.124) (-454.493) -- 0:00:39
324500 -- (-452.485) (-453.130) (-451.882) [-451.411] * (-450.761) (-454.990) (-452.744) [-453.142] -- 0:00:39
325000 -- (-455.354) (-454.927) [-449.888] (-451.202) * (-456.652) [-456.068] (-451.352) (-454.274) -- 0:00:39
Average standard deviation of split frequencies: 0.012334
325500 -- (-450.274) (-449.267) [-452.433] (-452.876) * (-457.129) [-450.382] (-449.586) (-457.959) -- 0:00:39
326000 -- (-455.031) [-449.481] (-453.742) (-452.342) * (-451.230) [-451.621] (-449.901) (-455.780) -- 0:00:39
326500 -- (-454.370) (-455.931) [-453.038] (-450.562) * (-453.919) (-453.315) (-451.041) [-452.381] -- 0:00:39
327000 -- [-450.035] (-449.289) (-450.015) (-456.202) * [-451.752] (-453.782) (-452.182) (-450.168) -- 0:00:39
327500 -- (-451.988) [-450.406] (-449.754) (-449.457) * (-450.521) (-450.518) [-452.392] (-451.596) -- 0:00:39
328000 -- [-449.833] (-451.251) (-453.268) (-458.612) * (-452.242) (-452.735) [-455.044] (-454.509) -- 0:00:38
328500 -- (-450.237) (-452.570) [-454.325] (-450.812) * (-452.274) (-455.397) [-451.695] (-451.144) -- 0:00:38
329000 -- (-451.180) (-452.865) (-452.321) [-452.402] * [-449.721] (-451.790) (-454.505) (-450.616) -- 0:00:38
329500 -- [-453.204] (-450.733) (-455.837) (-453.898) * (-450.252) (-453.275) (-451.969) [-451.919] -- 0:00:38
330000 -- (-450.255) (-450.276) [-451.874] (-452.387) * (-450.241) (-452.350) [-451.487] (-451.381) -- 0:00:38
Average standard deviation of split frequencies: 0.011940
330500 -- [-450.426] (-450.241) (-451.156) (-455.472) * (-453.088) (-452.649) [-450.905] (-450.241) -- 0:00:40
331000 -- (-449.363) (-450.251) (-449.692) [-452.621] * (-454.033) (-457.338) [-451.373] (-450.510) -- 0:00:40
331500 -- [-450.896] (-451.591) (-452.119) (-451.303) * (-453.856) (-452.982) [-451.111] (-449.814) -- 0:00:40
332000 -- (-453.081) (-452.598) (-453.072) [-453.056] * (-453.572) (-450.988) [-454.237] (-452.832) -- 0:00:40
332500 -- (-450.533) (-456.128) [-450.772] (-452.166) * [-450.993] (-451.151) (-450.545) (-451.148) -- 0:00:40
333000 -- (-451.267) [-450.024] (-450.284) (-450.082) * [-452.823] (-453.432) (-452.296) (-453.517) -- 0:00:40
333500 -- (-450.568) (-449.668) (-452.045) [-451.598] * (-450.860) (-456.982) [-451.897] (-450.297) -- 0:00:39
334000 -- (-452.212) (-453.889) [-452.141] (-451.962) * (-453.991) (-452.153) [-453.280] (-450.036) -- 0:00:39
334500 -- [-450.048] (-451.022) (-450.684) (-452.563) * (-451.529) [-450.329] (-451.377) (-450.050) -- 0:00:39
335000 -- (-450.539) [-450.546] (-450.701) (-453.352) * (-454.893) (-449.663) [-450.874] (-454.217) -- 0:00:39
Average standard deviation of split frequencies: 0.011802
335500 -- (-451.731) [-452.557] (-450.721) (-449.890) * (-459.780) (-449.968) (-452.986) [-450.433] -- 0:00:39
336000 -- (-455.626) (-451.168) [-450.524] (-451.033) * (-454.590) (-454.224) (-456.878) [-452.861] -- 0:00:39
336500 -- (-452.406) [-450.754] (-453.171) (-452.831) * (-452.632) (-455.592) [-455.280] (-455.146) -- 0:00:39
337000 -- [-450.504] (-450.128) (-454.550) (-449.446) * (-451.399) [-450.039] (-452.748) (-452.835) -- 0:00:39
337500 -- (-451.913) (-449.656) [-453.545] (-450.516) * (-450.712) (-452.844) [-451.150] (-453.937) -- 0:00:39
338000 -- [-452.769] (-450.170) (-455.556) (-451.408) * (-455.756) [-452.963] (-450.640) (-450.764) -- 0:00:39
338500 -- (-451.596) (-453.662) (-457.281) [-451.515] * (-452.902) (-452.913) [-451.761] (-450.134) -- 0:00:39
339000 -- (-454.548) [-450.916] (-454.695) (-453.293) * (-450.887) (-451.856) (-452.292) [-453.722] -- 0:00:38
339500 -- (-449.491) (-451.542) (-452.746) [-449.863] * (-449.884) [-451.804] (-456.519) (-450.994) -- 0:00:38
340000 -- (-451.574) (-450.949) [-451.032] (-450.250) * (-454.219) (-453.975) (-452.159) [-452.773] -- 0:00:38
Average standard deviation of split frequencies: 0.010907
340500 -- (-450.995) (-450.783) [-450.031] (-452.084) * [-450.388] (-453.788) (-450.836) (-452.858) -- 0:00:38
341000 -- (-450.749) (-454.460) [-450.595] (-451.082) * (-452.368) (-451.981) (-450.367) [-450.728] -- 0:00:38
341500 -- (-453.161) [-454.006] (-449.754) (-449.435) * (-456.364) (-456.347) [-450.786] (-451.530) -- 0:00:38
342000 -- [-453.171] (-456.536) (-449.585) (-451.794) * (-452.675) (-456.674) (-452.270) [-453.170] -- 0:00:38
342500 -- (-450.577) (-454.628) (-449.577) [-450.460] * [-449.484] (-454.868) (-454.124) (-452.532) -- 0:00:38
343000 -- [-451.264] (-453.551) (-454.054) (-451.521) * (-451.368) (-450.378) [-451.023] (-451.712) -- 0:00:38
343500 -- [-452.000] (-458.827) (-449.402) (-451.111) * [-449.536] (-450.796) (-453.392) (-450.941) -- 0:00:38
344000 -- (-452.718) (-451.911) [-449.814] (-450.047) * (-451.202) (-450.314) [-450.440] (-449.719) -- 0:00:38
344500 -- (-451.911) (-452.592) (-452.281) [-451.676] * [-449.888] (-451.497) (-454.316) (-452.269) -- 0:00:38
345000 -- (-451.603) [-450.704] (-452.579) (-451.233) * (-449.343) [-451.445] (-450.724) (-449.331) -- 0:00:37
Average standard deviation of split frequencies: 0.009778
345500 -- (-455.868) (-449.519) (-451.839) [-451.097] * [-451.279] (-453.914) (-453.387) (-449.886) -- 0:00:37
346000 -- [-449.439] (-450.418) (-450.478) (-451.465) * (-449.893) (-449.599) [-452.569] (-455.308) -- 0:00:37
346500 -- (-452.897) [-451.075] (-454.148) (-452.709) * (-452.622) (-450.519) [-454.980] (-450.553) -- 0:00:37
347000 -- (-454.839) (-453.246) [-452.614] (-451.720) * [-451.853] (-450.176) (-454.752) (-451.359) -- 0:00:37
347500 -- (-450.059) [-449.736] (-450.888) (-450.576) * (-451.135) (-449.720) (-459.876) [-451.088] -- 0:00:39
348000 -- (-449.715) (-451.550) (-451.025) [-451.972] * (-451.539) (-451.885) (-451.185) [-451.834] -- 0:00:39
348500 -- (-451.601) [-450.466] (-451.679) (-450.481) * (-450.892) (-450.097) (-450.058) [-454.989] -- 0:00:39
349000 -- (-450.947) (-453.340) (-449.800) [-451.364] * (-451.432) (-450.746) (-451.956) [-451.049] -- 0:00:39
349500 -- (-449.799) [-450.863] (-451.303) (-450.832) * (-450.629) (-454.511) (-450.877) [-451.231] -- 0:00:39
350000 -- [-452.573] (-450.491) (-450.510) (-455.052) * [-452.036] (-451.585) (-451.607) (-451.050) -- 0:00:39
Average standard deviation of split frequencies: 0.009964
350500 -- (-453.266) (-449.653) (-451.199) [-451.863] * [-452.506] (-451.548) (-455.496) (-450.013) -- 0:00:38
351000 -- (-450.248) (-451.953) (-454.680) [-451.033] * (-453.468) [-449.714] (-451.887) (-452.432) -- 0:00:38
351500 -- (-450.659) (-453.969) [-451.498] (-458.960) * (-452.694) (-452.867) (-451.029) [-451.274] -- 0:00:38
352000 -- (-450.241) (-454.860) (-450.060) [-451.078] * (-450.353) [-452.935] (-451.512) (-453.518) -- 0:00:38
352500 -- (-453.223) [-456.759] (-449.623) (-452.920) * (-449.416) [-450.860] (-450.997) (-451.866) -- 0:00:38
353000 -- [-452.931] (-449.750) (-451.286) (-452.162) * (-454.650) (-450.270) [-450.660] (-449.883) -- 0:00:38
353500 -- (-450.506) (-449.485) (-452.673) [-452.104] * (-453.739) (-450.704) (-449.195) [-450.579] -- 0:00:38
354000 -- [-456.233] (-450.029) (-451.790) (-449.473) * [-453.306] (-455.161) (-449.410) (-450.732) -- 0:00:38
354500 -- (-457.815) (-459.232) (-449.739) [-454.511] * [-451.616] (-454.404) (-450.327) (-450.789) -- 0:00:38
355000 -- (-454.775) (-453.666) [-453.579] (-452.337) * (-452.799) [-449.566] (-450.813) (-450.440) -- 0:00:38
Average standard deviation of split frequencies: 0.009581
355500 -- (-450.439) (-452.734) (-450.291) [-451.615] * (-452.140) [-450.665] (-452.270) (-450.206) -- 0:00:38
356000 -- [-450.927] (-451.410) (-450.576) (-453.999) * (-450.442) (-450.103) (-451.017) [-451.395] -- 0:00:37
356500 -- (-449.451) (-450.373) (-457.083) [-452.673] * (-450.168) (-453.946) (-453.462) [-452.459] -- 0:00:37
357000 -- [-449.466] (-450.625) (-456.378) (-458.080) * (-451.600) (-454.516) (-453.688) [-451.420] -- 0:00:37
357500 -- [-451.782] (-451.480) (-455.205) (-451.479) * (-453.061) [-451.999] (-456.817) (-450.755) -- 0:00:37
358000 -- (-451.717) [-452.039] (-450.071) (-451.508) * [-453.760] (-450.981) (-451.478) (-450.291) -- 0:00:37
358500 -- (-451.043) (-449.606) [-451.668] (-450.152) * (-450.431) (-451.064) (-450.447) [-449.774] -- 0:00:37
359000 -- [-451.094] (-452.842) (-451.689) (-454.462) * (-450.905) [-453.328] (-452.724) (-452.121) -- 0:00:37
359500 -- (-450.248) [-455.438] (-460.509) (-450.044) * (-451.231) (-450.964) [-451.068] (-454.604) -- 0:00:37
360000 -- (-450.116) (-455.657) (-452.480) [-450.390] * (-452.664) [-450.513] (-451.034) (-454.475) -- 0:00:37
Average standard deviation of split frequencies: 0.011437
360500 -- [-450.316] (-451.419) (-453.546) (-449.671) * (-453.407) (-449.549) [-450.422] (-450.128) -- 0:00:37
361000 -- (-453.682) [-450.487] (-451.010) (-453.510) * (-451.079) (-451.866) [-451.620] (-451.065) -- 0:00:37
361500 -- (-453.227) (-453.204) [-453.316] (-453.344) * (-455.964) (-451.901) (-450.273) [-451.566] -- 0:00:37
362000 -- [-450.016] (-450.790) (-451.149) (-452.141) * (-451.400) (-456.326) [-452.850] (-454.125) -- 0:00:37
362500 -- (-451.492) [-450.810] (-450.978) (-452.388) * (-453.657) (-454.830) (-451.628) [-450.662] -- 0:00:36
363000 -- (-452.472) (-451.051) (-450.869) [-451.939] * (-453.847) (-450.773) [-452.318] (-451.091) -- 0:00:36
363500 -- (-450.838) (-451.217) (-450.475) [-450.151] * (-452.224) (-451.685) [-451.274] (-454.094) -- 0:00:36
364000 -- [-450.365] (-450.514) (-455.446) (-450.627) * (-451.960) [-450.172] (-452.379) (-450.667) -- 0:00:36
364500 -- [-455.090] (-452.961) (-453.958) (-450.328) * (-451.343) (-449.855) (-455.722) [-450.686] -- 0:00:38
365000 -- (-454.437) [-451.284] (-453.411) (-453.800) * [-453.240] (-449.998) (-454.304) (-451.711) -- 0:00:38
Average standard deviation of split frequencies: 0.011109
365500 -- (-453.500) (-449.749) (-454.161) [-451.408] * (-450.229) [-450.036] (-451.705) (-451.028) -- 0:00:38
366000 -- [-452.648] (-450.962) (-452.543) (-449.790) * (-450.226) [-450.232] (-451.761) (-453.451) -- 0:00:38
366500 -- (-452.930) (-452.793) (-451.424) [-449.494] * (-452.800) (-454.653) [-450.883] (-452.381) -- 0:00:38
367000 -- (-452.739) [-453.202] (-450.142) (-449.833) * (-451.276) [-450.845] (-452.978) (-450.750) -- 0:00:37
367500 -- (-450.534) [-450.629] (-454.370) (-451.079) * [-450.607] (-449.262) (-453.400) (-450.250) -- 0:00:37
368000 -- [-451.315] (-451.872) (-452.396) (-453.052) * [-450.998] (-450.628) (-451.694) (-451.085) -- 0:00:37
368500 -- (-457.406) [-449.887] (-450.291) (-450.556) * [-453.510] (-450.967) (-451.454) (-449.820) -- 0:00:37
369000 -- (-452.974) (-453.176) (-451.310) [-449.475] * (-450.340) [-451.472] (-450.961) (-452.071) -- 0:00:37
369500 -- [-450.130] (-452.200) (-451.065) (-450.180) * [-450.371] (-451.736) (-451.605) (-452.469) -- 0:00:37
370000 -- (-449.725) (-452.304) (-452.335) [-450.685] * [-450.133] (-450.909) (-453.735) (-451.317) -- 0:00:37
Average standard deviation of split frequencies: 0.010333
370500 -- [-449.797] (-452.493) (-450.659) (-453.747) * [-450.641] (-450.157) (-456.034) (-455.154) -- 0:00:37
371000 -- [-454.886] (-450.433) (-455.118) (-453.121) * (-450.816) (-452.109) (-456.141) [-449.556] -- 0:00:37
371500 -- (-449.908) (-450.888) (-452.205) [-451.037] * [-451.240] (-449.658) (-451.763) (-451.216) -- 0:00:37
372000 -- (-449.401) [-451.075] (-449.866) (-449.743) * [-451.848] (-450.924) (-450.300) (-450.571) -- 0:00:37
372500 -- (-450.998) (-451.979) (-450.966) [-450.996] * (-452.046) (-451.862) (-451.847) [-450.617] -- 0:00:37
373000 -- (-452.240) (-452.014) [-449.651] (-452.208) * [-450.234] (-450.541) (-453.037) (-450.958) -- 0:00:36
373500 -- (-451.882) (-452.536) (-451.142) [-455.510] * [-450.456] (-449.795) (-454.921) (-450.269) -- 0:00:36
374000 -- (-450.873) (-449.923) (-451.145) [-452.207] * (-452.957) (-451.513) (-450.289) [-452.658] -- 0:00:36
374500 -- [-450.489] (-449.462) (-452.142) (-451.337) * [-450.901] (-451.322) (-450.610) (-450.911) -- 0:00:36
375000 -- (-450.713) (-450.937) (-454.523) [-450.672] * (-450.843) [-449.683] (-452.560) (-450.198) -- 0:00:36
Average standard deviation of split frequencies: 0.010578
375500 -- (-450.921) (-458.966) (-452.528) [-451.505] * (-449.576) [-452.902] (-452.006) (-450.775) -- 0:00:36
376000 -- (-452.084) (-450.989) (-451.124) [-450.127] * (-460.018) [-450.520] (-453.120) (-450.446) -- 0:00:36
376500 -- (-450.354) [-450.526] (-454.276) (-449.472) * (-461.081) (-452.290) [-451.056] (-450.869) -- 0:00:36
377000 -- [-451.708] (-451.123) (-451.795) (-452.320) * [-453.198] (-460.400) (-451.464) (-452.813) -- 0:00:36
377500 -- (-450.148) (-451.023) [-450.696] (-452.570) * [-449.424] (-451.426) (-449.775) (-451.953) -- 0:00:36
378000 -- (-451.753) (-450.275) [-451.559] (-450.795) * (-451.744) (-452.699) [-452.018] (-450.136) -- 0:00:36
378500 -- (-449.382) (-451.916) (-451.177) [-452.084] * [-449.195] (-452.543) (-453.362) (-449.304) -- 0:00:36
379000 -- (-450.638) (-450.811) [-450.202] (-452.723) * (-449.533) (-451.699) [-453.023] (-453.022) -- 0:00:36
379500 -- [-450.726] (-454.728) (-450.045) (-452.949) * [-450.692] (-456.358) (-452.369) (-452.503) -- 0:00:35
380000 -- [-450.151] (-458.956) (-449.948) (-450.031) * (-451.523) (-452.694) [-451.789] (-450.607) -- 0:00:35
Average standard deviation of split frequencies: 0.010758
380500 -- [-455.167] (-451.615) (-449.860) (-450.728) * (-454.399) (-451.219) (-451.100) [-450.539] -- 0:00:35
381000 -- (-451.344) [-452.391] (-449.259) (-451.863) * [-449.915] (-450.520) (-451.216) (-456.979) -- 0:00:35
381500 -- [-451.138] (-452.745) (-455.155) (-450.538) * (-450.350) [-450.602] (-449.424) (-451.022) -- 0:00:37
382000 -- [-451.646] (-451.451) (-451.953) (-452.785) * (-450.930) (-451.160) [-452.321] (-453.079) -- 0:00:37
382500 -- (-451.932) [-450.579] (-453.344) (-455.969) * (-451.635) [-454.527] (-450.183) (-454.334) -- 0:00:37
383000 -- [-450.777] (-453.179) (-453.343) (-452.961) * [-452.399] (-455.718) (-453.183) (-452.200) -- 0:00:37
383500 -- (-449.943) (-451.234) (-458.975) [-450.618] * (-451.371) (-451.004) [-455.744] (-449.986) -- 0:00:36
384000 -- (-451.818) (-452.110) (-456.351) [-451.653] * [-452.031] (-454.220) (-450.870) (-452.437) -- 0:00:36
384500 -- (-455.057) (-451.335) (-452.130) [-451.326] * (-452.343) (-455.180) [-450.153] (-451.722) -- 0:00:36
385000 -- (-452.383) [-451.948] (-450.453) (-449.558) * (-452.044) (-452.078) [-450.821] (-451.621) -- 0:00:36
Average standard deviation of split frequencies: 0.010457
385500 -- (-450.376) (-451.332) [-452.296] (-452.465) * (-451.970) (-454.069) [-455.299] (-451.131) -- 0:00:36
386000 -- (-451.816) [-450.412] (-452.464) (-449.660) * (-451.120) [-450.287] (-449.567) (-450.194) -- 0:00:36
386500 -- [-451.028] (-453.039) (-451.910) (-449.657) * [-453.815] (-449.283) (-451.097) (-455.955) -- 0:00:36
387000 -- (-450.015) (-455.445) [-450.769] (-452.752) * (-452.488) (-450.418) (-451.097) [-450.669] -- 0:00:36
387500 -- (-451.076) [-450.573] (-451.802) (-456.933) * (-451.982) (-451.898) [-452.916] (-452.030) -- 0:00:36
388000 -- (-450.636) (-454.985) [-450.282] (-451.263) * (-452.225) [-450.370] (-452.439) (-450.574) -- 0:00:36
388500 -- (-451.409) (-454.748) (-452.179) [-450.507] * (-450.507) (-452.337) (-453.163) [-450.857] -- 0:00:36
389000 -- (-453.876) [-453.569] (-455.092) (-450.954) * (-458.825) (-451.234) [-451.931] (-451.200) -- 0:00:36
389500 -- (-450.907) (-453.890) (-458.554) [-453.687] * [-452.848] (-451.044) (-454.812) (-452.871) -- 0:00:36
390000 -- [-450.169] (-451.250) (-451.487) (-453.617) * (-451.768) [-451.904] (-453.496) (-451.913) -- 0:00:35
Average standard deviation of split frequencies: 0.009880
390500 -- (-449.846) (-451.338) [-451.679] (-450.345) * (-450.682) (-450.038) (-451.816) [-450.635] -- 0:00:35
391000 -- (-451.451) (-450.532) [-451.074] (-451.113) * [-451.161] (-457.535) (-458.882) (-451.008) -- 0:00:35
391500 -- (-451.751) (-454.291) (-451.341) [-452.106] * [-451.559] (-452.600) (-456.701) (-451.682) -- 0:00:35
392000 -- (-451.470) (-452.284) (-452.073) [-452.810] * (-449.690) (-450.995) (-453.296) [-450.994] -- 0:00:35
392500 -- (-449.371) (-451.598) (-450.870) [-453.973] * (-450.357) (-449.781) (-449.694) [-450.508] -- 0:00:35
393000 -- [-450.146] (-450.274) (-451.556) (-453.737) * (-452.047) (-453.167) (-450.008) [-451.785] -- 0:00:35
393500 -- (-449.713) (-451.828) [-450.504] (-450.649) * [-451.120] (-455.007) (-451.888) (-452.081) -- 0:00:35
394000 -- (-451.240) (-454.547) (-454.623) [-449.666] * [-452.115] (-453.747) (-449.809) (-450.575) -- 0:00:35
394500 -- (-453.364) (-453.552) (-451.960) [-452.032] * (-449.647) (-450.626) [-451.542] (-451.292) -- 0:00:35
395000 -- (-453.715) (-455.403) (-453.532) [-452.051] * (-450.097) (-449.627) (-451.355) [-451.352] -- 0:00:35
Average standard deviation of split frequencies: 0.010342
395500 -- (-453.584) (-450.325) [-458.663] (-450.721) * (-451.180) (-449.384) (-451.040) [-451.419] -- 0:00:35
396000 -- (-450.529) (-454.588) [-451.715] (-453.134) * [-449.772] (-450.693) (-450.409) (-454.020) -- 0:00:35
396500 -- (-453.239) (-450.802) [-451.669] (-452.000) * (-452.083) [-451.283] (-450.928) (-452.382) -- 0:00:35
397000 -- [-451.976] (-451.818) (-451.252) (-452.655) * (-452.329) (-450.757) [-452.726] (-451.279) -- 0:00:34
397500 -- [-450.355] (-450.733) (-453.734) (-449.664) * (-456.217) (-450.706) [-451.917] (-456.136) -- 0:00:34
398000 -- (-455.766) (-449.334) [-452.610] (-449.924) * (-458.081) (-453.451) (-452.038) [-455.226] -- 0:00:34
398500 -- [-450.701] (-449.279) (-453.490) (-453.378) * (-452.091) (-451.594) [-450.830] (-450.677) -- 0:00:36
399000 -- (-451.221) (-452.256) [-449.808] (-451.811) * (-452.522) [-449.978] (-452.628) (-452.831) -- 0:00:36
399500 -- (-452.849) [-450.446] (-451.940) (-450.524) * (-452.360) (-450.194) (-453.706) [-451.253] -- 0:00:36
400000 -- [-452.431] (-452.342) (-452.048) (-452.479) * (-451.249) [-450.192] (-450.606) (-454.633) -- 0:00:36
Average standard deviation of split frequencies: 0.008314
400500 -- (-452.054) (-450.151) [-450.626] (-452.039) * (-452.747) [-450.802] (-451.415) (-450.524) -- 0:00:35
401000 -- (-452.935) [-452.497] (-451.813) (-450.981) * (-449.969) [-449.611] (-454.118) (-452.854) -- 0:00:35
401500 -- [-450.218] (-460.999) (-451.254) (-451.448) * (-451.137) (-449.273) (-450.739) [-452.096] -- 0:00:35
402000 -- (-449.766) (-462.279) [-450.589] (-451.041) * [-451.879] (-451.604) (-450.686) (-453.095) -- 0:00:35
402500 -- (-449.752) (-452.562) [-452.202] (-450.647) * (-453.102) [-452.478] (-449.396) (-451.315) -- 0:00:35
403000 -- (-450.325) [-450.376] (-454.649) (-451.154) * [-451.077] (-450.203) (-452.842) (-450.004) -- 0:00:35
403500 -- [-451.554] (-452.209) (-450.343) (-451.804) * [-450.160] (-454.222) (-453.174) (-450.170) -- 0:00:35
404000 -- [-453.791] (-452.705) (-451.266) (-452.808) * [-452.330] (-453.423) (-453.131) (-449.955) -- 0:00:35
404500 -- [-452.664] (-449.968) (-450.715) (-451.658) * [-457.455] (-456.556) (-450.646) (-451.205) -- 0:00:35
405000 -- (-454.020) (-449.881) [-449.483] (-450.023) * (-453.433) (-449.518) [-452.438] (-449.898) -- 0:00:35
Average standard deviation of split frequencies: 0.007895
405500 -- [-449.814] (-450.117) (-449.166) (-450.614) * [-449.259] (-454.495) (-451.047) (-450.926) -- 0:00:35
406000 -- (-450.268) (-451.018) [-451.215] (-451.548) * (-457.637) (-453.976) (-451.626) [-450.181] -- 0:00:35
406500 -- [-450.064] (-450.636) (-455.048) (-449.573) * (-453.874) [-456.199] (-450.282) (-451.446) -- 0:00:35
407000 -- (-451.575) (-454.378) [-454.781] (-451.549) * (-450.972) [-451.605] (-451.535) (-452.603) -- 0:00:34
407500 -- [-452.117] (-453.054) (-451.626) (-452.780) * (-449.556) (-451.011) [-449.935] (-455.699) -- 0:00:34
408000 -- (-452.333) [-449.873] (-449.773) (-450.869) * (-451.361) (-450.647) (-451.018) [-454.445] -- 0:00:34
408500 -- (-451.780) (-451.018) [-450.355] (-451.508) * [-450.475] (-451.105) (-452.057) (-455.504) -- 0:00:34
409000 -- (-451.160) [-451.689] (-450.056) (-452.273) * (-450.454) [-451.347] (-453.892) (-455.708) -- 0:00:34
409500 -- (-454.447) [-455.054] (-451.575) (-451.206) * (-450.531) (-449.562) (-455.855) [-450.602] -- 0:00:34
410000 -- (-450.326) (-454.153) [-453.941] (-449.802) * (-454.213) [-450.690] (-452.428) (-459.001) -- 0:00:34
Average standard deviation of split frequencies: 0.007882
410500 -- (-450.254) [-452.698] (-451.737) (-454.286) * (-449.800) [-452.476] (-452.065) (-454.929) -- 0:00:34
411000 -- (-450.261) (-452.231) [-450.037] (-452.549) * (-450.587) (-452.221) (-451.518) [-452.740] -- 0:00:34
411500 -- (-452.325) [-450.614] (-449.863) (-450.687) * (-454.451) (-450.766) (-458.518) [-450.547] -- 0:00:34
412000 -- (-451.636) [-454.049] (-450.340) (-451.004) * (-450.240) (-450.838) (-454.586) [-452.829] -- 0:00:34
412500 -- (-450.592) (-451.888) [-450.356] (-452.701) * (-454.620) (-452.392) (-450.624) [-451.392] -- 0:00:34
413000 -- [-450.115] (-452.477) (-450.688) (-451.806) * [-452.190] (-449.961) (-451.548) (-449.619) -- 0:00:34
413500 -- (-452.885) (-451.076) [-449.713] (-450.297) * (-450.922) [-451.630] (-453.369) (-449.995) -- 0:00:34
414000 -- (-454.645) [-455.753] (-450.983) (-449.846) * [-450.605] (-450.563) (-451.816) (-450.038) -- 0:00:33
414500 -- (-452.436) (-452.099) (-451.512) [-449.307] * (-456.858) (-453.719) (-456.185) [-450.218] -- 0:00:33
415000 -- [-452.190] (-450.566) (-449.631) (-452.269) * (-450.770) (-451.946) (-449.108) [-452.618] -- 0:00:35
Average standard deviation of split frequencies: 0.007857
415500 -- [-454.041] (-450.557) (-449.976) (-452.803) * [-450.685] (-449.778) (-450.591) (-451.544) -- 0:00:35
416000 -- (-451.305) [-452.200] (-450.272) (-451.787) * [-449.959] (-451.305) (-451.940) (-452.108) -- 0:00:35
416500 -- (-453.498) (-449.967) (-451.602) [-452.309] * (-451.361) [-452.317] (-451.276) (-452.378) -- 0:00:35
417000 -- (-450.122) (-455.037) [-450.239] (-451.782) * (-450.874) (-450.188) [-450.677] (-450.677) -- 0:00:34
417500 -- [-452.795] (-449.918) (-451.351) (-451.755) * [-453.015] (-453.767) (-452.173) (-451.500) -- 0:00:34
418000 -- (-452.662) (-451.118) [-450.568] (-450.180) * (-453.589) [-452.615] (-451.997) (-453.377) -- 0:00:34
418500 -- [-452.249] (-450.992) (-452.116) (-452.663) * [-451.580] (-449.445) (-450.086) (-452.841) -- 0:00:34
419000 -- (-452.247) (-451.370) (-449.863) [-454.952] * (-451.323) (-449.595) (-452.336) [-452.932] -- 0:00:34
419500 -- (-450.301) (-449.380) (-450.546) [-455.438] * [-454.516] (-453.110) (-452.930) (-452.253) -- 0:00:34
420000 -- (-455.779) [-449.875] (-452.120) (-450.491) * (-453.310) (-450.020) [-452.146] (-452.119) -- 0:00:34
Average standard deviation of split frequencies: 0.007247
420500 -- (-451.903) (-450.390) (-450.530) [-449.556] * (-450.238) (-449.989) [-452.076] (-451.885) -- 0:00:34
421000 -- (-456.516) (-450.294) [-452.207] (-451.799) * [-451.469] (-454.827) (-453.214) (-451.754) -- 0:00:34
421500 -- [-451.554] (-452.157) (-451.761) (-452.407) * (-451.718) (-450.258) [-452.005] (-452.164) -- 0:00:34
422000 -- [-451.214] (-450.488) (-450.939) (-456.446) * [-450.869] (-453.428) (-451.192) (-451.290) -- 0:00:34
422500 -- (-451.384) (-455.962) (-453.522) [-450.089] * [-452.978] (-450.781) (-450.124) (-450.416) -- 0:00:34
423000 -- (-450.055) (-451.022) [-450.725] (-450.549) * (-457.752) [-451.590] (-451.874) (-451.422) -- 0:00:34
423500 -- (-451.048) (-455.721) [-450.966] (-450.233) * [-454.091] (-449.533) (-452.189) (-450.048) -- 0:00:34
424000 -- (-449.576) [-449.428] (-450.256) (-450.738) * (-451.277) (-451.325) [-453.220] (-451.944) -- 0:00:33
424500 -- (-450.831) (-450.388) (-449.802) [-450.434] * (-454.008) (-451.172) (-454.582) [-449.518] -- 0:00:33
425000 -- (-449.924) [-450.044] (-449.807) (-450.669) * [-450.267] (-454.971) (-453.638) (-452.100) -- 0:00:33
Average standard deviation of split frequencies: 0.008507
425500 -- (-451.306) (-450.261) (-451.789) [-450.316] * (-450.423) (-453.001) [-450.328] (-449.694) -- 0:00:33
426000 -- [-450.926] (-453.582) (-453.403) (-454.619) * (-450.250) (-455.171) [-450.797] (-450.311) -- 0:00:33
426500 -- (-452.337) [-450.682] (-454.574) (-452.168) * (-450.764) (-450.369) [-451.753] (-453.785) -- 0:00:33
427000 -- [-457.991] (-450.523) (-450.830) (-452.848) * [-449.526] (-451.139) (-455.985) (-453.844) -- 0:00:33
427500 -- [-451.658] (-449.909) (-453.028) (-451.366) * (-449.429) [-452.296] (-459.774) (-452.031) -- 0:00:33
428000 -- [-453.232] (-454.170) (-454.453) (-450.944) * (-454.005) (-451.216) (-452.702) [-450.494] -- 0:00:33
428500 -- (-452.691) (-451.554) [-453.538] (-451.129) * (-452.275) (-456.395) (-451.775) [-450.632] -- 0:00:33
429000 -- (-450.422) [-451.013] (-453.318) (-451.845) * (-453.368) (-456.236) [-450.743] (-451.024) -- 0:00:33
429500 -- (-449.191) (-451.798) (-452.476) [-450.018] * [-452.173] (-451.253) (-451.408) (-450.344) -- 0:00:33
430000 -- [-451.964] (-452.638) (-454.596) (-450.579) * [-451.914] (-450.622) (-452.892) (-450.973) -- 0:00:33
Average standard deviation of split frequencies: 0.008415
430500 -- (-454.139) (-451.002) [-450.095] (-450.465) * (-451.540) [-454.113] (-451.027) (-449.842) -- 0:00:33
431000 -- [-450.581] (-451.236) (-455.731) (-455.333) * (-451.732) [-450.722] (-451.973) (-451.558) -- 0:00:33
431500 -- (-453.489) (-451.497) [-451.293] (-452.218) * (-451.238) (-450.189) (-450.331) [-450.137] -- 0:00:34
432000 -- (-453.681) (-453.506) (-455.872) [-450.261] * (-451.154) (-449.751) [-450.985] (-451.111) -- 0:00:34
432500 -- [-450.548] (-451.262) (-452.187) (-449.711) * (-451.091) (-449.910) [-450.294] (-450.195) -- 0:00:34
433000 -- (-450.494) [-450.943] (-451.509) (-452.644) * (-449.324) [-450.100] (-450.723) (-451.627) -- 0:00:34
433500 -- (-451.735) [-453.202] (-450.791) (-451.245) * (-454.874) [-449.989] (-451.594) (-451.503) -- 0:00:33
434000 -- (-454.776) (-449.931) (-451.644) [-451.485] * [-450.265] (-451.769) (-451.485) (-452.530) -- 0:00:33
434500 -- (-454.186) (-453.086) [-450.793] (-453.112) * (-452.571) (-451.751) (-449.779) [-449.623] -- 0:00:33
435000 -- (-456.941) (-450.267) [-450.648] (-452.139) * (-454.143) (-450.744) (-449.696) [-451.309] -- 0:00:33
Average standard deviation of split frequencies: 0.008177
435500 -- [-449.761] (-449.982) (-454.512) (-450.740) * (-455.528) (-450.602) [-450.959] (-450.394) -- 0:00:33
436000 -- (-451.868) [-452.140] (-450.645) (-450.195) * (-453.942) [-452.096] (-449.889) (-451.548) -- 0:00:33
436500 -- [-452.237] (-451.256) (-450.176) (-451.711) * (-454.004) [-450.727] (-450.970) (-449.553) -- 0:00:33
437000 -- (-454.009) (-450.346) [-451.770] (-450.889) * (-450.690) (-449.680) [-451.417] (-453.581) -- 0:00:33
437500 -- (-452.180) [-450.827] (-451.789) (-449.699) * (-453.884) (-451.868) [-449.823] (-451.528) -- 0:00:33
438000 -- (-455.399) [-453.684] (-451.187) (-451.016) * (-450.305) (-450.067) [-452.351] (-452.559) -- 0:00:33
438500 -- [-450.764] (-451.987) (-451.787) (-457.141) * (-451.353) [-452.830] (-450.233) (-451.992) -- 0:00:33
439000 -- (-452.302) (-450.119) (-450.912) [-451.827] * [-451.039] (-451.494) (-452.388) (-454.590) -- 0:00:33
439500 -- [-450.737] (-451.506) (-451.212) (-450.076) * (-452.079) (-450.563) [-451.520] (-457.237) -- 0:00:33
440000 -- (-457.783) [-454.821] (-450.840) (-450.611) * (-454.318) (-452.254) (-452.027) [-450.661] -- 0:00:33
Average standard deviation of split frequencies: 0.007774
440500 -- [-452.339] (-452.038) (-450.519) (-450.155) * (-451.654) (-452.719) [-451.297] (-452.001) -- 0:00:33
441000 -- (-452.066) (-450.891) [-450.002] (-450.522) * [-451.988] (-451.847) (-453.383) (-453.895) -- 0:00:32
441500 -- [-451.782] (-450.378) (-451.292) (-451.349) * [-452.665] (-449.573) (-451.932) (-453.013) -- 0:00:32
442000 -- (-450.607) (-452.001) (-450.780) [-450.297] * (-451.193) (-453.855) (-455.770) [-450.657] -- 0:00:32
442500 -- (-451.238) (-454.969) (-450.673) [-450.170] * [-450.606] (-455.805) (-454.569) (-449.601) -- 0:00:32
443000 -- [-451.180] (-452.007) (-449.996) (-452.688) * (-450.344) (-451.075) (-449.296) [-450.714] -- 0:00:32
443500 -- (-454.964) (-454.455) [-452.839] (-450.693) * (-450.368) [-450.692] (-451.764) (-454.189) -- 0:00:32
444000 -- (-451.188) [-453.423] (-451.942) (-450.420) * (-451.287) (-450.207) (-450.760) [-452.510] -- 0:00:32
444500 -- (-449.777) (-453.160) [-452.743] (-452.463) * (-449.209) (-450.310) (-450.911) [-452.538] -- 0:00:32
445000 -- (-450.612) (-451.691) (-451.111) [-451.539] * [-450.748] (-450.529) (-449.454) (-453.153) -- 0:00:32
Average standard deviation of split frequencies: 0.008394
445500 -- (-450.872) (-451.049) (-451.107) [-451.900] * (-453.167) (-452.019) (-449.708) [-455.488] -- 0:00:32
446000 -- (-453.263) [-451.800] (-450.958) (-453.742) * (-451.232) (-454.625) (-449.360) [-452.728] -- 0:00:32
446500 -- [-450.020] (-452.003) (-452.184) (-450.337) * (-452.560) (-451.996) (-451.728) [-451.520] -- 0:00:32
447000 -- (-451.671) (-451.695) (-452.615) [-452.790] * (-451.348) (-451.404) [-450.262] (-450.483) -- 0:00:32
447500 -- [-449.614] (-453.198) (-454.672) (-451.973) * (-452.317) (-452.591) (-452.390) [-456.272] -- 0:00:32
448000 -- [-450.873] (-450.281) (-454.194) (-453.194) * [-451.411] (-453.414) (-451.268) (-450.968) -- 0:00:32
448500 -- (-450.359) [-449.993] (-451.334) (-451.082) * (-449.553) [-449.486] (-452.206) (-451.432) -- 0:00:33
449000 -- (-451.156) [-451.403] (-452.593) (-449.759) * (-455.004) (-450.035) (-450.814) [-452.186] -- 0:00:33
449500 -- (-451.528) (-451.711) [-449.796] (-449.809) * (-451.601) (-450.112) (-450.093) [-453.227] -- 0:00:33
450000 -- [-453.693] (-450.161) (-453.511) (-449.812) * [-451.975] (-451.260) (-452.778) (-452.103) -- 0:00:33
Average standard deviation of split frequencies: 0.008760
450500 -- (-449.508) (-451.143) [-453.220] (-451.040) * (-453.022) [-449.713] (-456.477) (-453.870) -- 0:00:32
451000 -- (-449.497) (-453.002) (-449.811) [-451.009] * (-451.450) (-449.764) [-451.441] (-455.580) -- 0:00:32
451500 -- (-449.447) (-452.820) [-451.528] (-451.399) * (-454.016) (-449.786) (-449.834) [-451.596] -- 0:00:32
452000 -- [-452.587] (-449.969) (-452.631) (-449.551) * [-453.041] (-451.631) (-449.595) (-454.706) -- 0:00:32
452500 -- (-453.735) (-451.864) [-450.809] (-450.520) * (-453.385) (-451.183) (-450.687) [-452.792] -- 0:00:32
453000 -- (-450.649) [-451.982] (-452.152) (-450.604) * (-451.062) (-451.726) (-451.469) [-454.914] -- 0:00:32
453500 -- [-452.435] (-451.200) (-450.930) (-449.761) * (-451.911) (-451.109) (-451.635) [-451.317] -- 0:00:32
454000 -- (-450.308) [-453.238] (-458.332) (-455.336) * (-451.134) [-450.864] (-449.195) (-457.284) -- 0:00:32
454500 -- (-451.525) (-449.784) (-451.647) [-451.362] * [-452.152] (-449.923) (-449.754) (-452.908) -- 0:00:32
455000 -- (-451.720) [-451.418] (-451.279) (-450.831) * (-450.978) (-449.293) (-449.979) [-450.837] -- 0:00:32
Average standard deviation of split frequencies: 0.008787
455500 -- (-451.904) (-455.273) (-451.015) [-449.766] * [-451.789] (-450.877) (-454.800) (-451.380) -- 0:00:32
456000 -- (-451.648) (-451.977) [-451.606] (-450.308) * (-450.007) (-453.543) [-454.171] (-450.743) -- 0:00:32
456500 -- (-450.631) [-451.607] (-453.709) (-450.943) * (-449.952) [-450.593] (-452.614) (-454.250) -- 0:00:32
457000 -- (-450.342) (-451.627) (-456.045) [-449.801] * (-450.185) [-451.427] (-450.694) (-450.814) -- 0:00:32
457500 -- (-450.579) (-452.127) (-452.788) [-450.993] * (-451.659) (-453.973) (-452.088) [-453.636] -- 0:00:32
458000 -- (-452.158) (-454.100) (-451.597) [-451.495] * (-450.452) (-450.881) [-450.864] (-451.261) -- 0:00:31
458500 -- (-454.288) (-451.476) [-451.097] (-451.336) * (-452.438) [-450.233] (-451.906) (-450.358) -- 0:00:31
459000 -- (-452.311) [-452.085] (-450.181) (-451.739) * (-451.841) (-454.436) (-453.054) [-450.193] -- 0:00:31
459500 -- (-451.573) [-451.073] (-451.877) (-452.611) * (-451.609) [-449.395] (-451.248) (-449.230) -- 0:00:31
460000 -- [-453.325] (-453.411) (-450.810) (-453.114) * [-452.252] (-450.602) (-451.862) (-449.895) -- 0:00:31
Average standard deviation of split frequencies: 0.009210
460500 -- (-454.523) [-451.315] (-452.225) (-451.156) * [-450.111] (-450.839) (-458.168) (-452.876) -- 0:00:31
461000 -- [-451.521] (-450.876) (-451.544) (-453.028) * [-450.598] (-450.010) (-456.683) (-454.002) -- 0:00:31
461500 -- [-451.350] (-452.848) (-454.646) (-450.752) * (-451.178) (-451.001) [-450.078] (-452.927) -- 0:00:31
462000 -- (-451.739) (-455.041) [-452.128] (-453.078) * (-453.851) [-450.219] (-449.811) (-450.364) -- 0:00:31
462500 -- (-450.440) [-451.542] (-449.488) (-452.268) * (-451.240) [-453.248] (-453.503) (-452.234) -- 0:00:31
463000 -- (-449.641) [-452.560] (-451.920) (-451.490) * [-454.727] (-455.897) (-451.010) (-452.227) -- 0:00:31
463500 -- (-451.300) (-452.811) [-451.075] (-450.333) * (-452.412) [-452.456] (-451.064) (-452.473) -- 0:00:31
464000 -- (-450.624) [-450.086] (-451.406) (-453.926) * (-451.638) (-452.739) [-456.791] (-452.041) -- 0:00:31
464500 -- (-451.850) (-450.677) [-449.432] (-452.504) * (-453.120) (-451.991) [-452.213] (-451.947) -- 0:00:31
465000 -- (-451.032) (-451.040) [-454.701] (-450.334) * [-452.628] (-453.898) (-451.245) (-452.309) -- 0:00:31
Average standard deviation of split frequencies: 0.009666
465500 -- (-450.522) (-451.728) [-452.109] (-451.685) * (-456.861) (-452.695) (-449.986) [-452.952] -- 0:00:32
466000 -- (-450.333) (-450.682) (-452.579) [-450.609] * [-454.079] (-451.307) (-450.019) (-449.736) -- 0:00:32
466500 -- (-451.044) [-449.229] (-450.793) (-449.471) * [-455.019] (-452.588) (-450.067) (-450.971) -- 0:00:32
467000 -- (-449.731) (-450.500) [-449.223] (-452.935) * (-450.456) (-452.083) [-451.138] (-454.867) -- 0:00:31
467500 -- (-455.432) (-450.743) (-452.903) [-453.165] * [-452.708] (-450.376) (-451.691) (-450.614) -- 0:00:31
468000 -- (-456.391) (-455.527) [-451.621] (-450.574) * [-452.706] (-449.445) (-450.961) (-451.920) -- 0:00:31
468500 -- (-451.720) (-455.528) (-451.430) [-451.064] * (-455.755) (-451.235) [-450.872] (-453.775) -- 0:00:31
469000 -- (-453.482) [-454.149] (-450.124) (-454.946) * (-456.819) [-454.084] (-450.469) (-451.873) -- 0:00:31
469500 -- (-450.656) [-452.108] (-450.100) (-452.524) * [-451.897] (-452.049) (-453.349) (-450.691) -- 0:00:31
470000 -- (-450.481) (-450.589) (-449.924) [-451.601] * [-450.246] (-449.314) (-451.586) (-455.039) -- 0:00:31
Average standard deviation of split frequencies: 0.009077
470500 -- [-454.709] (-456.476) (-453.233) (-453.552) * (-450.093) (-450.610) [-450.088] (-451.529) -- 0:00:31
471000 -- (-450.560) (-451.054) (-451.147) [-457.106] * (-452.731) [-453.777] (-450.666) (-454.253) -- 0:00:31
471500 -- (-452.526) (-454.372) [-455.044] (-456.301) * (-452.656) [-450.252] (-451.651) (-453.290) -- 0:00:31
472000 -- (-451.191) (-451.164) (-457.253) [-450.744] * (-451.042) (-451.488) (-451.047) [-452.022] -- 0:00:31
472500 -- (-450.969) (-450.653) [-449.749] (-451.457) * [-451.912] (-450.023) (-452.355) (-450.968) -- 0:00:31
473000 -- (-454.276) (-452.203) (-450.878) [-451.288] * (-450.645) [-451.995] (-454.112) (-451.300) -- 0:00:31
473500 -- [-450.384] (-452.141) (-450.239) (-452.156) * (-454.928) (-451.669) [-450.607] (-457.880) -- 0:00:31
474000 -- (-456.230) (-451.068) [-450.990] (-450.606) * (-451.342) (-454.083) (-452.662) [-454.440] -- 0:00:31
474500 -- (-453.932) [-450.009] (-453.078) (-450.078) * [-451.581] (-452.638) (-454.578) (-450.769) -- 0:00:31
475000 -- (-449.313) (-453.501) [-452.114] (-452.996) * (-451.032) (-451.412) [-455.098] (-450.075) -- 0:00:30
Average standard deviation of split frequencies: 0.009470
475500 -- [-452.950] (-450.856) (-451.671) (-453.074) * [-449.396] (-452.344) (-456.972) (-451.695) -- 0:00:30
476000 -- (-449.634) (-450.103) (-451.273) [-450.390] * (-452.084) [-451.386] (-453.972) (-449.903) -- 0:00:30
476500 -- (-452.791) (-452.375) [-450.770] (-452.715) * (-450.010) (-456.898) (-452.685) [-450.767] -- 0:00:30
477000 -- (-452.273) [-452.812] (-449.937) (-450.115) * (-453.013) (-452.719) [-450.755] (-452.374) -- 0:00:30
477500 -- (-452.322) (-452.264) [-453.724] (-453.400) * [-453.604] (-452.501) (-450.011) (-450.013) -- 0:00:30
478000 -- (-454.330) (-450.464) (-453.103) [-450.043] * (-452.194) (-451.808) (-451.595) [-450.727] -- 0:00:30
478500 -- [-454.376] (-450.692) (-455.710) (-451.754) * (-451.159) (-454.451) (-450.190) [-451.856] -- 0:00:30
479000 -- (-451.822) (-450.592) [-452.065] (-453.291) * (-450.843) (-452.467) (-450.638) [-449.468] -- 0:00:30
479500 -- (-451.641) (-455.268) (-452.180) [-452.200] * (-452.917) [-450.777] (-451.944) (-453.872) -- 0:00:30
480000 -- (-455.547) (-452.658) [-450.909] (-449.446) * [-453.525] (-450.716) (-450.326) (-450.722) -- 0:00:30
Average standard deviation of split frequencies: 0.009991
480500 -- (-450.837) (-450.194) (-450.501) [-452.403] * (-452.752) (-452.120) [-451.264] (-450.670) -- 0:00:30
481000 -- (-450.224) (-450.528) (-451.531) [-452.688] * (-453.799) (-451.093) (-449.491) [-449.470] -- 0:00:30
481500 -- [-453.108] (-455.651) (-452.176) (-451.094) * (-451.078) [-452.578] (-449.930) (-449.845) -- 0:00:30
482000 -- (-450.941) (-452.697) (-452.576) [-451.303] * [-452.994] (-451.561) (-449.310) (-450.306) -- 0:00:30
482500 -- (-453.123) (-449.656) [-451.091] (-450.987) * [-450.723] (-452.651) (-457.443) (-454.565) -- 0:00:31
483000 -- (-452.335) (-452.122) (-454.812) [-450.981] * (-455.233) (-453.411) [-450.641] (-450.529) -- 0:00:31
483500 -- (-455.447) [-451.968] (-449.635) (-451.299) * (-457.932) [-452.680] (-450.230) (-451.558) -- 0:00:30
484000 -- (-454.417) (-451.659) (-449.929) [-450.536] * (-450.985) (-449.438) [-450.692] (-449.554) -- 0:00:30
484500 -- (-454.048) (-452.608) (-452.712) [-451.461] * (-450.271) (-453.686) [-454.019] (-451.668) -- 0:00:30
485000 -- (-452.536) (-456.183) (-454.058) [-451.773] * (-455.359) (-453.572) [-451.645] (-449.773) -- 0:00:30
Average standard deviation of split frequencies: 0.009586
485500 -- (-452.234) (-450.026) [-452.056] (-452.289) * (-451.670) [-452.289] (-450.806) (-454.471) -- 0:00:30
486000 -- [-454.941] (-449.194) (-450.695) (-451.410) * (-451.068) [-451.317] (-452.611) (-452.418) -- 0:00:30
486500 -- (-450.478) [-449.197] (-450.285) (-452.757) * (-452.296) (-453.710) [-451.884] (-450.467) -- 0:00:30
487000 -- [-451.224] (-449.387) (-451.185) (-451.812) * (-451.247) (-451.072) (-451.205) [-450.223] -- 0:00:30
487500 -- (-451.249) [-450.382] (-450.582) (-454.858) * (-449.293) (-450.555) (-452.406) [-451.408] -- 0:00:30
488000 -- [-451.579] (-453.215) (-450.493) (-449.805) * (-452.920) (-455.662) (-450.920) [-450.594] -- 0:00:30
488500 -- (-449.848) [-452.347] (-452.745) (-450.718) * (-449.229) [-453.487] (-450.453) (-454.980) -- 0:00:30
489000 -- (-451.467) (-451.420) [-449.425] (-452.051) * (-450.798) [-452.210] (-454.036) (-458.714) -- 0:00:30
489500 -- (-450.496) (-451.156) [-451.804] (-457.154) * (-449.847) (-456.578) (-450.125) [-455.052] -- 0:00:30
490000 -- (-450.097) (-450.488) [-452.023] (-451.808) * (-449.812) [-455.453] (-451.630) (-452.633) -- 0:00:30
Average standard deviation of split frequencies: 0.010208
490500 -- (-450.830) (-452.544) [-450.229] (-453.667) * (-449.296) [-450.951] (-452.868) (-452.945) -- 0:00:30
491000 -- (-450.468) (-450.751) [-450.182] (-451.435) * [-450.871] (-451.754) (-450.451) (-453.885) -- 0:00:30
491500 -- [-450.806] (-457.590) (-453.035) (-452.661) * (-451.289) (-451.121) [-452.804] (-451.108) -- 0:00:30
492000 -- (-450.043) (-452.685) [-449.518] (-456.947) * (-454.435) (-449.856) (-451.065) [-450.870] -- 0:00:29
492500 -- (-452.688) (-450.240) [-449.949] (-452.893) * (-450.910) [-450.201] (-453.559) (-449.913) -- 0:00:29
493000 -- (-451.812) (-451.765) [-451.887] (-451.704) * (-451.614) [-451.388] (-454.130) (-450.280) -- 0:00:29
493500 -- (-450.653) (-451.506) (-452.428) [-450.577] * [-450.485] (-452.684) (-450.226) (-452.189) -- 0:00:29
494000 -- (-451.134) (-451.219) [-450.362] (-462.068) * (-456.150) (-450.964) [-451.552] (-453.469) -- 0:00:29
494500 -- (-451.957) (-450.517) [-452.144] (-453.966) * (-456.856) (-449.708) [-455.809] (-449.918) -- 0:00:29
495000 -- (-452.488) [-451.467] (-450.230) (-454.310) * (-451.532) [-450.767] (-453.509) (-453.121) -- 0:00:29
Average standard deviation of split frequencies: 0.010276
495500 -- [-449.428] (-450.458) (-450.406) (-450.883) * (-451.615) (-451.165) (-453.979) [-451.326] -- 0:00:29
496000 -- [-450.898] (-451.805) (-450.598) (-452.655) * (-451.632) [-451.162] (-455.742) (-450.966) -- 0:00:29
496500 -- (-450.279) (-449.576) [-451.439] (-450.753) * (-450.332) (-452.252) [-451.509] (-450.830) -- 0:00:29
497000 -- (-450.974) (-457.601) (-450.799) [-450.968] * (-451.563) (-455.208) [-450.082] (-451.025) -- 0:00:29
497500 -- (-450.285) (-453.223) [-451.838] (-451.842) * (-452.116) [-453.019] (-452.540) (-452.093) -- 0:00:29
498000 -- (-450.666) (-453.943) [-452.849] (-450.790) * (-453.569) [-453.830] (-451.649) (-451.531) -- 0:00:29
498500 -- (-450.768) (-455.241) (-450.615) [-452.640] * (-452.113) (-450.086) (-451.750) [-451.314] -- 0:00:29
499000 -- (-453.417) (-453.129) [-450.987] (-453.054) * (-449.935) [-450.245] (-452.237) (-449.919) -- 0:00:30
499500 -- (-455.066) (-452.265) (-450.569) [-451.710] * (-456.160) (-455.895) (-452.573) [-455.418] -- 0:00:30
500000 -- [-457.512] (-451.574) (-449.449) (-452.983) * [-454.054] (-449.171) (-450.431) (-451.930) -- 0:00:30
Average standard deviation of split frequencies: 0.010534
500500 -- (-454.106) (-452.146) [-451.990] (-450.333) * [-453.112] (-450.190) (-450.904) (-453.080) -- 0:00:29
501000 -- (-450.531) [-451.919] (-451.483) (-451.542) * [-450.097] (-450.499) (-451.837) (-452.429) -- 0:00:29
501500 -- (-450.975) (-453.513) (-452.687) [-451.381] * (-449.654) [-451.134] (-454.622) (-453.994) -- 0:00:29
502000 -- (-455.585) (-450.448) [-451.393] (-451.031) * (-450.638) [-449.775] (-452.434) (-452.915) -- 0:00:29
502500 -- (-453.911) (-455.342) [-449.292] (-450.783) * [-455.121] (-454.375) (-452.201) (-451.874) -- 0:00:29
503000 -- (-453.749) (-453.527) [-452.420] (-450.980) * (-453.410) (-453.605) (-453.624) [-450.391] -- 0:00:29
503500 -- (-453.012) [-454.370] (-453.589) (-451.403) * [-450.508] (-452.743) (-452.886) (-452.453) -- 0:00:29
504000 -- (-450.717) (-452.321) (-452.642) [-451.063] * (-450.212) (-452.980) (-456.744) [-451.543] -- 0:00:29
504500 -- (-451.097) (-451.420) (-451.440) [-451.192] * (-449.466) (-454.100) (-451.437) [-451.485] -- 0:00:29
505000 -- [-454.918] (-452.978) (-449.457) (-450.007) * (-451.203) (-449.817) [-450.569] (-451.611) -- 0:00:29
Average standard deviation of split frequencies: 0.010947
505500 -- [-450.416] (-449.552) (-450.958) (-453.019) * [-449.703] (-456.518) (-450.860) (-451.837) -- 0:00:29
506000 -- (-453.947) (-450.189) [-450.515] (-450.935) * (-449.630) (-454.197) [-450.382] (-452.413) -- 0:00:29
506500 -- (-450.922) (-449.544) (-452.878) [-451.435] * (-451.433) [-450.643] (-452.809) (-449.865) -- 0:00:29
507000 -- [-453.313] (-453.733) (-453.170) (-451.043) * (-451.083) (-451.898) [-450.904] (-450.264) -- 0:00:29
507500 -- (-451.050) [-452.190] (-451.369) (-451.384) * (-451.683) (-452.001) (-450.416) [-452.296] -- 0:00:29
508000 -- [-451.783] (-451.351) (-454.147) (-449.979) * (-451.579) (-458.026) (-450.382) [-449.985] -- 0:00:29
508500 -- [-454.141] (-456.500) (-451.615) (-449.884) * (-453.741) (-453.271) [-451.007] (-451.317) -- 0:00:28
509000 -- (-451.716) [-451.966] (-450.988) (-449.960) * (-449.987) [-453.126] (-457.759) (-451.480) -- 0:00:28
509500 -- (-450.935) (-454.445) (-454.253) [-453.173] * (-451.508) (-450.744) [-450.841] (-452.259) -- 0:00:28
510000 -- [-453.305] (-450.576) (-456.865) (-452.863) * (-451.031) (-452.018) [-451.216] (-457.052) -- 0:00:28
Average standard deviation of split frequencies: 0.010212
510500 -- (-453.160) [-450.805] (-453.504) (-450.225) * [-450.294] (-458.029) (-453.647) (-453.828) -- 0:00:28
511000 -- (-452.001) (-450.475) (-452.016) [-451.965] * [-451.101] (-452.312) (-454.944) (-452.127) -- 0:00:28
511500 -- [-451.081] (-451.547) (-450.353) (-449.881) * [-452.786] (-453.794) (-450.029) (-452.256) -- 0:00:28
512000 -- (-450.532) (-450.928) (-451.600) [-449.614] * (-451.095) (-450.132) (-449.961) [-454.459] -- 0:00:28
512500 -- (-449.823) (-452.892) (-452.828) [-451.693] * [-451.189] (-449.801) (-459.517) (-450.158) -- 0:00:28
513000 -- [-449.789] (-451.311) (-453.784) (-451.486) * (-452.711) (-450.917) (-453.432) [-452.693] -- 0:00:28
513500 -- [-454.452] (-451.836) (-450.330) (-450.603) * (-451.323) [-450.780] (-451.283) (-452.296) -- 0:00:28
514000 -- (-452.052) (-456.433) (-454.047) [-451.749] * (-451.468) [-451.333] (-449.991) (-453.083) -- 0:00:28
514500 -- [-452.893] (-456.579) (-453.330) (-454.719) * (-451.879) [-450.891] (-454.501) (-449.862) -- 0:00:28
515000 -- (-451.757) [-449.943] (-453.784) (-450.072) * (-451.815) [-452.306] (-453.376) (-451.297) -- 0:00:28
Average standard deviation of split frequencies: 0.010164
515500 -- [-450.743] (-453.051) (-450.507) (-449.951) * (-454.079) (-454.348) (-450.102) [-454.537] -- 0:00:29
516000 -- (-450.194) [-449.869] (-451.967) (-452.479) * (-453.725) (-452.340) [-450.845] (-455.028) -- 0:00:29
516500 -- (-451.665) [-449.834] (-450.058) (-453.579) * (-452.812) (-451.185) (-451.742) [-454.197] -- 0:00:29
517000 -- (-449.658) (-450.536) [-450.900] (-451.939) * [-450.393] (-451.714) (-450.985) (-452.939) -- 0:00:28
517500 -- (-449.878) (-451.127) [-452.721] (-452.188) * (-450.448) (-451.789) [-452.730] (-454.522) -- 0:00:28
518000 -- (-450.535) (-451.336) (-451.101) [-450.985] * (-451.445) (-455.635) [-450.639] (-454.929) -- 0:00:28
518500 -- [-449.895] (-449.917) (-449.641) (-450.929) * (-450.201) (-450.246) (-449.594) [-452.489] -- 0:00:28
519000 -- (-453.143) [-450.240] (-451.455) (-450.669) * (-452.838) (-450.246) (-450.233) [-451.374] -- 0:00:28
519500 -- (-450.203) [-451.635] (-455.537) (-454.153) * [-450.988] (-450.241) (-453.341) (-450.065) -- 0:00:28
520000 -- [-451.411] (-456.425) (-450.314) (-453.622) * (-450.490) [-452.249] (-452.105) (-451.423) -- 0:00:28
Average standard deviation of split frequencies: 0.010242
520500 -- [-451.178] (-451.326) (-450.513) (-449.958) * (-449.897) (-451.198) [-451.167] (-451.559) -- 0:00:28
521000 -- [-453.844] (-452.249) (-452.250) (-453.464) * (-451.727) (-451.956) (-450.648) [-453.065] -- 0:00:28
521500 -- (-452.917) (-450.409) (-452.553) [-449.889] * (-450.152) [-454.485] (-450.116) (-454.181) -- 0:00:28
522000 -- [-452.736] (-449.884) (-452.615) (-449.187) * (-450.114) (-455.189) [-452.944] (-449.651) -- 0:00:28
522500 -- (-452.184) (-454.066) [-451.337] (-455.225) * (-449.627) (-457.336) (-451.378) [-450.159] -- 0:00:28
523000 -- (-451.767) (-457.225) (-452.380) [-451.913] * (-450.693) [-452.267] (-452.216) (-454.499) -- 0:00:28
523500 -- (-453.953) (-451.421) (-453.400) [-449.947] * [-451.903] (-450.259) (-452.254) (-452.147) -- 0:00:28
524000 -- (-450.943) [-451.582] (-453.035) (-450.132) * [-452.000] (-450.057) (-452.408) (-456.240) -- 0:00:28
524500 -- [-450.418] (-451.499) (-450.168) (-449.712) * (-450.924) (-450.445) [-450.161] (-452.202) -- 0:00:28
525000 -- [-452.247] (-450.480) (-453.033) (-450.315) * [-451.039] (-451.079) (-449.978) (-450.418) -- 0:00:28
Average standard deviation of split frequencies: 0.010250
525500 -- [-451.875] (-451.000) (-451.435) (-451.200) * (-451.988) [-455.512] (-452.424) (-449.422) -- 0:00:27
526000 -- (-449.216) [-453.614] (-450.644) (-452.737) * (-452.202) [-456.256] (-454.693) (-450.241) -- 0:00:27
526500 -- (-455.273) (-452.583) [-449.515] (-449.724) * [-449.746] (-456.180) (-451.644) (-450.445) -- 0:00:27
527000 -- (-450.168) [-449.772] (-451.382) (-449.736) * (-449.295) (-451.355) (-451.765) [-449.649] -- 0:00:27
527500 -- (-453.381) (-449.701) (-452.416) [-450.412] * [-449.614] (-456.773) (-454.391) (-454.294) -- 0:00:27
528000 -- (-450.540) (-449.677) (-459.773) [-449.913] * [-450.049] (-452.596) (-455.620) (-450.786) -- 0:00:27
528500 -- (-455.421) [-449.467] (-452.085) (-452.055) * (-451.386) (-451.655) [-450.150] (-453.837) -- 0:00:27
529000 -- (-450.683) [-450.827] (-451.507) (-450.598) * (-452.106) (-453.198) [-449.931] (-454.258) -- 0:00:27
529500 -- (-451.214) (-450.570) (-450.946) [-450.153] * (-452.228) (-454.660) (-453.106) [-449.763] -- 0:00:27
530000 -- (-453.974) (-455.114) (-450.883) [-449.704] * (-452.008) (-454.933) (-453.499) [-449.447] -- 0:00:27
Average standard deviation of split frequencies: 0.009549
530500 -- (-451.683) (-452.126) [-449.959] (-450.407) * (-452.259) (-452.976) (-452.411) [-451.744] -- 0:00:27
531000 -- [-449.361] (-453.274) (-450.599) (-450.307) * (-451.302) (-449.643) [-458.173] (-457.479) -- 0:00:27
531500 -- [-449.818] (-450.953) (-452.155) (-456.160) * (-450.470) (-451.162) (-454.383) [-449.741] -- 0:00:27
532000 -- (-452.380) (-450.287) (-450.225) [-450.091] * [-450.364] (-457.012) (-449.777) (-450.898) -- 0:00:27
532500 -- (-452.436) [-449.928] (-455.403) (-451.780) * (-450.618) [-451.984] (-449.070) (-451.691) -- 0:00:28
533000 -- (-451.316) (-452.212) (-451.701) [-453.302] * [-450.384] (-450.024) (-452.864) (-451.564) -- 0:00:28
533500 -- (-459.069) (-452.548) [-449.427] (-451.798) * [-451.226] (-451.340) (-449.746) (-449.544) -- 0:00:27
534000 -- (-454.144) (-452.816) (-451.284) [-451.760] * (-450.644) (-454.951) (-449.858) [-451.986] -- 0:00:27
534500 -- (-450.749) [-450.152] (-453.245) (-450.235) * (-457.813) (-450.857) [-449.979] (-450.080) -- 0:00:27
535000 -- (-459.575) (-452.265) (-455.123) [-450.438] * [-453.727] (-453.461) (-452.392) (-450.980) -- 0:00:27
Average standard deviation of split frequencies: 0.009400
535500 -- (-457.064) [-452.770] (-451.621) (-450.030) * (-455.733) [-450.346] (-452.324) (-451.738) -- 0:00:27
536000 -- (-450.440) (-453.125) [-452.210] (-449.928) * (-450.113) (-450.497) (-449.872) [-454.390] -- 0:00:27
536500 -- (-450.855) [-451.757] (-452.997) (-452.805) * [-450.871] (-452.620) (-449.616) (-450.189) -- 0:00:27
537000 -- (-450.988) (-451.098) (-458.077) [-453.473] * (-452.256) (-456.271) (-451.639) [-451.527] -- 0:00:27
537500 -- [-451.046] (-455.778) (-452.681) (-452.148) * (-452.292) (-461.906) [-449.800] (-452.268) -- 0:00:27
538000 -- [-449.979] (-453.983) (-449.181) (-451.216) * (-452.313) (-454.889) (-450.871) [-451.286] -- 0:00:27
538500 -- (-451.765) (-451.972) (-450.417) [-453.649] * [-453.666] (-458.229) (-450.217) (-452.141) -- 0:00:27
539000 -- [-451.762] (-453.959) (-452.004) (-450.358) * (-450.836) [-457.614] (-450.883) (-450.847) -- 0:00:27
539500 -- (-451.617) (-450.308) [-450.555] (-450.794) * (-451.437) (-452.492) (-451.096) [-454.642] -- 0:00:27
540000 -- [-455.227] (-450.941) (-450.463) (-454.206) * (-450.829) [-451.049] (-450.690) (-452.359) -- 0:00:27
Average standard deviation of split frequencies: 0.009754
540500 -- (-451.584) [-452.884] (-450.915) (-452.408) * (-451.590) (-454.231) (-450.075) [-453.617] -- 0:00:27
541000 -- (-450.787) [-453.732] (-450.993) (-450.631) * [-453.641] (-460.728) (-452.736) (-451.619) -- 0:00:27
541500 -- (-455.474) (-451.957) (-453.844) [-451.314] * [-451.095] (-459.101) (-449.525) (-453.673) -- 0:00:27
542000 -- [-451.754] (-455.269) (-452.662) (-450.473) * (-449.769) (-455.385) [-449.340] (-456.145) -- 0:00:27
542500 -- (-452.846) (-453.920) (-452.414) [-450.026] * (-453.692) (-454.563) [-454.874] (-454.533) -- 0:00:26
543000 -- [-452.996] (-451.189) (-450.426) (-451.696) * (-450.398) [-451.527] (-457.313) (-452.032) -- 0:00:26
543500 -- (-455.093) (-451.368) (-450.473) [-451.235] * (-451.602) (-451.943) (-454.855) [-449.926] -- 0:00:26
544000 -- (-449.982) (-453.070) [-449.881] (-452.276) * [-452.517] (-452.010) (-452.990) (-451.362) -- 0:00:26
544500 -- (-452.188) (-453.153) (-449.465) [-451.823] * (-451.331) [-450.782] (-453.611) (-456.295) -- 0:00:26
545000 -- (-451.301) (-451.893) (-450.087) [-452.552] * (-453.303) (-452.655) [-450.989] (-451.690) -- 0:00:26
Average standard deviation of split frequencies: 0.010091
545500 -- (-451.493) (-451.806) [-450.788] (-452.498) * (-451.834) [-452.421] (-450.975) (-455.901) -- 0:00:26
546000 -- (-450.633) (-454.552) (-449.708) [-450.255] * [-453.476] (-455.279) (-450.017) (-450.109) -- 0:00:26
546500 -- (-452.966) [-450.559] (-451.605) (-451.064) * [-451.574] (-452.282) (-452.776) (-453.261) -- 0:00:26
547000 -- (-450.950) (-452.985) [-453.667] (-452.096) * [-451.722] (-452.037) (-452.931) (-450.848) -- 0:00:26
547500 -- (-451.820) (-453.539) [-450.530] (-451.660) * [-449.352] (-450.587) (-454.974) (-451.797) -- 0:00:26
548000 -- (-451.483) (-452.166) (-449.935) [-452.309] * [-451.466] (-450.450) (-453.653) (-457.859) -- 0:00:26
548500 -- (-450.288) [-451.965] (-449.541) (-451.712) * (-450.361) (-450.997) (-450.974) [-449.901] -- 0:00:26
549000 -- (-451.246) (-450.945) (-450.724) [-449.957] * (-451.948) (-455.511) [-451.079] (-450.816) -- 0:00:26
549500 -- [-451.442] (-449.905) (-451.614) (-449.033) * (-450.402) (-455.401) (-450.560) [-450.544] -- 0:00:27
550000 -- [-451.576] (-450.219) (-453.712) (-451.500) * (-451.896) (-449.765) (-453.900) [-450.116] -- 0:00:27
Average standard deviation of split frequencies: 0.009310
550500 -- [-451.609] (-449.378) (-450.917) (-453.102) * (-454.506) [-453.493] (-451.743) (-451.353) -- 0:00:26
551000 -- (-450.276) (-457.234) (-450.291) [-450.129] * (-455.245) (-451.451) [-452.250] (-452.134) -- 0:00:26
551500 -- [-451.160] (-451.397) (-454.304) (-451.874) * (-456.639) [-452.325] (-449.513) (-451.594) -- 0:00:26
552000 -- (-454.556) (-451.448) (-451.356) [-453.232] * (-453.478) [-450.592] (-450.036) (-452.143) -- 0:00:26
552500 -- (-452.176) (-452.459) (-452.433) [-454.003] * (-450.698) (-451.867) (-449.908) [-452.639] -- 0:00:26
553000 -- [-452.652] (-453.686) (-454.575) (-452.938) * [-453.277] (-453.580) (-453.591) (-450.595) -- 0:00:26
553500 -- [-450.005] (-453.584) (-450.917) (-454.402) * (-451.289) [-451.731] (-452.850) (-450.420) -- 0:00:26
554000 -- (-449.108) (-451.308) [-449.559] (-453.286) * (-449.462) (-450.697) (-450.316) [-450.826] -- 0:00:26
554500 -- [-449.203] (-452.723) (-449.269) (-453.819) * [-449.123] (-453.655) (-453.183) (-451.019) -- 0:00:26
555000 -- [-449.895] (-450.320) (-451.300) (-455.192) * (-449.255) (-454.679) [-452.148] (-453.349) -- 0:00:26
Average standard deviation of split frequencies: 0.010121
555500 -- (-449.459) (-458.091) [-451.151] (-450.225) * (-452.511) [-453.905] (-455.816) (-450.001) -- 0:00:26
556000 -- [-450.418] (-451.697) (-451.237) (-452.993) * (-450.541) (-451.603) (-454.669) [-449.374] -- 0:00:26
556500 -- [-452.329] (-452.299) (-449.918) (-451.998) * (-450.644) (-455.806) [-453.220] (-449.513) -- 0:00:26
557000 -- [-450.518] (-454.660) (-452.865) (-452.847) * [-450.742] (-450.031) (-451.004) (-452.097) -- 0:00:26
557500 -- (-450.072) (-455.151) (-452.730) [-453.808] * (-451.813) (-452.582) (-450.016) [-450.615] -- 0:00:26
558000 -- [-451.063] (-450.189) (-450.343) (-450.736) * (-449.755) (-450.587) (-450.672) [-453.870] -- 0:00:26
558500 -- (-452.151) (-451.387) (-449.662) [-455.320] * (-451.701) (-451.070) [-450.789] (-451.476) -- 0:00:26
559000 -- (-455.081) (-451.296) [-450.675] (-449.960) * (-449.656) [-451.084] (-449.846) (-450.055) -- 0:00:26
559500 -- (-453.311) [-450.919] (-452.551) (-452.886) * (-453.136) (-450.581) (-449.497) [-452.874] -- 0:00:25
560000 -- (-460.525) (-452.857) [-453.575] (-452.788) * (-452.848) (-456.192) (-450.103) [-452.978] -- 0:00:25
Average standard deviation of split frequencies: 0.010195
560500 -- (-456.842) (-452.110) (-450.916) [-454.792] * (-454.758) [-452.362] (-451.215) (-454.423) -- 0:00:25
561000 -- (-457.518) (-450.120) [-450.526] (-452.586) * [-451.219] (-450.718) (-453.965) (-450.948) -- 0:00:25
561500 -- (-453.232) [-452.165] (-450.827) (-451.139) * (-452.527) (-452.949) [-449.407] (-450.667) -- 0:00:25
562000 -- (-454.350) [-451.172] (-450.506) (-452.636) * (-460.794) [-452.462] (-450.869) (-453.354) -- 0:00:25
562500 -- (-452.687) (-450.470) [-450.397] (-452.517) * (-452.411) [-452.207] (-451.146) (-449.613) -- 0:00:25
563000 -- [-450.841] (-450.437) (-452.877) (-450.624) * (-449.781) (-449.975) (-449.776) [-451.690] -- 0:00:25
563500 -- [-451.260] (-457.249) (-450.299) (-449.444) * [-450.543] (-452.119) (-449.797) (-454.860) -- 0:00:25
564000 -- (-452.981) (-452.766) (-451.997) [-450.400] * (-454.478) [-450.067] (-455.550) (-450.952) -- 0:00:25
564500 -- (-451.928) [-453.336] (-452.851) (-453.813) * (-452.566) (-449.876) [-455.112] (-449.247) -- 0:00:25
565000 -- [-450.381] (-455.176) (-453.324) (-451.318) * (-450.128) [-454.734] (-450.002) (-451.679) -- 0:00:25
Average standard deviation of split frequencies: 0.009890
565500 -- (-452.047) (-456.668) [-452.943] (-454.634) * [-452.029] (-451.391) (-450.595) (-449.838) -- 0:00:25
566000 -- (-453.241) [-454.700] (-452.195) (-455.575) * (-452.749) (-450.286) [-452.926] (-451.423) -- 0:00:25
566500 -- (-451.384) (-453.087) [-451.348] (-450.418) * (-455.490) (-455.043) [-451.082] (-453.577) -- 0:00:26
567000 -- [-451.018] (-451.125) (-458.342) (-451.382) * [-451.664] (-457.547) (-450.715) (-455.090) -- 0:00:25
567500 -- (-449.515) (-452.520) [-452.070] (-450.304) * [-450.247] (-457.226) (-460.309) (-449.872) -- 0:00:25
568000 -- [-450.048] (-451.791) (-450.391) (-451.497) * (-452.671) [-450.718] (-455.590) (-450.095) -- 0:00:25
568500 -- (-452.124) [-452.609] (-449.440) (-449.920) * (-450.335) [-450.860] (-451.317) (-453.240) -- 0:00:25
569000 -- (-451.123) (-451.005) (-450.740) [-449.723] * (-450.629) (-449.811) [-450.716] (-449.451) -- 0:00:25
569500 -- (-450.874) (-450.800) [-453.298] (-449.785) * (-449.711) (-456.184) (-451.202) [-451.634] -- 0:00:25
570000 -- (-451.410) (-451.093) [-449.819] (-453.298) * (-450.581) (-454.251) (-456.911) [-450.922] -- 0:00:25
Average standard deviation of split frequencies: 0.009500
570500 -- [-457.397] (-451.419) (-451.081) (-450.350) * (-450.844) (-450.992) (-455.604) [-452.612] -- 0:00:25
571000 -- [-451.711] (-451.870) (-452.176) (-450.764) * (-454.160) [-450.706] (-451.667) (-450.455) -- 0:00:25
571500 -- (-452.989) [-452.400] (-452.129) (-452.508) * (-452.853) (-450.580) (-452.696) [-450.703] -- 0:00:25
572000 -- (-453.294) [-454.635] (-451.426) (-452.738) * (-455.196) (-451.962) (-451.790) [-449.707] -- 0:00:25
572500 -- [-455.767] (-451.776) (-452.665) (-451.810) * (-450.284) (-451.065) [-452.835] (-453.210) -- 0:00:25
573000 -- [-455.069] (-453.719) (-450.815) (-449.931) * (-449.696) (-452.046) (-454.841) [-453.573] -- 0:00:25
573500 -- (-454.504) (-451.311) (-456.356) [-451.698] * (-451.285) (-450.194) (-451.370) [-452.090] -- 0:00:25
574000 -- (-453.558) (-452.255) [-451.257] (-450.408) * (-450.690) [-452.722] (-454.111) (-455.485) -- 0:00:25
574500 -- (-450.879) [-451.463] (-450.667) (-451.710) * (-450.476) [-451.264] (-455.066) (-453.458) -- 0:00:25
575000 -- (-455.484) (-452.190) (-450.978) [-450.235] * (-451.151) (-451.384) (-454.178) [-451.945] -- 0:00:25
Average standard deviation of split frequencies: 0.009207
575500 -- (-458.455) (-449.627) [-451.246] (-450.637) * (-449.867) (-449.787) [-452.345] (-453.460) -- 0:00:25
576000 -- (-452.655) [-452.163] (-452.168) (-449.245) * (-450.421) (-449.955) [-449.843] (-451.952) -- 0:00:25
576500 -- (-451.510) [-450.938] (-450.034) (-451.087) * (-450.795) (-451.717) [-455.208] (-452.229) -- 0:00:24
577000 -- [-452.215] (-455.864) (-450.005) (-456.630) * [-451.590] (-452.508) (-452.159) (-449.380) -- 0:00:24
577500 -- (-458.966) (-450.071) (-449.586) [-453.674] * (-455.730) (-452.626) (-452.407) [-457.194] -- 0:00:24
578000 -- (-450.979) [-450.088] (-451.869) (-459.718) * [-452.162] (-453.655) (-453.613) (-449.571) -- 0:00:24
578500 -- [-451.072] (-451.865) (-450.987) (-451.481) * [-450.099] (-451.966) (-451.948) (-450.291) -- 0:00:24
579000 -- [-450.007] (-451.479) (-451.325) (-453.639) * [-455.157] (-450.220) (-451.655) (-450.635) -- 0:00:24
579500 -- [-452.373] (-451.876) (-449.894) (-450.329) * [-450.763] (-452.363) (-455.460) (-450.670) -- 0:00:24
580000 -- (-450.683) (-452.120) [-450.715] (-450.121) * [-450.882] (-452.538) (-455.817) (-457.893) -- 0:00:24
Average standard deviation of split frequencies: 0.008423
580500 -- (-449.947) (-456.206) (-453.269) [-449.748] * (-452.360) (-450.302) [-452.078] (-452.989) -- 0:00:24
581000 -- (-452.347) [-455.072] (-455.039) (-452.705) * (-451.963) (-450.899) (-449.122) [-452.345] -- 0:00:24
581500 -- (-452.398) (-452.938) [-449.782] (-450.748) * (-449.498) (-452.593) [-449.813] (-450.647) -- 0:00:24
582000 -- (-450.602) (-449.620) (-449.754) [-450.459] * (-451.011) (-451.515) [-450.174] (-450.386) -- 0:00:24
582500 -- (-454.879) [-455.492] (-450.798) (-452.153) * [-452.096] (-452.006) (-450.370) (-453.172) -- 0:00:24
583000 -- (-456.127) [-449.666] (-451.104) (-451.931) * [-449.968] (-453.152) (-452.815) (-450.253) -- 0:00:24
583500 -- (-452.189) (-452.860) [-450.396] (-450.630) * [-450.731] (-453.238) (-453.210) (-450.342) -- 0:00:24
584000 -- [-449.905] (-451.061) (-450.406) (-450.080) * [-452.916] (-453.309) (-451.050) (-450.178) -- 0:00:24
584500 -- [-450.306] (-451.711) (-456.690) (-449.602) * (-451.158) [-451.310] (-450.014) (-450.145) -- 0:00:24
585000 -- (-451.577) (-455.911) [-452.114] (-454.535) * (-452.902) (-451.676) [-450.231] (-451.585) -- 0:00:24
Average standard deviation of split frequencies: 0.008195
585500 -- [-451.859] (-451.680) (-449.916) (-450.706) * (-449.371) (-451.907) [-452.637] (-452.033) -- 0:00:24
586000 -- (-452.331) [-452.529] (-450.885) (-455.022) * (-451.616) (-455.344) (-452.952) [-451.382] -- 0:00:24
586500 -- (-449.978) (-449.874) [-451.612] (-455.830) * (-458.694) [-456.843] (-455.217) (-451.009) -- 0:00:24
587000 -- (-450.716) (-450.116) (-450.557) [-449.925] * [-451.913] (-451.895) (-450.189) (-451.149) -- 0:00:24
587500 -- (-452.300) [-454.265] (-451.108) (-450.203) * [-450.575] (-457.001) (-450.772) (-452.548) -- 0:00:24
588000 -- [-452.370] (-454.044) (-451.422) (-450.602) * (-449.949) (-451.602) (-450.300) [-452.917] -- 0:00:24
588500 -- (-451.119) (-449.483) [-450.149] (-450.463) * (-451.396) (-450.915) [-449.809] (-457.917) -- 0:00:24
589000 -- (-451.504) [-449.869] (-450.561) (-454.132) * [-453.194] (-451.037) (-450.047) (-454.306) -- 0:00:24
589500 -- (-452.126) (-453.422) [-451.506] (-454.385) * (-453.668) (-454.297) [-457.757] (-455.002) -- 0:00:24
590000 -- (-450.573) (-451.761) (-450.140) [-450.754] * [-452.536] (-451.944) (-455.411) (-454.009) -- 0:00:24
Average standard deviation of split frequencies: 0.008131
590500 -- (-451.787) [-451.349] (-451.968) (-450.518) * (-449.347) (-451.155) [-450.764] (-458.122) -- 0:00:24
591000 -- (-450.990) (-449.923) [-450.172] (-450.932) * (-450.890) (-450.726) [-449.982] (-457.422) -- 0:00:24
591500 -- (-449.459) (-451.030) [-450.845] (-456.779) * [-452.861] (-453.044) (-455.030) (-453.238) -- 0:00:24
592000 -- (-450.145) (-455.717) [-450.378] (-451.078) * (-450.290) (-451.959) (-451.843) [-449.273] -- 0:00:24
592500 -- (-454.246) (-452.878) [-449.156] (-449.868) * [-451.837] (-453.506) (-451.379) (-450.162) -- 0:00:24
593000 -- [-450.395] (-452.002) (-451.265) (-450.040) * (-451.072) [-449.768] (-453.767) (-450.364) -- 0:00:24
593500 -- [-449.707] (-453.091) (-454.299) (-450.463) * (-450.432) (-451.225) [-452.368] (-456.684) -- 0:00:23
594000 -- [-452.022] (-451.600) (-452.299) (-450.312) * (-450.188) (-452.542) [-454.111] (-455.495) -- 0:00:23
594500 -- [-449.980] (-454.979) (-451.763) (-450.825) * (-450.484) (-454.266) [-450.557] (-453.637) -- 0:00:23
595000 -- [-453.250] (-451.460) (-450.275) (-450.636) * (-449.480) [-453.803] (-450.050) (-451.475) -- 0:00:23
Average standard deviation of split frequencies: 0.008206
595500 -- (-452.942) [-452.297] (-452.279) (-453.807) * (-449.584) (-457.895) (-450.182) [-449.959] -- 0:00:23
596000 -- (-454.222) (-449.865) [-451.212] (-451.747) * (-449.160) (-451.953) (-452.671) [-450.306] -- 0:00:23
596500 -- (-451.049) (-452.253) [-454.134] (-450.736) * (-453.726) [-452.411] (-456.980) (-456.950) -- 0:00:23
597000 -- (-453.585) [-450.198] (-450.349) (-452.739) * (-452.522) (-451.347) (-455.136) [-452.878] -- 0:00:23
597500 -- (-451.440) (-451.705) [-453.173] (-452.958) * (-454.522) [-452.095] (-450.361) (-450.629) -- 0:00:23
598000 -- (-453.281) (-451.903) [-452.114] (-455.504) * (-451.523) (-450.833) (-452.667) [-450.215] -- 0:00:23
598500 -- [-450.197] (-450.082) (-451.381) (-450.145) * (-450.028) (-451.614) [-451.302] (-454.126) -- 0:00:23
599000 -- (-453.169) (-451.093) (-452.131) [-452.136] * (-453.235) [-452.190] (-451.440) (-453.911) -- 0:00:23
599500 -- (-452.586) (-451.966) (-453.097) [-452.372] * (-452.008) (-453.497) [-451.195] (-450.990) -- 0:00:23
600000 -- (-451.184) (-451.110) [-451.516] (-451.591) * [-450.843] (-452.312) (-449.960) (-455.568) -- 0:00:23
Average standard deviation of split frequencies: 0.008093
600500 -- (-451.345) [-451.892] (-450.223) (-450.098) * (-451.171) [-452.728] (-449.984) (-453.781) -- 0:00:23
601000 -- (-450.492) [-449.587] (-451.984) (-449.795) * (-450.131) [-449.952] (-454.016) (-453.120) -- 0:00:23
601500 -- [-449.308] (-453.582) (-451.410) (-458.289) * (-455.497) [-450.846] (-452.007) (-450.614) -- 0:00:23
602000 -- (-454.784) (-457.165) [-451.484] (-452.004) * (-450.728) (-453.243) (-451.058) [-452.247] -- 0:00:23
602500 -- [-451.384] (-453.511) (-450.085) (-455.975) * (-453.218) [-454.028] (-450.771) (-455.507) -- 0:00:23
603000 -- (-450.235) [-450.546] (-454.105) (-455.052) * (-450.903) (-451.981) [-451.132] (-451.030) -- 0:00:23
603500 -- (-450.504) [-451.098] (-451.952) (-456.296) * [-450.814] (-450.345) (-451.474) (-451.214) -- 0:00:23
604000 -- (-450.036) (-450.586) [-451.948] (-451.320) * (-451.399) (-455.280) [-451.847] (-450.841) -- 0:00:23
604500 -- (-452.825) (-450.584) [-451.251] (-451.276) * (-450.684) [-450.218] (-452.448) (-451.301) -- 0:00:23
605000 -- (-452.927) (-450.518) [-450.047] (-452.422) * (-453.095) [-449.836] (-451.767) (-451.249) -- 0:00:23
Average standard deviation of split frequencies: 0.008119
605500 -- (-453.073) [-451.872] (-450.233) (-452.763) * (-450.790) (-450.909) (-454.953) [-449.930] -- 0:00:23
606000 -- (-454.876) [-450.493] (-449.895) (-453.342) * (-450.775) (-451.927) (-457.331) [-449.562] -- 0:00:23
606500 -- (-451.180) (-450.402) [-449.827] (-453.766) * (-455.976) [-452.359] (-452.487) (-451.407) -- 0:00:23
607000 -- (-450.746) [-450.851] (-452.362) (-452.221) * [-453.612] (-451.568) (-450.028) (-451.156) -- 0:00:23
607500 -- (-450.380) (-452.503) (-452.597) [-453.622] * (-450.055) (-451.296) [-450.162] (-451.225) -- 0:00:23
608000 -- (-451.222) [-455.117] (-450.883) (-451.973) * [-452.119] (-450.394) (-449.967) (-449.387) -- 0:00:23
608500 -- (-450.858) (-450.675) (-450.498) [-452.077] * [-449.846] (-451.445) (-450.932) (-450.872) -- 0:00:23
609000 -- (-451.544) (-450.991) [-453.889] (-449.706) * [-449.624] (-450.388) (-451.719) (-450.138) -- 0:00:23
609500 -- (-450.026) [-452.092] (-452.355) (-449.748) * (-453.912) (-455.321) (-453.446) [-450.267] -- 0:00:23
610000 -- [-451.418] (-455.006) (-451.747) (-451.575) * (-451.923) [-451.852] (-453.591) (-451.331) -- 0:00:23
Average standard deviation of split frequencies: 0.007527
610500 -- (-453.231) (-453.432) [-450.084] (-450.921) * (-452.745) (-451.387) [-455.495] (-450.213) -- 0:00:22
611000 -- (-451.561) [-452.381] (-451.874) (-450.508) * [-450.490] (-450.885) (-449.730) (-451.857) -- 0:00:22
611500 -- (-454.010) [-452.830] (-450.539) (-451.836) * [-449.483] (-454.335) (-451.493) (-454.310) -- 0:00:22
612000 -- (-451.037) [-453.529] (-453.865) (-450.601) * (-450.106) [-456.730] (-450.204) (-452.950) -- 0:00:22
612500 -- (-452.709) (-454.888) [-450.810] (-451.237) * (-451.037) (-460.107) [-450.660] (-451.880) -- 0:00:22
613000 -- (-451.207) (-456.676) [-450.418] (-453.158) * [-451.669] (-455.521) (-450.286) (-452.264) -- 0:00:22
613500 -- (-453.364) (-450.728) (-453.309) [-452.118] * [-451.109] (-450.929) (-452.652) (-452.724) -- 0:00:22
614000 -- [-451.650] (-452.454) (-450.554) (-455.655) * (-449.822) (-450.329) (-454.670) [-450.997] -- 0:00:22
614500 -- [-450.875] (-451.608) (-452.759) (-453.445) * (-451.417) [-450.188] (-453.155) (-453.746) -- 0:00:22
615000 -- (-451.407) (-451.454) [-451.966] (-449.586) * (-452.182) (-450.175) (-453.181) [-450.182] -- 0:00:22
Average standard deviation of split frequencies: 0.007796
615500 -- (-450.783) (-452.508) [-450.022] (-450.967) * (-454.613) [-452.476] (-454.407) (-457.801) -- 0:00:22
616000 -- (-451.113) [-453.117] (-454.380) (-450.613) * (-451.631) (-451.158) (-452.993) [-451.932] -- 0:00:22
616500 -- (-452.310) (-451.315) [-450.680] (-453.314) * (-452.099) (-452.310) [-451.666] (-451.757) -- 0:00:22
617000 -- [-457.738] (-455.096) (-455.502) (-454.515) * [-452.001] (-449.301) (-449.786) (-451.276) -- 0:00:22
617500 -- (-455.658) (-451.819) (-454.306) [-452.624] * (-450.405) (-450.603) [-449.696] (-449.886) -- 0:00:22
618000 -- (-453.751) (-453.138) [-449.660] (-449.941) * (-449.461) (-451.428) (-449.851) [-449.778] -- 0:00:22
618500 -- (-453.008) [-452.050] (-449.646) (-449.224) * (-452.356) (-451.273) (-449.435) [-449.738] -- 0:00:22
619000 -- (-451.387) (-456.565) [-449.712] (-450.733) * [-450.009] (-451.436) (-452.053) (-450.457) -- 0:00:22
619500 -- (-451.376) (-458.078) (-449.875) [-450.637] * (-450.153) (-449.866) [-449.130] (-454.207) -- 0:00:22
620000 -- (-454.176) [-450.617] (-450.143) (-449.520) * (-451.900) (-450.476) (-455.916) [-451.893] -- 0:00:22
Average standard deviation of split frequencies: 0.007738
620500 -- (-452.914) [-450.169] (-449.569) (-450.466) * (-456.836) (-450.568) [-451.610] (-450.777) -- 0:00:22
621000 -- (-452.117) (-454.053) [-450.770] (-449.748) * (-451.997) (-457.155) (-453.318) [-449.864] -- 0:00:22
621500 -- [-453.146] (-455.452) (-452.725) (-451.328) * (-450.916) [-452.780] (-454.027) (-450.187) -- 0:00:22
622000 -- (-452.083) (-450.791) (-453.878) [-450.169] * (-453.021) (-450.396) [-451.394] (-451.587) -- 0:00:22
622500 -- (-450.738) (-450.080) (-454.131) [-453.868] * [-454.357] (-453.732) (-450.595) (-450.407) -- 0:00:22
623000 -- (-455.651) (-452.168) [-451.404] (-451.879) * (-456.445) (-456.894) (-450.198) [-452.036] -- 0:00:22
623500 -- (-453.988) (-451.826) (-452.461) [-449.541] * (-454.792) (-450.505) (-450.786) [-453.412] -- 0:00:22
624000 -- (-451.709) [-451.622] (-450.477) (-455.339) * (-450.420) (-451.927) [-456.655] (-454.273) -- 0:00:22
624500 -- [-450.788] (-453.719) (-450.862) (-454.882) * (-454.015) (-453.893) (-454.410) [-451.043] -- 0:00:22
625000 -- (-450.618) (-454.609) [-449.783] (-452.149) * (-450.848) (-452.921) (-452.086) [-450.472] -- 0:00:22
Average standard deviation of split frequencies: 0.008331
625500 -- (-451.537) (-458.487) [-454.359] (-450.650) * (-452.749) (-452.194) (-450.025) [-449.832] -- 0:00:22
626000 -- (-454.293) (-454.570) [-451.705] (-450.751) * (-449.861) [-454.623] (-452.580) (-450.660) -- 0:00:22
626500 -- (-451.905) [-453.534] (-455.103) (-457.764) * [-451.956] (-452.655) (-450.125) (-450.824) -- 0:00:22
627000 -- (-451.910) [-452.566] (-450.040) (-449.512) * (-452.741) (-451.299) [-450.963] (-449.558) -- 0:00:22
627500 -- (-452.088) [-452.592] (-449.947) (-451.544) * (-454.634) [-451.173] (-453.850) (-453.354) -- 0:00:21
628000 -- (-453.422) (-452.691) [-453.044] (-450.812) * (-452.541) [-450.490] (-452.863) (-450.970) -- 0:00:21
628500 -- (-450.201) (-454.300) [-452.047] (-454.491) * (-450.113) (-450.453) [-454.556] (-453.525) -- 0:00:21
629000 -- [-452.134] (-454.345) (-451.080) (-451.697) * [-450.185] (-451.631) (-455.381) (-449.832) -- 0:00:21
629500 -- [-452.588] (-450.509) (-451.028) (-451.729) * (-452.999) (-454.903) [-451.188] (-451.954) -- 0:00:21
630000 -- (-451.878) (-453.377) (-453.215) [-449.564] * (-451.710) [-459.309] (-453.229) (-451.788) -- 0:00:21
Average standard deviation of split frequencies: 0.008736
630500 -- [-451.032] (-450.122) (-452.713) (-449.353) * (-453.282) [-453.797] (-449.840) (-449.997) -- 0:00:21
631000 -- (-453.236) (-451.471) (-454.627) [-450.197] * (-451.357) (-453.180) (-452.269) [-449.748] -- 0:00:21
631500 -- (-450.070) (-455.336) (-452.388) [-451.567] * (-450.825) [-453.191] (-451.121) (-450.153) -- 0:00:21
632000 -- (-453.075) [-454.902] (-451.170) (-453.880) * (-451.550) (-452.450) (-449.469) [-452.429] -- 0:00:21
632500 -- (-452.522) (-455.581) [-450.040] (-450.209) * (-449.813) [-451.080] (-452.778) (-452.106) -- 0:00:21
633000 -- [-451.101] (-457.220) (-450.170) (-450.289) * (-455.904) (-451.839) (-451.722) [-450.986] -- 0:00:21
633500 -- (-449.557) (-450.401) (-450.609) [-451.229] * [-455.849] (-450.808) (-452.843) (-450.042) -- 0:00:21
634000 -- [-450.073] (-450.810) (-450.593) (-456.167) * (-453.787) (-450.036) [-450.193] (-451.400) -- 0:00:21
634500 -- (-458.308) (-449.435) (-450.397) [-454.563] * (-451.628) [-450.798] (-454.370) (-453.068) -- 0:00:21
635000 -- (-455.730) (-453.295) (-449.717) [-449.905] * (-454.686) (-450.640) [-452.603] (-449.826) -- 0:00:21
Average standard deviation of split frequencies: 0.008339
635500 -- (-454.152) (-452.583) [-449.088] (-449.643) * (-456.642) (-452.326) (-451.258) [-450.314] -- 0:00:21
636000 -- (-452.483) (-451.512) (-452.712) [-451.220] * (-450.880) [-449.573] (-451.953) (-453.505) -- 0:00:21
636500 -- [-450.637] (-451.376) (-452.377) (-450.565) * (-449.436) (-449.785) [-449.514] (-455.105) -- 0:00:21
637000 -- [-452.042] (-452.879) (-450.943) (-456.152) * [-449.406] (-449.955) (-451.035) (-451.082) -- 0:00:21
637500 -- [-456.321] (-452.526) (-452.397) (-449.364) * (-449.642) [-452.673] (-449.288) (-450.521) -- 0:00:21
638000 -- (-451.499) (-454.125) (-453.879) [-451.531] * (-451.932) (-452.264) [-451.644] (-451.425) -- 0:00:21
638500 -- (-450.824) (-451.157) (-457.895) [-451.536] * [-451.630] (-451.948) (-454.063) (-452.868) -- 0:00:21
639000 -- (-451.862) (-452.332) (-450.739) [-449.904] * (-452.953) (-449.380) [-451.295] (-452.765) -- 0:00:21
639500 -- (-452.669) [-450.959] (-453.107) (-450.629) * (-455.609) (-452.433) (-454.878) [-450.783] -- 0:00:21
640000 -- (-452.204) [-452.488] (-452.882) (-453.448) * (-451.999) (-451.598) [-450.942] (-450.722) -- 0:00:21
Average standard deviation of split frequencies: 0.008738
640500 -- [-456.298] (-449.588) (-456.226) (-450.747) * (-454.188) (-451.796) [-451.150] (-450.849) -- 0:00:21
641000 -- [-455.143] (-450.294) (-451.798) (-449.936) * [-451.392] (-452.320) (-450.817) (-451.170) -- 0:00:21
641500 -- (-451.419) (-453.616) (-452.741) [-450.236] * [-450.454] (-452.335) (-454.206) (-453.657) -- 0:00:21
642000 -- (-452.868) (-451.425) [-452.195] (-449.482) * (-451.412) [-451.347] (-451.478) (-450.654) -- 0:00:21
642500 -- (-450.219) (-449.229) (-451.454) [-450.444] * (-450.872) (-453.918) [-450.386] (-458.188) -- 0:00:21
643000 -- (-449.658) [-449.560] (-452.256) (-449.388) * (-450.538) (-452.496) [-450.137] (-452.064) -- 0:00:21
643500 -- (-451.679) [-450.807] (-454.026) (-451.317) * (-452.150) [-449.792] (-457.513) (-449.632) -- 0:00:21
644000 -- [-450.399] (-449.843) (-452.392) (-449.862) * (-451.913) [-449.843] (-452.007) (-453.760) -- 0:00:21
644500 -- (-450.453) [-451.864] (-455.033) (-449.453) * (-455.320) (-450.327) [-451.154] (-449.790) -- 0:00:20
645000 -- (-451.112) (-452.897) [-451.136] (-452.007) * (-449.923) [-453.280] (-449.637) (-450.129) -- 0:00:20
Average standard deviation of split frequencies: 0.008529
645500 -- [-452.652] (-452.412) (-451.807) (-452.856) * (-450.529) [-450.946] (-450.178) (-450.498) -- 0:00:20
646000 -- (-452.357) [-451.072] (-453.910) (-452.578) * (-454.021) (-455.252) (-452.357) [-449.579] -- 0:00:20
646500 -- (-452.695) (-449.370) [-451.969] (-451.177) * (-454.362) [-451.768] (-450.156) (-451.509) -- 0:00:20
647000 -- (-449.822) (-449.098) (-453.927) [-450.686] * (-454.072) (-450.687) [-449.799] (-450.544) -- 0:00:20
647500 -- (-450.900) (-451.249) [-456.422] (-451.475) * (-451.001) [-453.149] (-451.979) (-453.080) -- 0:00:20
648000 -- [-450.384] (-452.699) (-453.558) (-452.236) * (-450.795) (-453.246) (-449.812) [-452.418] -- 0:00:20
648500 -- (-452.647) (-460.939) [-450.804] (-452.575) * (-453.300) (-450.832) (-453.107) [-450.063] -- 0:00:20
649000 -- (-451.254) (-453.749) [-449.271] (-453.988) * (-454.022) [-453.004] (-457.087) (-451.075) -- 0:00:20
649500 -- [-450.609] (-451.264) (-453.275) (-451.136) * (-452.867) (-451.047) [-454.345] (-450.509) -- 0:00:20
650000 -- (-452.657) (-450.331) (-451.626) [-451.160] * (-451.649) (-450.119) (-452.574) [-452.247] -- 0:00:20
Average standard deviation of split frequencies: 0.008558
650500 -- (-450.513) (-450.791) (-450.582) [-449.890] * (-451.594) [-450.658] (-450.262) (-451.098) -- 0:00:20
651000 -- [-449.750] (-451.742) (-450.917) (-453.083) * [-451.626] (-449.485) (-450.998) (-450.815) -- 0:00:20
651500 -- (-450.764) (-451.259) (-450.647) [-450.458] * (-454.507) (-451.848) (-451.424) [-452.044] -- 0:00:20
652000 -- (-450.341) [-451.117] (-451.380) (-450.387) * (-452.274) (-451.665) (-452.528) [-450.689] -- 0:00:20
652500 -- (-449.660) (-450.915) [-451.453] (-452.861) * (-452.202) (-453.459) (-450.377) [-455.968] -- 0:00:20
653000 -- (-454.506) [-452.077] (-449.616) (-453.620) * [-451.218] (-457.145) (-449.255) (-455.665) -- 0:00:20
653500 -- [-456.917] (-449.781) (-451.282) (-459.565) * [-450.179] (-456.125) (-449.707) (-451.238) -- 0:00:20
654000 -- (-456.870) (-452.536) (-452.992) [-449.602] * [-450.400] (-456.749) (-451.959) (-451.374) -- 0:00:20
654500 -- (-452.026) (-454.236) (-455.195) [-452.365] * (-449.407) (-455.923) (-456.640) [-454.949] -- 0:00:20
655000 -- (-451.968) (-451.667) [-457.855] (-451.253) * (-449.795) [-455.984] (-453.718) (-453.724) -- 0:00:20
Average standard deviation of split frequencies: 0.008489
655500 -- (-451.954) (-452.230) (-451.832) [-453.753] * [-452.342] (-451.374) (-453.290) (-451.332) -- 0:00:20
656000 -- (-455.846) (-456.881) [-449.834] (-452.371) * (-450.104) (-449.522) (-449.870) [-449.883] -- 0:00:20
656500 -- (-454.935) (-451.891) [-451.273] (-450.091) * [-452.942] (-449.385) (-453.775) (-450.519) -- 0:00:20
657000 -- (-449.695) [-449.098] (-452.670) (-449.646) * [-449.808] (-454.748) (-449.660) (-449.768) -- 0:00:20
657500 -- (-450.052) [-449.097] (-451.824) (-450.414) * (-451.556) (-450.942) [-450.042] (-450.419) -- 0:00:20
658000 -- (-452.661) (-452.625) (-450.546) [-450.924] * [-450.723] (-450.965) (-451.861) (-450.552) -- 0:00:20
658500 -- [-450.879] (-451.468) (-450.050) (-452.954) * [-452.995] (-449.280) (-450.715) (-451.527) -- 0:00:20
659000 -- [-452.913] (-454.398) (-449.315) (-454.026) * [-451.167] (-450.747) (-451.000) (-450.649) -- 0:00:20
659500 -- (-449.363) (-450.273) (-449.723) [-453.330] * (-451.681) [-453.384] (-450.117) (-454.265) -- 0:00:20
660000 -- (-451.283) (-453.249) [-452.375] (-453.590) * [-451.941] (-453.967) (-449.475) (-451.149) -- 0:00:20
Average standard deviation of split frequencies: 0.008830
660500 -- (-451.725) (-457.567) (-452.719) [-449.296] * (-451.927) (-453.817) [-456.412] (-451.373) -- 0:00:20
661000 -- (-450.278) [-456.459] (-452.975) (-452.506) * [-450.323] (-451.813) (-453.451) (-450.526) -- 0:00:20
661500 -- [-454.881] (-456.655) (-451.973) (-452.499) * [-450.769] (-451.587) (-450.892) (-451.044) -- 0:00:19
662000 -- (-453.417) (-452.510) (-451.823) [-453.254] * [-455.111] (-455.908) (-451.071) (-451.836) -- 0:00:19
662500 -- (-455.221) [-451.987] (-451.400) (-453.433) * (-452.874) (-449.566) [-453.006] (-450.707) -- 0:00:19
663000 -- (-451.738) (-450.884) (-452.466) [-451.234] * (-451.299) (-449.555) (-451.942) [-453.566] -- 0:00:19
663500 -- (-451.316) [-449.578] (-454.913) (-455.079) * [-451.908] (-453.035) (-452.641) (-452.180) -- 0:00:19
664000 -- (-450.663) (-453.487) (-449.158) [-451.177] * (-452.204) [-454.192] (-451.225) (-454.623) -- 0:00:19
664500 -- (-450.255) (-450.456) (-450.032) [-451.667] * (-451.460) (-452.817) [-455.120] (-451.059) -- 0:00:19
665000 -- (-449.958) [-451.936] (-451.537) (-449.312) * [-450.333] (-449.933) (-453.367) (-453.396) -- 0:00:19
Average standard deviation of split frequencies: 0.008405
665500 -- [-449.321] (-454.548) (-449.693) (-456.267) * [-449.824] (-449.510) (-451.216) (-450.887) -- 0:00:19
666000 -- [-459.610] (-450.803) (-454.917) (-462.484) * [-450.068] (-451.454) (-452.678) (-452.003) -- 0:00:19
666500 -- (-452.033) (-454.520) (-453.102) [-454.988] * (-451.992) [-450.006] (-451.750) (-450.245) -- 0:00:19
667000 -- (-450.980) (-449.486) [-451.858] (-452.813) * (-450.280) (-451.429) (-449.996) [-450.342] -- 0:00:19
667500 -- [-453.787] (-449.978) (-451.607) (-450.051) * (-449.951) (-449.409) (-451.471) [-451.748] -- 0:00:19
668000 -- (-455.221) (-451.720) [-449.801] (-451.153) * (-450.374) (-457.845) (-451.599) [-452.895] -- 0:00:19
668500 -- [-451.841] (-450.414) (-450.922) (-452.171) * (-451.138) [-453.839] (-451.765) (-450.837) -- 0:00:19
669000 -- (-451.081) (-452.501) [-450.681] (-456.410) * (-451.009) (-450.011) [-451.497] (-451.468) -- 0:00:19
669500 -- [-451.903] (-451.771) (-450.667) (-450.241) * (-451.211) (-449.813) [-451.479] (-451.280) -- 0:00:19
670000 -- [-454.117] (-451.276) (-451.074) (-450.300) * (-453.011) [-451.195] (-452.359) (-450.100) -- 0:00:19
Average standard deviation of split frequencies: 0.008171
670500 -- [-451.406] (-454.694) (-450.427) (-456.196) * (-452.265) [-453.402] (-451.029) (-449.367) -- 0:00:19
671000 -- (-451.837) [-451.490] (-450.776) (-450.961) * [-452.580] (-450.188) (-450.508) (-452.535) -- 0:00:19
671500 -- (-451.513) (-449.082) [-452.762] (-451.796) * (-458.245) [-451.002] (-450.594) (-450.281) -- 0:00:19
672000 -- (-451.494) (-449.081) [-452.554] (-455.606) * (-452.960) (-453.036) [-450.084] (-453.308) -- 0:00:19
672500 -- (-453.779) (-453.977) [-450.116] (-449.713) * (-449.368) (-453.791) (-450.005) [-450.109] -- 0:00:19
673000 -- (-455.514) [-451.022] (-451.012) (-450.928) * (-452.606) (-452.945) (-450.193) [-449.919] -- 0:00:19
673500 -- (-449.689) (-452.220) (-451.154) [-451.073] * (-451.771) (-450.679) (-450.146) [-453.680] -- 0:00:19
674000 -- (-450.932) [-450.746] (-450.656) (-451.998) * (-452.078) [-451.663] (-450.545) (-453.162) -- 0:00:19
674500 -- (-451.967) [-454.805] (-451.129) (-450.520) * (-451.274) (-450.756) (-451.030) [-450.593] -- 0:00:19
675000 -- (-451.996) [-453.118] (-455.471) (-450.654) * (-449.463) (-450.191) (-451.938) [-450.549] -- 0:00:19
Average standard deviation of split frequencies: 0.008150
675500 -- (-451.263) (-449.379) (-454.190) [-450.497] * (-453.092) (-452.137) [-453.741] (-450.987) -- 0:00:19
676000 -- (-449.743) (-449.962) [-450.299] (-450.676) * [-452.872] (-450.366) (-454.544) (-450.679) -- 0:00:19
676500 -- (-452.567) [-451.775] (-450.331) (-450.409) * [-451.121] (-453.557) (-452.684) (-451.956) -- 0:00:19
677000 -- [-449.903] (-452.892) (-452.954) (-451.024) * (-449.398) (-452.579) (-453.203) [-452.209] -- 0:00:19
677500 -- (-450.353) (-451.392) (-450.069) [-452.110] * (-452.439) (-452.739) [-452.706] (-450.271) -- 0:00:19
678000 -- (-451.380) [-450.014] (-451.508) (-450.962) * [-453.155] (-450.047) (-452.980) (-453.136) -- 0:00:18
678500 -- (-454.472) (-451.788) (-450.886) [-450.641] * [-450.322] (-453.149) (-452.793) (-452.399) -- 0:00:18
679000 -- (-452.460) (-451.476) [-451.305] (-451.579) * (-449.964) [-449.726] (-454.650) (-452.373) -- 0:00:18
679500 -- (-452.810) (-451.766) [-450.564] (-451.982) * (-450.598) [-452.654] (-451.079) (-450.917) -- 0:00:18
680000 -- [-451.144] (-452.481) (-450.529) (-452.072) * (-452.009) [-450.409] (-450.107) (-450.161) -- 0:00:18
Average standard deviation of split frequencies: 0.008267
680500 -- (-452.320) (-451.352) (-453.312) [-450.765] * (-451.213) (-450.819) [-450.071] (-451.341) -- 0:00:18
681000 -- (-451.989) (-450.987) [-459.545] (-451.475) * (-451.486) [-450.334] (-453.602) (-453.338) -- 0:00:18
681500 -- (-451.480) (-455.064) (-451.892) [-450.995] * [-450.591] (-452.389) (-450.531) (-451.238) -- 0:00:18
682000 -- (-452.681) [-449.644] (-449.724) (-455.031) * [-450.611] (-450.888) (-455.383) (-449.959) -- 0:00:18
682500 -- (-455.151) (-450.982) [-453.008] (-454.044) * [-450.889] (-451.338) (-454.662) (-451.980) -- 0:00:18
683000 -- (-449.764) (-452.292) (-450.046) [-450.209] * (-452.712) [-451.241] (-454.660) (-449.484) -- 0:00:18
683500 -- (-452.336) (-451.355) [-452.241] (-454.046) * (-449.943) (-450.906) [-454.308] (-451.627) -- 0:00:18
684000 -- (-464.671) [-449.979] (-450.950) (-453.954) * (-450.810) (-450.854) [-450.252] (-451.274) -- 0:00:18
684500 -- (-452.813) (-450.575) [-451.682] (-451.894) * (-451.793) (-453.296) [-451.633] (-450.255) -- 0:00:18
685000 -- (-450.610) (-450.202) (-453.066) [-451.827] * (-450.459) (-451.822) [-452.882] (-454.749) -- 0:00:18
Average standard deviation of split frequencies: 0.008031
685500 -- [-450.722] (-449.523) (-452.880) (-454.799) * [-450.344] (-451.726) (-450.955) (-451.439) -- 0:00:18
686000 -- (-450.893) (-449.632) [-449.566] (-450.974) * (-455.270) (-450.041) (-455.154) [-452.869] -- 0:00:18
686500 -- (-449.322) (-451.109) (-450.104) [-452.037] * [-455.565] (-451.047) (-452.451) (-452.467) -- 0:00:18
687000 -- (-451.218) (-454.634) [-450.194] (-451.488) * [-450.064] (-457.090) (-453.239) (-452.685) -- 0:00:18
687500 -- [-450.218] (-455.839) (-451.185) (-451.069) * [-449.667] (-454.706) (-451.711) (-452.354) -- 0:00:18
688000 -- (-451.272) (-452.566) [-449.973] (-454.234) * (-451.279) [-453.267] (-454.222) (-453.649) -- 0:00:18
688500 -- [-451.958] (-451.488) (-451.367) (-451.327) * (-451.788) (-450.125) (-451.151) [-452.774] -- 0:00:18
689000 -- (-451.583) [-450.929] (-451.314) (-452.381) * (-450.517) (-452.047) [-450.108] (-450.867) -- 0:00:18
689500 -- (-450.812) (-451.949) (-453.424) [-453.844] * (-451.410) (-456.247) [-450.518] (-450.183) -- 0:00:18
690000 -- (-451.690) [-452.283] (-455.412) (-451.151) * [-452.781] (-451.903) (-450.015) (-451.550) -- 0:00:18
Average standard deviation of split frequencies: 0.007977
690500 -- (-450.618) (-452.966) (-456.723) [-450.887] * [-449.803] (-451.377) (-453.125) (-452.242) -- 0:00:18
691000 -- (-453.780) [-450.146] (-456.469) (-450.611) * (-453.851) [-453.133] (-453.114) (-452.249) -- 0:00:18
691500 -- [-452.451] (-452.154) (-454.613) (-454.291) * (-452.388) (-453.499) (-452.488) [-451.101] -- 0:00:18
692000 -- (-454.381) (-453.314) (-450.175) [-451.984] * [-449.860] (-451.733) (-451.152) (-452.981) -- 0:00:18
692500 -- (-449.507) (-453.925) (-450.125) [-450.461] * (-451.217) (-450.828) (-451.215) [-452.291] -- 0:00:18
693000 -- [-449.450] (-452.439) (-450.715) (-453.016) * (-449.442) (-457.989) (-451.567) [-455.890] -- 0:00:18
693500 -- [-450.100] (-450.344) (-452.735) (-450.785) * (-450.763) (-456.023) [-453.073] (-453.424) -- 0:00:18
694000 -- (-449.597) (-451.205) [-450.515] (-451.966) * [-450.753] (-457.526) (-450.043) (-451.300) -- 0:00:18
694500 -- [-450.131] (-451.675) (-450.912) (-453.280) * [-450.545] (-450.659) (-452.894) (-450.616) -- 0:00:18
695000 -- (-450.805) (-450.973) (-449.809) [-449.713] * (-453.325) (-451.831) (-456.139) [-451.333] -- 0:00:17
Average standard deviation of split frequencies: 0.007225
695500 -- (-449.452) (-452.621) [-449.287] (-454.744) * (-450.943) (-452.614) (-450.738) [-451.382] -- 0:00:17
696000 -- (-453.643) [-449.299] (-451.791) (-453.789) * (-451.351) (-450.423) (-449.923) [-452.119] -- 0:00:17
696500 -- (-451.785) [-449.931] (-452.165) (-452.509) * (-453.022) (-452.441) (-452.536) [-451.194] -- 0:00:17
697000 -- (-452.889) (-452.433) [-452.845] (-453.265) * (-453.550) (-449.642) [-451.768] (-450.818) -- 0:00:17
697500 -- (-451.494) (-453.139) [-452.069] (-450.119) * (-457.652) (-450.051) [-451.337] (-458.076) -- 0:00:17
698000 -- (-451.272) (-452.154) [-450.706] (-454.107) * (-449.910) [-449.868] (-450.117) (-451.306) -- 0:00:17
698500 -- [-450.448] (-452.957) (-453.205) (-454.626) * (-449.491) [-449.493] (-451.151) (-453.105) -- 0:00:17
699000 -- (-451.796) (-452.513) (-451.773) [-450.400] * (-452.717) (-451.187) (-451.873) [-452.966] -- 0:00:17
699500 -- (-452.150) [-452.668] (-451.451) (-451.651) * (-450.354) (-449.366) [-451.654] (-449.698) -- 0:00:17
700000 -- (-451.029) [-451.903] (-455.866) (-452.186) * [-451.404] (-449.748) (-454.258) (-449.607) -- 0:00:17
Average standard deviation of split frequencies: 0.007221
700500 -- (-452.861) (-452.214) [-452.193] (-450.431) * (-450.896) (-450.127) (-452.683) [-449.981] -- 0:00:17
701000 -- (-453.572) [-454.567] (-453.631) (-451.742) * (-454.275) (-452.505) (-451.954) [-451.647] -- 0:00:17
701500 -- (-451.271) (-451.798) [-452.067] (-452.296) * (-451.919) (-450.578) (-453.154) [-449.756] -- 0:00:17
702000 -- (-454.407) [-451.031] (-453.187) (-450.510) * [-451.655] (-457.683) (-451.094) (-450.117) -- 0:00:17
702500 -- (-455.456) (-451.811) [-451.333] (-452.880) * (-451.175) [-449.633] (-449.587) (-450.687) -- 0:00:17
703000 -- [-451.034] (-451.353) (-451.149) (-450.902) * [-451.236] (-454.771) (-449.466) (-449.679) -- 0:00:17
703500 -- (-452.199) (-452.907) (-452.257) [-449.560] * (-453.719) (-452.764) (-453.300) [-450.199] -- 0:00:17
704000 -- (-451.705) (-455.198) (-451.776) [-450.752] * (-451.703) (-452.466) (-452.636) [-450.215] -- 0:00:17
704500 -- (-451.009) (-458.879) (-451.851) [-455.505] * (-452.294) (-451.593) [-451.328] (-450.403) -- 0:00:17
705000 -- (-451.241) (-453.744) (-453.273) [-450.430] * (-450.268) (-450.719) (-460.420) [-450.876] -- 0:00:17
Average standard deviation of split frequencies: 0.007887
705500 -- (-456.374) (-453.767) [-450.370] (-450.078) * [-452.144] (-449.954) (-454.585) (-451.182) -- 0:00:17
706000 -- (-450.991) (-452.265) [-452.641] (-449.602) * (-452.030) (-449.217) [-451.128] (-451.689) -- 0:00:17
706500 -- [-453.785] (-454.457) (-453.893) (-449.351) * (-451.012) (-449.743) (-451.689) [-452.176] -- 0:00:17
707000 -- (-454.403) [-454.303] (-450.752) (-449.800) * [-449.328] (-450.296) (-452.004) (-454.340) -- 0:00:17
707500 -- (-451.564) (-453.061) [-450.401] (-451.004) * [-451.695] (-450.980) (-453.676) (-451.678) -- 0:00:17
708000 -- (-452.897) (-453.081) (-450.992) [-450.829] * (-449.822) (-451.542) (-452.599) [-450.347] -- 0:00:17
708500 -- [-454.139] (-454.465) (-450.036) (-452.456) * (-454.346) (-451.638) (-452.462) [-449.809] -- 0:00:17
709000 -- (-453.572) [-450.889] (-450.176) (-450.895) * (-452.840) [-453.364] (-454.846) (-450.064) -- 0:00:17
709500 -- (-454.639) [-451.764] (-449.791) (-454.785) * (-450.848) [-453.273] (-450.952) (-450.872) -- 0:00:17
710000 -- [-455.527] (-452.672) (-450.205) (-453.187) * (-452.548) (-450.725) (-451.902) [-456.132] -- 0:00:17
Average standard deviation of split frequencies: 0.007836
710500 -- (-454.534) (-451.582) [-449.843] (-451.035) * (-450.281) (-452.501) (-450.617) [-454.778] -- 0:00:17
711000 -- (-450.712) (-451.788) (-450.212) [-449.361] * (-450.613) [-450.581] (-452.204) (-452.211) -- 0:00:17
711500 -- (-450.257) (-451.145) [-450.516] (-453.868) * (-450.355) (-452.088) [-452.034] (-451.879) -- 0:00:17
712000 -- [-453.476] (-453.084) (-453.961) (-450.795) * (-451.990) (-451.779) (-452.520) [-449.397] -- 0:00:16
712500 -- (-455.020) (-457.702) (-453.034) [-449.974] * (-453.518) (-451.786) [-450.760] (-450.485) -- 0:00:16
713000 -- [-451.932] (-457.768) (-450.306) (-450.181) * (-451.234) (-453.600) [-450.236] (-451.620) -- 0:00:16
713500 -- [-454.000] (-452.785) (-453.986) (-451.920) * [-450.890] (-454.268) (-450.005) (-452.029) -- 0:00:16
714000 -- (-455.083) [-450.898] (-452.643) (-449.277) * [-451.071] (-452.324) (-451.347) (-449.641) -- 0:00:16
714500 -- [-450.055] (-451.276) (-451.013) (-451.853) * [-451.334] (-453.521) (-449.678) (-451.449) -- 0:00:16
715000 -- (-453.914) (-454.029) [-452.667] (-451.764) * (-450.474) [-451.937] (-452.451) (-450.868) -- 0:00:16
Average standard deviation of split frequencies: 0.006979
715500 -- [-452.171] (-451.555) (-449.346) (-452.193) * (-452.065) [-450.870] (-451.682) (-453.043) -- 0:00:16
716000 -- (-449.576) [-453.954] (-449.288) (-451.678) * (-450.021) (-451.907) (-452.373) [-451.217] -- 0:00:16
716500 -- (-452.045) (-450.794) [-452.618] (-457.612) * (-450.553) [-452.339] (-453.784) (-451.115) -- 0:00:16
717000 -- (-453.222) (-450.356) [-450.218] (-452.061) * (-449.960) (-451.119) [-451.723] (-453.200) -- 0:00:16
717500 -- (-449.783) (-449.873) [-450.009] (-454.908) * [-449.421] (-451.121) (-450.464) (-449.900) -- 0:00:16
718000 -- (-449.996) [-450.614] (-450.810) (-451.953) * (-450.037) [-450.336] (-449.865) (-452.756) -- 0:00:16
718500 -- (-454.172) [-449.518] (-450.846) (-452.510) * (-450.783) [-450.202] (-450.305) (-452.534) -- 0:00:16
719000 -- (-450.769) [-451.013] (-454.081) (-451.665) * (-451.197) (-451.095) [-452.421] (-452.371) -- 0:00:16
719500 -- (-451.408) [-449.293] (-450.997) (-451.563) * (-454.408) [-449.811] (-452.107) (-451.580) -- 0:00:16
720000 -- (-450.252) (-451.906) [-451.156] (-453.337) * (-449.799) (-451.215) [-452.300] (-450.677) -- 0:00:16
Average standard deviation of split frequencies: 0.006803
720500 -- (-454.143) [-450.684] (-451.780) (-453.589) * (-450.896) (-454.316) (-450.571) [-451.009] -- 0:00:16
721000 -- (-451.627) (-451.060) [-449.921] (-452.973) * (-451.205) (-453.497) [-449.827] (-453.070) -- 0:00:16
721500 -- (-449.807) (-450.575) [-449.561] (-453.036) * (-450.484) [-453.019] (-451.349) (-451.343) -- 0:00:16
722000 -- (-451.487) (-451.476) (-450.281) [-450.930] * (-450.151) (-450.100) [-451.799] (-452.687) -- 0:00:16
722500 -- (-449.502) (-454.872) (-454.421) [-454.075] * [-454.470] (-450.762) (-449.616) (-451.969) -- 0:00:16
723000 -- (-451.079) (-453.518) (-458.594) [-453.579] * (-451.942) (-452.797) [-449.848] (-451.207) -- 0:00:16
723500 -- (-450.348) (-449.949) (-453.983) [-450.620] * (-451.439) (-453.824) [-451.878] (-451.621) -- 0:00:16
724000 -- (-449.720) [-451.021] (-451.947) (-451.487) * (-451.518) [-451.169] (-450.836) (-449.861) -- 0:00:16
724500 -- (-453.902) [-449.953] (-455.932) (-451.393) * [-451.784] (-454.692) (-450.450) (-450.896) -- 0:00:16
725000 -- (-451.043) (-453.516) [-451.134] (-456.121) * (-450.103) [-452.577] (-450.086) (-452.246) -- 0:00:16
Average standard deviation of split frequencies: 0.006969
725500 -- [-449.923] (-450.630) (-452.101) (-452.260) * (-453.912) (-452.920) [-449.653] (-451.891) -- 0:00:16
726000 -- (-454.571) [-449.929] (-453.716) (-449.617) * [-449.616] (-454.730) (-449.592) (-450.203) -- 0:00:16
726500 -- [-451.452] (-449.732) (-455.350) (-453.036) * (-451.579) (-453.295) (-451.684) [-451.529] -- 0:00:16
727000 -- (-452.200) [-450.396] (-451.692) (-454.464) * [-450.437] (-451.560) (-453.031) (-451.583) -- 0:00:16
727500 -- (-450.759) (-453.555) (-451.502) [-454.782] * (-449.838) (-456.609) [-455.175] (-454.617) -- 0:00:16
728000 -- (-450.659) [-450.468] (-451.249) (-452.320) * (-451.565) (-455.312) [-457.040] (-450.628) -- 0:00:16
728500 -- [-452.504] (-449.858) (-450.843) (-452.485) * [-451.593] (-451.423) (-450.455) (-450.445) -- 0:00:16
729000 -- (-453.871) (-450.627) (-451.477) [-456.903] * [-451.770] (-456.239) (-449.287) (-450.793) -- 0:00:15
729500 -- (-452.989) (-449.831) [-452.053] (-455.574) * (-449.978) [-450.503] (-450.137) (-454.713) -- 0:00:15
730000 -- [-452.808] (-453.125) (-453.906) (-454.290) * (-452.338) [-451.199] (-452.554) (-452.413) -- 0:00:15
Average standard deviation of split frequencies: 0.007183
730500 -- (-451.186) [-449.510] (-451.628) (-449.287) * [-450.706] (-450.636) (-454.399) (-454.550) -- 0:00:15
731000 -- (-450.328) [-450.158] (-449.779) (-450.708) * [-449.290] (-452.276) (-450.402) (-451.405) -- 0:00:15
731500 -- (-453.828) (-451.971) [-449.995] (-450.140) * (-450.776) (-452.924) [-452.225] (-451.541) -- 0:00:15
732000 -- (-449.792) (-449.701) [-450.706] (-451.711) * [-451.820] (-456.221) (-450.307) (-451.974) -- 0:00:15
732500 -- (-451.213) (-451.291) [-450.914] (-450.012) * [-450.539] (-453.393) (-451.480) (-453.251) -- 0:00:15
733000 -- (-450.434) [-452.259] (-454.641) (-450.503) * (-449.951) [-450.699] (-450.841) (-452.399) -- 0:00:15
733500 -- (-454.085) (-450.872) [-454.553] (-453.001) * (-451.060) (-451.215) [-450.494] (-452.197) -- 0:00:15
734000 -- (-451.452) (-452.540) [-450.531] (-450.234) * (-452.805) [-450.401] (-452.006) (-449.947) -- 0:00:15
734500 -- (-452.396) (-450.133) (-450.311) [-453.391] * (-452.749) (-451.508) (-451.521) [-450.833] -- 0:00:15
735000 -- (-451.188) (-449.481) (-451.138) [-451.976] * [-451.720] (-450.208) (-451.326) (-450.486) -- 0:00:15
Average standard deviation of split frequencies: 0.007045
735500 -- (-456.340) (-449.623) [-452.614] (-450.842) * (-450.840) [-451.984] (-456.078) (-450.486) -- 0:00:15
736000 -- [-451.328] (-451.157) (-453.141) (-450.850) * (-455.250) (-450.840) [-452.217] (-451.412) -- 0:00:15
736500 -- (-449.550) (-452.993) [-454.189] (-451.249) * (-452.306) (-450.514) (-450.210) [-454.504] -- 0:00:15
737000 -- [-452.657] (-453.260) (-449.391) (-452.797) * [-453.024] (-452.651) (-451.072) (-460.140) -- 0:00:15
737500 -- (-451.434) (-451.343) [-449.645] (-454.639) * (-450.829) [-451.830] (-451.220) (-457.436) -- 0:00:15
738000 -- (-451.832) (-451.397) (-454.554) [-451.812] * (-451.369) (-455.244) [-455.877] (-450.256) -- 0:00:15
738500 -- [-450.810] (-451.974) (-453.684) (-451.947) * (-452.139) (-451.819) (-451.625) [-452.294] -- 0:00:15
739000 -- (-452.041) (-453.203) (-450.517) [-452.768] * (-451.548) [-454.320] (-452.276) (-451.553) -- 0:00:15
739500 -- (-451.309) (-451.345) [-450.960] (-450.060) * (-460.845) (-451.327) (-453.595) [-451.029] -- 0:00:15
740000 -- (-449.975) (-451.127) [-449.865] (-452.671) * (-453.791) (-452.100) (-451.335) [-452.564] -- 0:00:15
Average standard deviation of split frequencies: 0.006831
740500 -- (-452.978) (-451.916) (-450.075) [-453.317] * (-451.868) [-454.025] (-450.463) (-450.207) -- 0:00:15
741000 -- (-449.665) [-451.656] (-450.311) (-454.859) * (-452.675) (-454.540) [-450.349] (-450.654) -- 0:00:15
741500 -- (-450.780) (-457.326) (-451.605) [-451.113] * (-455.696) [-450.555] (-451.429) (-452.525) -- 0:00:15
742000 -- (-450.350) [-450.755] (-451.659) (-449.854) * (-452.231) (-452.346) [-450.361] (-452.198) -- 0:00:15
742500 -- [-451.956] (-451.227) (-451.674) (-451.675) * (-451.446) (-449.974) (-450.307) [-451.305] -- 0:00:15
743000 -- [-454.737] (-452.761) (-449.832) (-454.990) * (-451.462) (-450.846) [-450.173] (-452.043) -- 0:00:15
743500 -- [-451.600] (-450.546) (-451.214) (-453.099) * (-451.168) (-450.139) (-449.753) [-454.446] -- 0:00:15
744000 -- (-450.215) [-450.638] (-453.091) (-452.172) * (-452.386) [-450.095] (-452.262) (-452.675) -- 0:00:15
744500 -- (-450.768) (-449.980) [-450.131] (-449.632) * (-453.153) (-450.005) [-449.891] (-451.191) -- 0:00:15
745000 -- (-450.948) (-451.016) (-450.475) [-449.498] * (-453.892) [-450.339] (-451.760) (-453.939) -- 0:00:15
Average standard deviation of split frequencies: 0.007077
745500 -- (-450.207) (-450.820) (-451.877) [-449.604] * (-454.299) (-450.581) [-455.328] (-451.186) -- 0:00:15
746000 -- (-451.607) (-451.098) [-451.415] (-449.245) * [-451.323] (-450.225) (-453.554) (-450.552) -- 0:00:14
746500 -- (-451.337) (-450.134) [-452.115] (-452.114) * (-450.701) [-453.892] (-451.401) (-450.326) -- 0:00:14
747000 -- (-452.528) (-451.188) (-454.835) [-451.431] * (-450.283) (-454.657) (-450.322) [-450.094] -- 0:00:14
747500 -- (-451.794) [-450.137] (-451.759) (-454.847) * (-453.063) [-450.706] (-449.647) (-449.887) -- 0:00:14
748000 -- (-452.282) (-452.510) [-451.346] (-455.924) * [-450.616] (-452.663) (-450.107) (-450.422) -- 0:00:14
748500 -- [-451.434] (-451.566) (-452.880) (-454.477) * (-451.202) [-454.109] (-450.942) (-450.141) -- 0:00:14
749000 -- (-454.884) (-450.471) (-450.938) [-452.037] * (-452.066) (-460.119) [-452.505] (-450.379) -- 0:00:14
749500 -- (-451.519) [-451.905] (-452.104) (-453.977) * (-452.752) [-450.549] (-451.826) (-451.521) -- 0:00:14
750000 -- (-455.235) (-450.941) (-449.266) [-452.328] * [-455.576] (-455.866) (-452.218) (-454.535) -- 0:00:14
Average standard deviation of split frequencies: 0.006866
750500 -- (-453.962) (-454.062) [-450.754] (-451.581) * (-456.072) [-453.872] (-451.660) (-451.230) -- 0:00:14
751000 -- (-451.692) [-450.278] (-450.721) (-450.606) * (-455.166) (-449.545) [-450.945] (-453.904) -- 0:00:14
751500 -- (-450.416) (-450.431) (-450.153) [-450.480] * [-450.760] (-455.478) (-452.720) (-458.230) -- 0:00:14
752000 -- (-453.450) (-451.719) [-450.921] (-449.601) * (-450.573) [-452.786] (-454.555) (-462.043) -- 0:00:14
752500 -- (-449.934) (-450.072) (-450.827) [-457.133] * (-452.580) (-450.200) [-451.063] (-458.661) -- 0:00:14
753000 -- (-451.669) (-451.123) [-454.778] (-450.678) * (-451.505) (-450.641) [-450.214] (-452.073) -- 0:00:14
753500 -- [-451.040] (-454.421) (-453.186) (-450.918) * (-453.293) (-453.218) (-449.746) [-451.631] -- 0:00:14
754000 -- (-454.977) (-450.703) [-450.057] (-452.505) * [-454.103] (-450.550) (-449.349) (-450.753) -- 0:00:14
754500 -- [-451.973] (-449.842) (-451.073) (-449.926) * [-449.812] (-449.589) (-450.677) (-453.017) -- 0:00:14
755000 -- (-451.179) (-450.828) [-449.755] (-450.735) * (-451.199) [-451.591] (-451.114) (-453.491) -- 0:00:14
Average standard deviation of split frequencies: 0.007067
755500 -- (-452.661) (-452.863) [-451.583] (-450.567) * [-452.852] (-455.222) (-449.778) (-453.064) -- 0:00:14
756000 -- [-449.713] (-459.662) (-456.060) (-451.040) * (-450.454) (-456.135) (-453.283) [-451.504] -- 0:00:14
756500 -- [-451.570] (-456.110) (-453.976) (-451.002) * (-450.650) (-449.997) [-451.051] (-454.519) -- 0:00:14
757000 -- (-451.128) (-454.161) [-451.299] (-450.320) * (-450.047) (-453.204) [-451.039] (-450.679) -- 0:00:14
757500 -- (-451.851) (-455.810) [-449.123] (-450.523) * (-453.032) (-451.733) [-452.809] (-451.373) -- 0:00:14
758000 -- (-452.404) (-455.088) [-450.551] (-450.520) * (-452.573) (-449.608) (-454.083) [-449.762] -- 0:00:14
758500 -- [-451.105] (-452.145) (-450.234) (-455.890) * (-451.633) [-449.508] (-450.111) (-450.416) -- 0:00:14
759000 -- (-449.266) (-450.572) (-451.716) [-451.250] * (-456.151) [-452.113] (-452.298) (-452.455) -- 0:00:14
759500 -- [-450.678] (-450.405) (-449.222) (-452.158) * [-454.997] (-454.483) (-455.591) (-451.983) -- 0:00:14
760000 -- (-449.944) (-450.522) [-450.384] (-451.257) * (-450.315) [-450.714] (-452.467) (-453.398) -- 0:00:14
Average standard deviation of split frequencies: 0.007230
760500 -- [-451.238] (-452.822) (-453.309) (-452.252) * (-451.868) (-452.238) [-454.848] (-450.750) -- 0:00:14
761000 -- (-455.894) (-456.154) [-452.497] (-450.359) * (-456.337) (-450.251) [-451.123] (-451.336) -- 0:00:14
761500 -- (-449.970) (-450.993) (-451.005) [-453.264] * (-453.127) [-450.470] (-450.999) (-454.722) -- 0:00:14
762000 -- (-450.765) [-452.063] (-452.207) (-452.796) * (-450.709) (-452.133) [-450.965] (-450.451) -- 0:00:14
762500 -- (-451.053) (-453.988) [-452.604] (-450.833) * (-450.537) [-450.835] (-450.842) (-449.743) -- 0:00:14
763000 -- (-450.402) [-450.868] (-450.699) (-449.436) * [-451.422] (-453.410) (-451.017) (-450.042) -- 0:00:13
763500 -- (-449.748) [-452.074] (-450.953) (-449.701) * [-451.635] (-452.257) (-449.539) (-451.613) -- 0:00:13
764000 -- (-450.265) (-449.955) (-450.520) [-451.506] * (-449.503) (-449.222) (-449.289) [-451.436] -- 0:00:13
764500 -- [-450.481] (-449.714) (-450.483) (-453.120) * (-449.831) [-452.592] (-449.432) (-450.305) -- 0:00:13
765000 -- [-449.431] (-450.991) (-452.232) (-452.420) * (-449.722) (-454.946) (-451.283) [-450.065] -- 0:00:13
Average standard deviation of split frequencies: 0.006934
765500 -- (-454.685) [-452.536] (-449.688) (-450.987) * (-449.295) (-454.390) [-451.007] (-450.566) -- 0:00:13
766000 -- [-451.061] (-454.886) (-449.833) (-449.929) * (-450.887) (-451.322) [-450.458] (-454.443) -- 0:00:13
766500 -- [-450.541] (-450.945) (-450.911) (-452.722) * (-449.426) [-452.452] (-451.770) (-459.175) -- 0:00:13
767000 -- (-451.144) (-452.079) (-449.891) [-453.921] * [-452.314] (-449.949) (-450.227) (-453.826) -- 0:00:13
767500 -- [-451.390] (-450.442) (-450.101) (-452.672) * (-451.975) [-449.842] (-450.086) (-452.421) -- 0:00:13
768000 -- (-455.981) (-452.616) [-450.904] (-451.063) * (-453.909) [-451.185] (-450.515) (-452.526) -- 0:00:13
768500 -- (-455.985) (-450.690) (-451.255) [-452.791] * (-450.992) [-450.729] (-453.722) (-450.868) -- 0:00:13
769000 -- (-451.504) (-450.241) [-451.113] (-451.801) * (-449.974) (-451.402) (-453.684) [-452.179] -- 0:00:13
769500 -- [-455.350] (-450.177) (-453.546) (-450.554) * (-451.797) (-449.573) [-451.243] (-451.666) -- 0:00:13
770000 -- (-453.782) [-452.723] (-456.758) (-451.771) * (-452.775) (-452.923) [-451.408] (-450.853) -- 0:00:13
Average standard deviation of split frequencies: 0.006851
770500 -- (-456.439) (-452.259) [-453.741] (-450.146) * (-451.716) (-455.108) [-452.921] (-453.643) -- 0:00:13
771000 -- (-455.393) (-449.772) (-450.291) [-450.782] * (-451.786) [-451.550] (-452.227) (-450.216) -- 0:00:13
771500 -- (-453.071) (-455.056) (-451.138) [-450.937] * (-450.701) (-453.595) [-449.364] (-452.045) -- 0:00:13
772000 -- (-454.225) (-450.426) (-449.402) [-450.096] * (-450.581) [-450.174] (-455.393) (-452.866) -- 0:00:13
772500 -- (-452.141) (-453.571) [-450.901] (-451.682) * (-454.441) (-450.361) [-453.357] (-449.820) -- 0:00:13
773000 -- (-453.214) [-450.639] (-450.509) (-451.291) * [-455.876] (-450.198) (-451.270) (-450.237) -- 0:00:13
773500 -- [-451.609] (-450.428) (-450.405) (-451.316) * [-453.252] (-451.180) (-451.230) (-451.740) -- 0:00:13
774000 -- (-453.552) (-450.214) (-450.500) [-450.451] * (-450.349) [-453.671] (-456.785) (-452.517) -- 0:00:13
774500 -- [-450.685] (-450.624) (-451.748) (-454.706) * [-451.333] (-452.532) (-450.816) (-451.935) -- 0:00:13
775000 -- (-453.249) (-452.335) (-451.747) [-451.870] * (-451.152) [-451.117] (-451.554) (-457.032) -- 0:00:13
Average standard deviation of split frequencies: 0.007128
775500 -- (-453.701) [-453.308] (-453.007) (-451.246) * (-452.642) [-451.917] (-451.325) (-454.043) -- 0:00:13
776000 -- (-454.705) [-452.793] (-450.102) (-449.593) * (-449.854) [-450.063] (-450.455) (-450.019) -- 0:00:13
776500 -- (-453.243) (-451.651) (-451.466) [-450.223] * [-451.526] (-449.877) (-450.901) (-450.836) -- 0:00:13
777000 -- (-454.269) [-450.995] (-449.353) (-451.156) * (-450.821) (-449.246) [-450.196] (-449.927) -- 0:00:13
777500 -- (-455.222) (-452.374) (-450.566) [-450.962] * (-450.560) (-454.472) (-452.927) [-451.809] -- 0:00:13
778000 -- (-450.009) (-451.392) [-452.208] (-450.732) * [-451.049] (-451.135) (-451.557) (-451.004) -- 0:00:13
778500 -- (-449.959) (-458.592) [-450.686] (-450.308) * (-452.288) [-454.287] (-452.624) (-453.041) -- 0:00:13
779000 -- (-451.597) (-453.786) (-450.669) [-454.746] * (-452.697) (-454.812) (-451.131) [-453.995] -- 0:00:13
779500 -- (-450.289) (-450.090) (-454.037) [-450.448] * [-450.202] (-451.887) (-451.478) (-451.068) -- 0:00:13
780000 -- (-452.698) (-450.545) (-452.126) [-450.277] * (-450.028) [-452.296] (-453.318) (-454.121) -- 0:00:12
Average standard deviation of split frequencies: 0.006763
780500 -- (-453.012) (-451.438) (-452.031) [-451.826] * (-452.342) (-450.686) (-452.875) [-453.909] -- 0:00:12
781000 -- [-452.510] (-449.568) (-453.214) (-451.993) * (-449.971) [-449.859] (-452.268) (-453.660) -- 0:00:12
781500 -- (-451.861) (-451.308) [-452.703] (-451.779) * (-450.260) [-451.257] (-455.017) (-450.254) -- 0:00:12
782000 -- [-450.590] (-450.699) (-451.230) (-451.307) * (-451.406) [-450.054] (-456.501) (-450.903) -- 0:00:12
782500 -- (-453.931) [-451.357] (-452.096) (-450.763) * (-451.222) (-450.822) (-455.926) [-450.811] -- 0:00:12
783000 -- (-450.529) [-450.363] (-451.901) (-451.540) * (-451.474) [-454.245] (-449.774) (-451.575) -- 0:00:12
783500 -- (-451.236) (-449.482) (-454.618) [-450.128] * (-451.107) (-451.834) [-449.760] (-453.301) -- 0:00:12
784000 -- (-457.604) [-449.936] (-456.441) (-453.435) * (-452.505) (-454.478) (-455.054) [-451.538] -- 0:00:12
784500 -- (-455.985) [-450.029] (-456.682) (-450.046) * (-450.617) (-451.623) (-451.169) [-449.683] -- 0:00:12
785000 -- (-452.966) (-451.591) [-452.832] (-449.704) * (-451.546) (-450.721) (-452.851) [-449.464] -- 0:00:12
Average standard deviation of split frequencies: 0.007037
785500 -- (-449.949) (-449.350) [-450.995] (-452.916) * (-453.481) (-451.999) [-452.826] (-450.094) -- 0:00:12
786000 -- (-451.369) (-449.211) [-452.394] (-451.239) * (-451.239) [-453.612] (-449.780) (-454.402) -- 0:00:12
786500 -- (-450.666) [-449.086] (-455.260) (-450.887) * [-449.979] (-452.003) (-451.108) (-453.552) -- 0:00:12
787000 -- (-452.102) (-449.431) [-452.888] (-450.477) * [-449.946] (-453.897) (-453.706) (-453.149) -- 0:00:12
787500 -- [-450.747] (-451.343) (-455.850) (-452.639) * (-449.519) (-454.026) [-450.190] (-451.064) -- 0:00:12
788000 -- (-454.008) (-451.194) (-451.345) [-450.813] * (-452.238) (-455.100) [-449.614] (-450.499) -- 0:00:12
788500 -- (-455.145) (-451.544) [-450.967] (-449.697) * [-449.825] (-451.890) (-453.611) (-449.275) -- 0:00:12
789000 -- (-450.930) [-452.000] (-453.633) (-449.697) * (-449.727) [-451.680] (-451.177) (-452.963) -- 0:00:12
789500 -- (-454.754) (-454.509) [-453.399] (-450.587) * (-449.743) [-450.980] (-453.768) (-453.466) -- 0:00:12
790000 -- [-449.410] (-452.479) (-451.519) (-451.497) * (-450.415) (-450.942) (-452.439) [-451.925] -- 0:00:12
Average standard deviation of split frequencies: 0.006558
790500 -- (-450.806) (-453.961) (-450.521) [-451.233] * (-450.798) [-450.226] (-452.006) (-454.368) -- 0:00:12
791000 -- [-452.965] (-451.179) (-450.605) (-450.268) * (-449.716) (-453.554) [-452.007] (-458.367) -- 0:00:12
791500 -- (-451.530) [-451.777] (-450.018) (-454.371) * [-450.346] (-452.942) (-449.943) (-456.960) -- 0:00:12
792000 -- (-450.525) (-451.725) [-452.966] (-456.948) * (-451.856) [-453.195] (-452.365) (-454.277) -- 0:00:12
792500 -- (-451.624) (-450.919) [-453.132] (-450.574) * (-450.677) (-458.588) (-454.169) [-453.018] -- 0:00:12
793000 -- (-453.011) (-451.967) (-454.223) [-449.993] * [-449.667] (-451.776) (-450.366) (-454.349) -- 0:00:12
793500 -- (-452.869) [-452.962] (-450.920) (-451.819) * [-450.000] (-450.512) (-455.536) (-450.147) -- 0:00:12
794000 -- (-451.194) (-451.102) [-454.265] (-451.649) * [-451.980] (-451.154) (-450.985) (-450.014) -- 0:00:12
794500 -- (-452.382) (-453.576) [-452.306] (-453.030) * [-451.792] (-452.059) (-451.745) (-452.081) -- 0:00:12
795000 -- (-449.797) (-450.674) [-450.475] (-449.881) * (-450.461) (-453.827) [-455.233] (-452.971) -- 0:00:12
Average standard deviation of split frequencies: 0.006593
795500 -- (-450.264) (-451.261) [-451.795] (-450.522) * (-451.160) (-452.653) [-451.480] (-451.860) -- 0:00:12
796000 -- (-449.371) (-450.669) (-452.229) [-451.462] * [-452.929] (-451.647) (-450.941) (-451.374) -- 0:00:12
796500 -- (-450.880) [-451.253] (-451.828) (-452.368) * (-456.026) (-451.147) (-451.550) [-452.086] -- 0:00:12
797000 -- (-450.897) (-451.490) [-451.372] (-450.369) * (-449.859) (-453.250) [-450.261] (-450.582) -- 0:00:11
797500 -- (-450.193) (-450.390) (-451.955) [-452.726] * (-450.162) (-456.775) [-451.274] (-451.484) -- 0:00:11
798000 -- [-449.878] (-452.744) (-453.863) (-449.888) * [-450.161] (-451.172) (-449.817) (-452.037) -- 0:00:11
798500 -- (-451.934) (-454.253) (-449.969) [-450.039] * (-451.022) (-450.552) (-449.609) [-451.719] -- 0:00:11
799000 -- [-453.534] (-450.961) (-450.412) (-452.281) * [-452.854] (-452.977) (-451.837) (-450.268) -- 0:00:11
799500 -- [-449.509] (-450.247) (-450.911) (-452.392) * (-451.241) (-449.823) (-450.847) [-451.336] -- 0:00:11
800000 -- (-452.678) (-450.137) (-452.403) [-452.465] * (-454.933) [-450.870] (-450.127) (-449.821) -- 0:00:11
Average standard deviation of split frequencies: 0.006594
800500 -- (-450.844) [-450.558] (-458.519) (-451.626) * [-451.664] (-452.249) (-449.684) (-453.383) -- 0:00:11
801000 -- (-451.926) [-450.785] (-450.452) (-450.969) * (-456.793) (-458.864) [-451.691] (-452.369) -- 0:00:11
801500 -- [-450.601] (-452.998) (-456.266) (-452.198) * [-453.049] (-450.698) (-451.019) (-454.907) -- 0:00:11
802000 -- [-449.218] (-452.941) (-452.064) (-450.843) * [-450.415] (-458.265) (-451.491) (-456.146) -- 0:00:11
802500 -- (-449.372) (-451.346) (-450.356) [-451.013] * (-452.654) (-451.894) (-450.999) [-454.186] -- 0:00:11
803000 -- [-449.595] (-450.812) (-452.006) (-449.429) * (-453.407) (-449.648) [-450.095] (-453.313) -- 0:00:11
803500 -- (-450.302) (-450.762) [-452.306] (-450.604) * (-452.840) (-451.754) [-449.822] (-451.158) -- 0:00:11
804000 -- (-453.704) [-449.763] (-452.457) (-450.303) * (-452.553) [-451.959] (-450.074) (-451.651) -- 0:00:11
804500 -- (-452.530) [-453.921] (-450.274) (-455.103) * (-453.537) (-450.402) (-453.456) [-450.771] -- 0:00:11
805000 -- (-450.940) [-452.688] (-454.075) (-450.496) * (-455.102) [-453.682] (-449.939) (-451.610) -- 0:00:11
Average standard deviation of split frequencies: 0.006979
805500 -- (-450.846) [-451.000] (-451.276) (-451.629) * (-450.264) [-452.304] (-450.573) (-458.268) -- 0:00:11
806000 -- [-450.938] (-449.791) (-453.606) (-449.719) * (-451.257) [-450.493] (-451.253) (-457.583) -- 0:00:11
806500 -- [-450.871] (-452.333) (-451.037) (-452.476) * [-451.663] (-449.687) (-450.669) (-451.471) -- 0:00:11
807000 -- (-451.054) (-449.858) (-452.247) [-449.726] * (-452.774) (-449.290) [-450.429] (-455.406) -- 0:00:11
807500 -- (-449.963) [-452.240] (-454.717) (-449.159) * (-450.385) (-449.820) [-452.275] (-451.400) -- 0:00:11
808000 -- [-451.391] (-450.456) (-451.733) (-452.883) * (-452.088) [-451.908] (-451.880) (-453.273) -- 0:00:11
808500 -- (-451.032) (-451.574) [-451.842] (-451.732) * (-453.757) (-451.196) (-451.366) [-451.475] -- 0:00:11
809000 -- (-451.716) (-451.478) (-450.960) [-456.142] * (-450.695) (-450.821) [-451.930] (-453.070) -- 0:00:11
809500 -- (-452.214) [-452.512] (-453.081) (-450.008) * (-450.828) (-453.204) [-453.211] (-452.065) -- 0:00:11
810000 -- (-457.172) (-450.731) (-453.938) [-450.148] * [-451.019] (-454.227) (-454.459) (-450.953) -- 0:00:11
Average standard deviation of split frequencies: 0.006784
810500 -- (-454.516) [-449.421] (-453.446) (-451.664) * (-450.608) (-458.706) (-451.963) [-451.293] -- 0:00:11
811000 -- (-451.507) [-449.992] (-452.430) (-452.468) * (-450.407) (-456.949) (-451.886) [-449.450] -- 0:00:11
811500 -- [-451.309] (-453.500) (-454.626) (-454.688) * (-450.078) [-450.626] (-450.670) (-450.341) -- 0:00:11
812000 -- (-452.933) (-452.951) [-455.668] (-450.831) * (-450.405) (-455.640) (-451.294) [-451.397] -- 0:00:11
812500 -- [-451.714] (-451.796) (-453.229) (-451.694) * (-452.028) [-450.395] (-451.273) (-453.004) -- 0:00:11
813000 -- [-452.150] (-453.580) (-451.760) (-449.815) * (-452.826) [-449.641] (-449.976) (-454.753) -- 0:00:11
813500 -- (-452.482) (-453.279) (-450.763) [-450.424] * [-450.505] (-449.662) (-453.107) (-456.476) -- 0:00:11
814000 -- (-451.454) [-455.420] (-451.419) (-449.807) * (-450.557) [-452.651] (-450.926) (-455.853) -- 0:00:10
814500 -- (-451.833) (-453.334) [-450.378] (-454.429) * (-451.033) [-451.027] (-450.905) (-452.989) -- 0:00:10
815000 -- (-451.809) (-450.404) [-453.898] (-451.898) * [-450.137] (-452.984) (-454.548) (-451.591) -- 0:00:10
Average standard deviation of split frequencies: 0.007202
815500 -- (-454.687) [-449.859] (-450.071) (-452.833) * (-452.564) [-452.170] (-454.766) (-450.406) -- 0:00:10
816000 -- [-453.793] (-456.626) (-451.816) (-452.751) * (-454.978) (-450.753) [-449.966] (-449.760) -- 0:00:10
816500 -- (-453.683) (-457.022) [-450.405] (-451.713) * (-452.038) (-451.412) (-449.611) [-452.841] -- 0:00:10
817000 -- (-452.792) [-452.265] (-454.370) (-450.871) * (-453.094) [-454.444] (-449.893) (-452.508) -- 0:00:10
817500 -- (-453.936) [-451.867] (-455.711) (-450.130) * [-449.501] (-449.806) (-450.305) (-451.483) -- 0:00:10
818000 -- (-449.856) (-450.034) (-452.718) [-454.794] * (-453.156) [-449.605] (-451.525) (-450.005) -- 0:00:10
818500 -- (-449.260) [-451.875] (-450.734) (-451.748) * (-453.278) [-449.631] (-456.912) (-452.535) -- 0:00:10
819000 -- (-449.700) (-450.588) (-451.194) [-451.318] * [-450.560] (-450.889) (-452.295) (-450.679) -- 0:00:10
819500 -- (-449.822) [-451.556] (-452.925) (-452.533) * [-450.481] (-450.119) (-449.719) (-453.538) -- 0:00:10
820000 -- [-450.575] (-452.661) (-453.229) (-451.018) * (-450.119) [-451.425] (-450.104) (-450.737) -- 0:00:10
Average standard deviation of split frequencies: 0.007391
820500 -- (-449.482) (-454.016) [-449.763] (-451.966) * (-449.466) (-452.771) (-450.906) [-452.285] -- 0:00:10
821000 -- [-454.023] (-455.149) (-450.555) (-454.425) * [-451.239] (-451.181) (-450.969) (-454.869) -- 0:00:10
821500 -- (-450.684) (-453.632) (-449.447) [-450.607] * [-450.521] (-451.240) (-450.188) (-452.468) -- 0:00:10
822000 -- [-451.353] (-453.966) (-449.696) (-453.894) * (-450.594) [-450.576] (-458.852) (-451.795) -- 0:00:10
822500 -- (-451.740) (-451.940) [-450.222] (-450.713) * [-450.174] (-450.255) (-451.277) (-452.937) -- 0:00:10
823000 -- (-451.737) (-451.480) (-454.782) [-451.003] * [-452.773] (-451.143) (-453.584) (-454.460) -- 0:00:10
823500 -- (-453.484) (-455.666) (-451.734) [-450.008] * (-451.137) (-450.521) [-450.332] (-456.742) -- 0:00:10
824000 -- [-453.453] (-451.736) (-450.039) (-449.986) * [-450.667] (-449.723) (-449.908) (-456.479) -- 0:00:10
824500 -- (-454.907) (-452.659) [-451.585] (-454.809) * (-451.140) (-451.770) [-452.735] (-452.815) -- 0:00:10
825000 -- (-453.186) [-451.953] (-451.556) (-454.012) * (-451.221) (-451.252) (-455.702) [-452.075] -- 0:00:10
Average standard deviation of split frequencies: 0.006620
825500 -- (-454.722) (-454.902) [-451.128] (-450.677) * [-451.897] (-452.261) (-453.943) (-452.050) -- 0:00:10
826000 -- [-450.830] (-452.132) (-451.378) (-450.345) * (-452.747) [-449.388] (-452.241) (-456.181) -- 0:00:10
826500 -- (-452.878) [-455.101] (-454.098) (-450.385) * (-449.823) (-451.893) (-452.720) [-452.131] -- 0:00:10
827000 -- (-454.769) (-450.455) [-450.310] (-452.074) * [-451.551] (-449.916) (-450.323) (-450.236) -- 0:00:10
827500 -- (-452.683) (-451.874) [-450.460] (-453.029) * (-451.086) (-452.330) (-450.990) [-454.150] -- 0:00:10
828000 -- [-450.913] (-453.063) (-452.958) (-456.476) * (-451.044) (-452.771) (-451.653) [-450.138] -- 0:00:10
828500 -- (-449.773) [-449.620] (-454.686) (-451.952) * [-451.863] (-454.673) (-451.651) (-451.394) -- 0:00:10
829000 -- (-450.870) [-450.711] (-452.787) (-451.123) * (-450.352) [-451.418] (-451.726) (-450.930) -- 0:00:10
829500 -- (-450.503) [-450.179] (-453.869) (-451.923) * (-449.966) [-450.506] (-452.771) (-450.037) -- 0:00:10
830000 -- (-450.039) (-450.083) [-451.601] (-452.956) * (-455.752) [-450.776] (-452.917) (-456.019) -- 0:00:10
Average standard deviation of split frequencies: 0.006734
830500 -- [-451.485] (-452.167) (-451.004) (-450.727) * [-450.254] (-454.200) (-449.408) (-452.604) -- 0:00:10
831000 -- (-450.120) [-450.925] (-450.413) (-451.003) * (-449.803) [-452.278] (-451.814) (-452.148) -- 0:00:09
831500 -- (-449.359) (-450.236) (-452.361) [-452.584] * [-450.530] (-451.645) (-450.349) (-453.123) -- 0:00:09
832000 -- (-451.373) (-449.718) [-451.503] (-450.441) * (-450.596) (-451.728) [-449.899] (-451.790) -- 0:00:09
832500 -- (-449.998) (-451.460) [-450.929] (-450.966) * [-449.930] (-452.107) (-450.996) (-452.857) -- 0:00:09
833000 -- (-451.801) [-451.405] (-450.399) (-451.173) * (-449.481) [-458.309] (-450.666) (-453.919) -- 0:00:09
833500 -- (-449.997) (-450.300) [-450.343] (-450.405) * (-451.630) (-453.474) (-452.276) [-450.575] -- 0:00:09
834000 -- (-449.502) (-450.960) (-455.686) [-451.860] * (-451.773) [-449.763] (-454.401) (-455.254) -- 0:00:09
834500 -- (-449.925) [-450.735] (-449.710) (-450.779) * (-453.187) (-451.071) (-453.299) [-451.277] -- 0:00:09
835000 -- [-452.182] (-453.728) (-449.210) (-451.302) * [-455.998] (-451.729) (-451.915) (-449.451) -- 0:00:09
Average standard deviation of split frequencies: 0.006992
835500 -- (-455.296) [-452.470] (-451.473) (-451.050) * (-451.042) (-453.173) (-450.459) [-452.107] -- 0:00:09
836000 -- [-451.580] (-451.775) (-451.241) (-450.084) * (-451.514) [-454.458] (-449.978) (-450.872) -- 0:00:09
836500 -- (-453.008) [-454.201] (-450.396) (-451.288) * (-451.154) (-452.390) (-449.289) [-451.642] -- 0:00:09
837000 -- (-450.406) (-450.948) (-450.844) [-451.098] * [-451.076] (-452.434) (-450.637) (-452.264) -- 0:00:09
837500 -- (-449.852) [-453.342] (-449.617) (-450.006) * (-450.310) [-455.209] (-449.942) (-453.825) -- 0:00:09
838000 -- [-450.320] (-451.884) (-455.222) (-452.356) * [-452.222] (-449.488) (-450.484) (-449.973) -- 0:00:09
838500 -- (-452.349) (-452.777) (-452.491) [-450.239] * (-451.136) (-450.415) (-451.330) [-449.402] -- 0:00:09
839000 -- [-452.022] (-452.537) (-453.247) (-453.171) * (-451.003) (-454.546) (-455.110) [-452.227] -- 0:00:09
839500 -- (-450.816) (-454.418) [-451.415] (-453.086) * (-450.190) (-449.320) (-455.869) [-453.750] -- 0:00:09
840000 -- (-450.592) [-452.149] (-451.651) (-450.811) * (-453.103) [-454.470] (-453.453) (-450.353) -- 0:00:09
Average standard deviation of split frequencies: 0.006991
840500 -- (-450.125) (-451.646) (-452.788) [-452.087] * (-451.111) [-450.392] (-455.999) (-453.426) -- 0:00:09
841000 -- (-449.795) (-454.342) (-451.351) [-450.899] * [-450.206] (-451.094) (-459.209) (-450.855) -- 0:00:09
841500 -- (-450.940) (-452.876) (-455.420) [-454.126] * (-452.277) (-450.858) [-452.461] (-451.287) -- 0:00:09
842000 -- (-450.202) (-451.760) (-450.304) [-450.031] * [-451.282] (-451.770) (-452.632) (-450.165) -- 0:00:09
842500 -- (-449.648) (-449.823) (-449.767) [-451.835] * (-449.573) [-450.734] (-450.576) (-454.240) -- 0:00:09
843000 -- (-450.642) (-450.158) (-452.441) [-452.233] * (-449.608) [-450.559] (-450.930) (-453.933) -- 0:00:09
843500 -- (-453.962) (-450.714) (-452.420) [-450.729] * [-449.832] (-455.921) (-450.705) (-450.512) -- 0:00:09
844000 -- [-450.060] (-449.444) (-450.685) (-450.226) * (-450.466) [-451.445] (-454.874) (-451.643) -- 0:00:09
844500 -- (-454.572) [-449.896] (-453.227) (-452.419) * (-451.908) [-452.329] (-452.797) (-451.173) -- 0:00:09
845000 -- (-458.011) [-450.410] (-452.787) (-455.295) * (-452.279) (-450.605) [-451.090] (-451.564) -- 0:00:09
Average standard deviation of split frequencies: 0.006835
845500 -- (-452.240) [-451.079] (-452.811) (-449.954) * (-451.000) [-449.641] (-450.121) (-452.151) -- 0:00:09
846000 -- (-450.457) [-451.214] (-451.133) (-451.491) * (-450.958) (-450.862) [-450.061] (-451.801) -- 0:00:09
846500 -- (-452.196) (-451.860) [-452.619] (-453.570) * (-451.364) (-451.097) [-450.235] (-454.222) -- 0:00:09
847000 -- (-452.401) (-450.313) (-449.951) [-450.768] * (-449.906) [-455.097] (-450.715) (-454.579) -- 0:00:09
847500 -- [-449.723] (-451.337) (-450.313) (-453.335) * (-461.012) (-454.728) [-450.629] (-455.277) -- 0:00:08
848000 -- (-452.735) [-450.943] (-450.412) (-451.713) * (-453.838) [-449.983] (-450.398) (-451.734) -- 0:00:08
848500 -- (-450.934) (-453.537) [-449.865] (-451.486) * (-452.499) [-450.288] (-450.191) (-453.230) -- 0:00:08
849000 -- [-453.030] (-450.561) (-450.872) (-450.989) * [-453.807] (-451.084) (-450.439) (-457.728) -- 0:00:08
849500 -- [-452.589] (-450.690) (-450.017) (-453.900) * (-450.329) [-452.301] (-450.242) (-452.682) -- 0:00:08
850000 -- [-452.869] (-453.577) (-450.107) (-451.791) * (-451.190) (-455.076) [-450.040] (-451.040) -- 0:00:08
Average standard deviation of split frequencies: 0.006835
850500 -- [-450.928] (-453.565) (-451.405) (-449.931) * (-450.045) [-450.020] (-451.995) (-450.502) -- 0:00:08
851000 -- (-451.655) (-453.541) [-450.276] (-450.305) * (-450.417) (-451.360) (-453.625) [-450.128] -- 0:00:08
851500 -- (-451.437) (-451.764) (-452.460) [-449.283] * (-455.377) (-449.935) (-452.564) [-450.194] -- 0:00:08
852000 -- (-450.757) (-450.382) (-449.587) [-449.253] * (-451.951) (-452.696) [-453.535] (-452.807) -- 0:00:08
852500 -- (-453.203) (-451.775) (-457.686) [-452.011] * (-451.711) (-451.934) [-451.145] (-453.621) -- 0:00:08
853000 -- (-453.087) [-452.210] (-451.780) (-453.535) * (-449.890) [-449.904] (-450.790) (-453.646) -- 0:00:08
853500 -- (-455.925) (-452.118) (-451.168) [-452.570] * (-452.391) (-453.026) [-450.234] (-452.513) -- 0:00:08
854000 -- (-450.981) (-454.219) (-451.418) [-451.957] * (-452.411) (-453.651) [-450.515] (-455.473) -- 0:00:08
854500 -- (-453.760) [-452.933] (-451.212) (-450.719) * (-453.136) (-450.193) [-449.841] (-458.723) -- 0:00:08
855000 -- (-453.971) (-450.754) [-451.704] (-450.675) * (-452.918) (-450.188) [-449.604] (-450.342) -- 0:00:08
Average standard deviation of split frequencies: 0.006976
855500 -- [-454.138] (-450.406) (-451.377) (-449.926) * (-451.610) [-449.702] (-449.699) (-452.029) -- 0:00:08
856000 -- (-458.403) [-449.947] (-453.679) (-452.413) * [-451.307] (-452.481) (-451.319) (-452.481) -- 0:00:08
856500 -- [-457.780] (-451.415) (-452.154) (-452.816) * (-451.229) (-449.720) (-449.379) [-449.819] -- 0:00:08
857000 -- (-450.900) [-450.667] (-453.436) (-455.355) * (-452.631) (-450.182) (-449.442) [-451.254] -- 0:00:08
857500 -- (-451.538) [-452.580] (-454.731) (-449.466) * (-450.531) [-450.337] (-449.897) (-451.331) -- 0:00:08
858000 -- [-449.244] (-450.914) (-451.389) (-453.230) * (-450.818) [-452.605] (-452.983) (-451.482) -- 0:00:08
858500 -- (-449.991) (-450.026) (-454.179) [-450.930] * [-450.840] (-449.622) (-454.220) (-449.604) -- 0:00:08
859000 -- (-450.771) [-449.851] (-453.546) (-456.120) * [-450.480] (-453.508) (-450.456) (-449.762) -- 0:00:08
859500 -- (-450.579) [-451.397] (-451.019) (-454.968) * [-451.726] (-449.854) (-452.957) (-451.701) -- 0:00:08
860000 -- (-451.959) (-452.194) (-450.845) [-453.917] * (-455.864) (-451.572) (-451.881) [-453.796] -- 0:00:08
Average standard deviation of split frequencies: 0.007120
860500 -- [-449.654] (-450.670) (-452.986) (-453.293) * [-452.491] (-450.473) (-450.418) (-452.111) -- 0:00:08
861000 -- (-452.240) (-451.384) (-451.619) [-456.841] * (-452.022) (-451.135) [-451.016] (-452.116) -- 0:00:08
861500 -- (-450.711) (-450.700) (-450.798) [-449.336] * [-450.575] (-449.688) (-452.646) (-451.451) -- 0:00:08
862000 -- (-449.747) (-452.680) (-451.761) [-451.493] * (-451.758) (-453.028) [-451.165] (-452.644) -- 0:00:08
862500 -- (-452.467) (-451.142) [-450.418] (-451.038) * [-454.927] (-453.542) (-450.589) (-450.898) -- 0:00:08
863000 -- (-452.915) [-453.471] (-452.318) (-455.816) * (-452.618) (-451.105) [-452.107] (-452.537) -- 0:00:08
863500 -- (-451.652) [-451.411] (-453.371) (-449.840) * [-451.281] (-452.919) (-450.875) (-453.717) -- 0:00:08
864000 -- (-451.417) [-450.636] (-455.474) (-451.410) * (-452.491) (-451.632) [-450.612] (-449.791) -- 0:00:08
864500 -- (-451.107) (-453.057) (-453.436) [-450.904] * (-450.803) (-452.903) (-450.950) [-449.752] -- 0:00:07
865000 -- (-452.498) [-451.729] (-451.386) (-453.054) * (-450.476) [-454.168] (-453.528) (-450.646) -- 0:00:07
Average standard deviation of split frequencies: 0.007040
865500 -- (-455.371) [-449.966] (-453.670) (-450.146) * (-451.416) (-454.337) [-450.033] (-449.852) -- 0:00:07
866000 -- (-452.334) (-452.146) (-451.946) [-450.601] * (-452.883) (-454.448) (-451.588) [-451.343] -- 0:00:07
866500 -- (-452.984) (-455.106) [-453.137] (-454.158) * (-453.031) [-451.453] (-450.449) (-450.796) -- 0:00:07
867000 -- (-452.700) [-450.014] (-451.259) (-452.768) * (-452.241) [-450.300] (-451.353) (-452.224) -- 0:00:07
867500 -- (-450.499) [-449.864] (-451.312) (-450.810) * (-452.877) (-449.795) (-451.371) [-449.646] -- 0:00:07
868000 -- (-453.226) [-450.578] (-455.313) (-456.106) * (-451.061) (-449.946) [-452.114] (-449.470) -- 0:00:07
868500 -- (-454.441) (-451.906) [-453.254] (-453.289) * (-450.649) [-449.627] (-450.243) (-450.764) -- 0:00:07
869000 -- (-452.698) (-454.480) [-453.577] (-451.506) * (-454.865) (-453.897) [-450.299] (-451.308) -- 0:00:07
869500 -- [-452.911] (-450.637) (-452.004) (-452.847) * [-451.250] (-453.456) (-452.109) (-450.801) -- 0:00:07
870000 -- [-454.449] (-450.750) (-453.265) (-450.233) * (-452.830) [-454.537] (-449.928) (-453.999) -- 0:00:07
Average standard deviation of split frequencies: 0.007075
870500 -- (-458.647) [-450.419] (-450.280) (-449.800) * [-452.982] (-451.174) (-449.979) (-451.557) -- 0:00:07
871000 -- (-450.865) (-453.488) (-457.497) [-449.846] * [-450.701] (-450.856) (-451.993) (-452.214) -- 0:00:07
871500 -- (-450.971) [-454.142] (-453.101) (-451.526) * (-449.884) (-449.768) [-453.792] (-450.131) -- 0:00:07
872000 -- (-450.133) (-453.265) (-453.101) [-453.054] * (-452.026) (-450.998) (-453.939) [-450.771] -- 0:00:07
872500 -- (-452.599) [-453.030] (-452.313) (-450.849) * (-454.089) [-452.853] (-453.166) (-453.142) -- 0:00:07
873000 -- [-451.340] (-450.350) (-453.184) (-450.332) * [-452.179] (-452.139) (-451.170) (-451.249) -- 0:00:07
873500 -- (-452.699) (-450.162) (-451.313) [-451.897] * (-451.416) (-454.120) (-451.973) [-450.042] -- 0:00:07
874000 -- (-452.045) (-451.946) [-452.699] (-456.367) * (-451.234) [-451.224] (-453.354) (-451.044) -- 0:00:07
874500 -- (-453.150) (-455.090) (-450.940) [-449.398] * (-451.516) [-452.678] (-453.556) (-450.856) -- 0:00:07
875000 -- (-449.506) (-450.359) [-452.105] (-451.951) * (-453.655) (-451.882) (-451.052) [-451.723] -- 0:00:07
Average standard deviation of split frequencies: 0.007103
875500 -- [-450.304] (-450.473) (-451.739) (-451.261) * (-453.308) [-451.351] (-451.783) (-453.483) -- 0:00:07
876000 -- (-449.945) [-451.989] (-452.254) (-450.968) * (-453.217) [-450.712] (-454.856) (-450.424) -- 0:00:07
876500 -- [-449.744] (-452.505) (-458.200) (-450.784) * (-453.724) (-452.007) (-453.532) [-450.965] -- 0:00:07
877000 -- [-455.891] (-451.273) (-452.961) (-450.318) * [-451.072] (-451.500) (-449.722) (-451.645) -- 0:00:07
877500 -- (-451.404) (-450.904) (-452.161) [-450.458] * (-452.598) (-452.029) [-451.792] (-452.613) -- 0:00:07
878000 -- [-451.884] (-451.601) (-449.698) (-451.839) * [-452.132] (-451.398) (-453.200) (-453.188) -- 0:00:07
878500 -- (-455.196) (-450.197) (-451.201) [-449.623] * [-452.870] (-451.927) (-449.788) (-452.975) -- 0:00:07
879000 -- (-452.942) [-450.100] (-451.798) (-449.827) * [-450.946] (-450.298) (-450.813) (-451.292) -- 0:00:07
879500 -- (-450.743) (-453.718) [-452.133] (-454.490) * (-450.031) [-450.921] (-450.522) (-451.016) -- 0:00:07
880000 -- (-449.953) (-450.483) (-454.228) [-451.788] * [-451.166] (-450.366) (-455.815) (-452.204) -- 0:00:07
Average standard deviation of split frequencies: 0.007387
880500 -- (-451.835) [-449.789] (-451.848) (-451.361) * (-450.017) (-451.405) [-453.493] (-453.247) -- 0:00:07
881000 -- (-451.557) (-452.543) [-452.858] (-453.528) * (-450.456) [-453.964] (-451.368) (-450.279) -- 0:00:07
881500 -- (-449.370) (-453.064) (-449.358) [-449.691] * (-452.342) [-451.810] (-454.467) (-453.772) -- 0:00:06
882000 -- (-452.677) (-452.167) (-449.375) [-450.585] * (-451.358) [-450.831] (-451.437) (-449.786) -- 0:00:06
882500 -- (-452.275) (-451.095) [-452.303] (-450.018) * (-450.898) (-450.443) (-450.798) [-449.268] -- 0:00:06
883000 -- (-449.587) (-451.711) (-451.875) [-450.254] * (-450.429) [-450.702] (-451.676) (-450.549) -- 0:00:06
883500 -- [-450.704] (-449.783) (-450.370) (-455.065) * (-455.766) (-451.435) (-451.917) [-449.627] -- 0:00:06
884000 -- [-452.705] (-450.765) (-449.456) (-455.366) * [-453.183] (-450.968) (-456.054) (-449.900) -- 0:00:06
884500 -- (-453.154) (-449.885) [-449.538] (-453.010) * (-452.152) (-450.290) (-454.036) [-450.963] -- 0:00:06
885000 -- (-450.802) (-449.801) (-451.800) [-450.625] * (-454.132) [-451.803] (-455.878) (-449.221) -- 0:00:06
Average standard deviation of split frequencies: 0.008081
885500 -- (-450.540) (-449.905) [-450.272] (-452.304) * (-453.895) (-449.637) [-451.427] (-451.359) -- 0:00:06
886000 -- (-452.127) (-451.111) (-450.444) [-451.261] * (-452.061) [-450.239] (-451.113) (-454.166) -- 0:00:06
886500 -- (-456.174) (-452.951) [-450.633] (-449.207) * (-450.441) (-450.047) (-452.793) [-452.040] -- 0:00:06
887000 -- [-452.098] (-452.639) (-452.013) (-453.082) * [-450.046] (-451.494) (-452.525) (-450.384) -- 0:00:06
887500 -- [-452.673] (-453.838) (-453.944) (-450.698) * [-450.301] (-451.077) (-449.914) (-453.569) -- 0:00:06
888000 -- [-451.754] (-451.286) (-452.877) (-451.204) * (-449.823) (-452.559) [-449.508] (-456.241) -- 0:00:06
888500 -- (-453.590) (-450.062) [-449.870] (-451.198) * [-449.595] (-454.718) (-449.493) (-453.286) -- 0:00:06
889000 -- (-452.456) (-450.232) [-450.274] (-450.511) * (-450.204) (-451.758) [-450.713] (-453.722) -- 0:00:06
889500 -- (-452.926) [-453.775] (-456.742) (-451.910) * [-451.029] (-450.418) (-451.822) (-451.971) -- 0:00:06
890000 -- (-450.859) [-451.963] (-453.307) (-450.839) * (-454.404) [-456.213] (-450.860) (-453.251) -- 0:00:06
Average standard deviation of split frequencies: 0.008369
890500 -- [-450.747] (-451.155) (-452.898) (-450.174) * (-450.943) (-456.904) (-452.472) [-452.819] -- 0:00:06
891000 -- (-451.655) (-451.410) [-451.381] (-450.392) * (-451.500) (-450.950) (-454.645) [-451.239] -- 0:00:06
891500 -- [-453.079] (-451.760) (-450.970) (-451.019) * (-450.511) (-450.662) [-450.686] (-451.878) -- 0:00:06
892000 -- (-452.049) [-452.134] (-454.625) (-451.047) * (-449.936) (-449.149) (-452.050) [-450.293] -- 0:00:06
892500 -- (-453.631) [-451.290] (-450.677) (-450.994) * [-450.411] (-450.479) (-450.563) (-451.271) -- 0:00:06
893000 -- [-452.721] (-451.117) (-451.304) (-450.993) * [-452.519] (-453.396) (-450.706) (-455.128) -- 0:00:06
893500 -- (-452.403) [-454.629] (-452.349) (-453.726) * (-456.435) [-452.808] (-454.271) (-452.553) -- 0:00:06
894000 -- (-453.669) [-449.647] (-452.331) (-451.419) * (-449.822) (-451.633) [-454.867] (-451.894) -- 0:00:06
894500 -- (-454.574) (-452.249) (-451.359) [-451.366] * [-452.700] (-452.828) (-450.425) (-449.540) -- 0:00:06
895000 -- (-452.948) (-454.989) (-450.224) [-451.595] * (-452.506) (-452.087) (-453.634) [-451.744] -- 0:00:06
Average standard deviation of split frequencies: 0.007927
895500 -- [-452.536] (-453.014) (-453.681) (-450.735) * (-450.940) [-450.404] (-453.352) (-449.269) -- 0:00:06
896000 -- [-452.121] (-450.978) (-451.527) (-450.697) * (-449.989) (-453.075) [-453.575] (-453.507) -- 0:00:06
896500 -- (-450.421) [-451.329] (-451.891) (-452.121) * (-450.215) (-451.653) (-451.773) [-456.213] -- 0:00:06
897000 -- (-450.954) (-450.699) [-451.151] (-450.574) * (-450.322) (-455.412) [-450.942] (-451.522) -- 0:00:06
897500 -- (-451.112) (-451.997) [-452.746] (-450.783) * [-450.869] (-452.753) (-450.751) (-449.544) -- 0:00:06
898000 -- (-451.109) (-453.661) [-450.016] (-451.002) * (-451.569) (-451.293) [-452.589] (-451.095) -- 0:00:06
898500 -- [-451.535] (-451.834) (-450.794) (-451.399) * (-449.837) [-451.026] (-454.534) (-454.226) -- 0:00:05
899000 -- (-453.828) (-450.906) [-451.265] (-450.282) * [-450.201] (-451.391) (-452.737) (-454.725) -- 0:00:05
899500 -- (-450.547) [-451.280] (-456.034) (-450.814) * (-452.070) (-450.967) (-455.737) [-449.920] -- 0:00:05
900000 -- (-451.295) (-449.630) [-457.795] (-453.392) * (-451.733) (-452.213) [-451.218] (-450.620) -- 0:00:05
Average standard deviation of split frequencies: 0.008505
900500 -- (-449.569) (-449.892) [-457.073] (-452.389) * (-452.584) [-451.458] (-454.863) (-450.453) -- 0:00:05
901000 -- (-450.681) [-449.891] (-450.600) (-452.527) * [-451.818] (-451.712) (-451.216) (-450.918) -- 0:00:05
901500 -- (-450.282) (-450.755) (-452.555) [-449.622] * [-450.595] (-451.899) (-450.574) (-453.231) -- 0:00:05
902000 -- (-451.003) [-451.657] (-455.486) (-454.771) * (-450.484) [-450.993] (-450.983) (-451.261) -- 0:00:05
902500 -- (-454.422) (-451.019) (-452.057) [-454.497] * (-450.349) [-450.413] (-450.262) (-453.287) -- 0:00:05
903000 -- (-450.313) [-449.709] (-450.681) (-457.514) * (-452.083) (-450.325) [-450.597] (-452.853) -- 0:00:05
903500 -- [-451.065] (-454.281) (-452.591) (-451.261) * (-449.717) (-453.181) [-449.339] (-451.369) -- 0:00:05
904000 -- (-450.841) (-453.287) (-450.460) [-453.774] * (-450.402) (-451.251) (-449.825) [-454.807] -- 0:00:05
904500 -- (-451.535) [-453.281] (-450.815) (-453.440) * [-450.493] (-451.370) (-450.027) (-453.079) -- 0:00:05
905000 -- [-450.354] (-450.726) (-452.005) (-452.070) * (-450.472) [-453.950] (-450.414) (-452.205) -- 0:00:05
Average standard deviation of split frequencies: 0.008227
905500 -- (-449.416) [-450.493] (-452.561) (-450.470) * (-449.381) (-449.543) [-452.057] (-454.520) -- 0:00:05
906000 -- (-450.678) (-450.265) (-451.315) [-451.860] * (-451.340) (-450.348) (-455.280) [-452.348] -- 0:00:05
906500 -- (-451.369) (-451.473) [-449.889] (-449.948) * (-449.459) [-453.853] (-452.381) (-449.623) -- 0:00:05
907000 -- (-452.221) (-454.475) [-451.271] (-451.053) * (-449.809) (-452.254) (-452.082) [-450.309] -- 0:00:05
907500 -- [-452.242] (-450.510) (-450.322) (-451.499) * [-450.599] (-455.259) (-450.024) (-449.975) -- 0:00:05
908000 -- [-450.022] (-450.657) (-450.791) (-452.103) * [-450.319] (-454.153) (-452.564) (-449.332) -- 0:00:05
908500 -- (-452.540) (-450.894) [-451.769] (-454.146) * (-449.461) (-452.408) (-453.046) [-451.042] -- 0:00:05
909000 -- (-452.880) (-449.594) [-451.454] (-450.188) * (-454.793) (-450.802) [-452.175] (-450.696) -- 0:00:05
909500 -- (-452.709) [-450.141] (-450.104) (-451.013) * (-451.454) (-452.911) (-450.986) [-449.712] -- 0:00:05
910000 -- (-451.593) (-452.610) (-450.725) [-450.887] * (-452.099) (-450.460) (-450.403) [-451.307] -- 0:00:05
Average standard deviation of split frequencies: 0.007385
910500 -- (-450.926) (-451.614) (-453.646) [-449.426] * (-452.405) (-455.907) [-451.537] (-452.072) -- 0:00:05
911000 -- (-451.551) (-449.428) [-450.353] (-453.718) * (-450.621) [-451.261] (-450.829) (-453.983) -- 0:00:05
911500 -- (-451.000) (-450.733) [-450.985] (-455.590) * [-450.672] (-450.186) (-454.123) (-449.739) -- 0:00:05
912000 -- (-451.053) [-451.585] (-453.382) (-449.937) * (-449.935) (-456.266) (-451.712) [-449.458] -- 0:00:05
912500 -- [-450.324] (-452.164) (-452.095) (-454.238) * [-451.752] (-451.609) (-451.517) (-450.912) -- 0:00:05
913000 -- (-452.480) (-450.695) [-449.274] (-450.682) * (-449.890) [-453.021] (-452.159) (-453.284) -- 0:00:05
913500 -- [-451.658] (-452.319) (-452.064) (-454.337) * (-451.037) [-450.040] (-459.097) (-454.613) -- 0:00:05
914000 -- (-451.757) (-451.521) [-450.795] (-454.119) * [-450.462] (-449.533) (-452.525) (-452.634) -- 0:00:05
914500 -- (-451.629) (-450.399) (-450.024) [-451.268] * (-454.116) (-450.725) (-451.520) [-454.491] -- 0:00:05
915000 -- (-450.057) (-451.433) [-449.718] (-457.447) * (-451.037) [-452.660] (-452.055) (-451.151) -- 0:00:05
Average standard deviation of split frequencies: 0.006999
915500 -- (-452.069) (-456.193) (-453.287) [-453.238] * (-450.686) (-450.667) (-451.324) [-451.946] -- 0:00:04
916000 -- (-454.209) (-450.825) [-450.731] (-451.029) * (-451.849) (-455.110) (-451.252) [-451.819] -- 0:00:04
916500 -- (-449.809) (-452.982) [-451.687] (-451.415) * [-452.951] (-451.175) (-450.346) (-449.373) -- 0:00:04
917000 -- (-451.318) (-453.428) (-450.224) [-451.865] * [-451.640] (-449.265) (-451.185) (-450.054) -- 0:00:04
917500 -- (-452.230) (-453.597) [-452.286] (-454.168) * (-452.156) (-450.293) [-451.187] (-452.176) -- 0:00:04
918000 -- [-450.901] (-451.186) (-450.456) (-451.007) * (-451.969) (-452.088) [-452.404] (-450.846) -- 0:00:04
918500 -- [-450.302] (-451.385) (-451.539) (-451.224) * [-449.921] (-456.727) (-457.235) (-451.141) -- 0:00:04
919000 -- (-451.436) (-452.781) [-450.121] (-451.257) * (-451.094) (-456.762) (-457.076) [-450.526] -- 0:00:04
919500 -- (-452.579) [-453.330] (-450.070) (-452.755) * (-451.541) (-452.668) (-449.520) [-450.645] -- 0:00:04
920000 -- (-449.129) (-452.395) (-449.771) [-455.459] * (-453.160) [-452.311] (-453.013) (-450.689) -- 0:00:04
Average standard deviation of split frequencies: 0.006861
920500 -- (-451.179) (-452.139) (-452.903) [-452.205] * (-456.105) (-450.647) (-452.661) [-451.667] -- 0:00:04
921000 -- (-455.116) (-449.843) (-455.205) [-449.964] * (-451.182) [-451.464] (-450.647) (-450.031) -- 0:00:04
921500 -- (-452.294) [-450.951] (-451.981) (-450.598) * (-450.313) [-450.237] (-450.012) (-450.549) -- 0:00:04
922000 -- (-451.147) (-452.909) [-452.768] (-450.635) * (-450.627) (-451.166) (-449.498) [-453.261] -- 0:00:04
922500 -- (-453.084) [-454.562] (-453.276) (-450.302) * [-449.446] (-455.331) (-450.984) (-450.350) -- 0:00:04
923000 -- (-450.566) (-451.580) [-451.555] (-451.648) * (-450.563) [-450.568] (-454.623) (-452.987) -- 0:00:04
923500 -- (-449.710) (-451.999) (-451.944) [-452.435] * (-449.694) (-450.991) [-453.773] (-450.731) -- 0:00:04
924000 -- (-450.134) (-450.367) [-452.395] (-450.500) * [-449.971] (-450.242) (-450.968) (-450.520) -- 0:00:04
924500 -- [-451.726] (-451.557) (-452.614) (-450.358) * (-449.780) [-451.744] (-451.301) (-451.460) -- 0:00:04
925000 -- (-457.782) (-453.469) (-450.185) [-449.998] * (-450.447) (-450.765) [-450.642] (-450.378) -- 0:00:04
Average standard deviation of split frequencies: 0.006856
925500 -- (-449.536) [-451.051] (-451.345) (-453.447) * (-451.708) (-451.593) [-449.484] (-454.247) -- 0:00:04
926000 -- [-449.149] (-452.381) (-451.538) (-451.648) * (-450.440) (-452.873) [-450.978] (-451.197) -- 0:00:04
926500 -- (-449.273) (-454.811) [-453.120] (-451.662) * [-454.129] (-450.169) (-454.668) (-453.877) -- 0:00:04
927000 -- (-452.841) (-455.894) (-450.559) [-452.084] * (-454.807) (-450.601) (-452.732) [-450.287] -- 0:00:04
927500 -- (-452.837) (-452.787) [-452.729] (-452.353) * (-450.343) (-450.286) [-452.136] (-450.530) -- 0:00:04
928000 -- (-450.246) (-453.041) [-452.319] (-451.003) * (-449.179) [-451.888] (-454.441) (-451.324) -- 0:00:04
928500 -- (-449.783) [-452.424] (-450.901) (-456.694) * (-455.955) (-451.847) (-449.658) [-450.676] -- 0:00:04
929000 -- (-450.655) (-451.192) (-451.815) [-452.061] * (-451.114) (-454.684) (-451.524) [-451.832] -- 0:00:04
929500 -- (-452.796) (-450.035) (-452.119) [-449.840] * [-451.428] (-450.001) (-452.119) (-454.919) -- 0:00:04
930000 -- (-451.007) [-451.759] (-453.894) (-456.376) * [-457.148] (-450.986) (-453.108) (-449.532) -- 0:00:04
Average standard deviation of split frequencies: 0.007429
930500 -- [-449.585] (-451.151) (-453.875) (-449.511) * (-452.409) [-452.211] (-451.519) (-451.520) -- 0:00:04
931000 -- [-451.364] (-453.607) (-454.669) (-450.082) * (-456.894) (-453.484) (-452.292) [-451.042] -- 0:00:04
931500 -- [-451.567] (-451.996) (-458.273) (-452.077) * (-452.528) (-450.354) [-452.229] (-453.666) -- 0:00:04
932000 -- (-450.418) (-449.560) (-452.563) [-451.400] * [-450.998] (-449.373) (-452.405) (-451.340) -- 0:00:04
932500 -- (-451.163) (-455.018) (-450.132) [-455.258] * (-455.162) (-452.186) (-449.739) [-450.694] -- 0:00:03
933000 -- (-454.154) (-450.883) (-451.299) [-451.591] * (-452.641) [-450.960] (-449.605) (-450.882) -- 0:00:03
933500 -- (-450.303) (-450.220) [-450.116] (-452.327) * (-451.098) (-453.878) [-450.873] (-451.804) -- 0:00:03
934000 -- (-451.479) (-451.816) (-452.427) [-450.124] * (-452.795) (-450.827) (-453.538) [-451.426] -- 0:00:03
934500 -- [-452.311] (-452.106) (-453.504) (-449.974) * (-451.813) (-450.858) (-450.344) [-452.603] -- 0:00:03
935000 -- (-454.917) [-452.254] (-450.414) (-450.449) * [-453.122] (-461.312) (-451.711) (-456.539) -- 0:00:03
Average standard deviation of split frequencies: 0.007051
935500 -- (-450.004) [-451.892] (-449.733) (-455.340) * [-449.827] (-452.776) (-451.723) (-451.249) -- 0:00:03
936000 -- (-450.957) [-452.691] (-451.628) (-451.565) * (-455.073) [-449.256] (-450.240) (-453.066) -- 0:00:03
936500 -- (-451.205) (-451.116) (-450.032) [-452.196] * (-451.205) (-449.242) (-454.514) [-451.275] -- 0:00:03
937000 -- (-451.447) (-450.903) (-452.776) [-451.360] * (-453.644) [-452.996] (-451.067) (-454.662) -- 0:00:03
937500 -- [-453.964] (-451.684) (-454.214) (-451.078) * (-450.548) [-453.007] (-454.276) (-455.336) -- 0:00:03
938000 -- (-453.941) [-451.340] (-453.369) (-450.566) * (-455.997) [-452.836] (-451.039) (-455.551) -- 0:00:03
938500 -- (-452.440) (-453.849) [-452.970] (-450.600) * (-450.355) (-450.714) (-455.485) [-455.768] -- 0:00:03
939000 -- (-452.743) (-452.282) (-449.395) [-450.845] * [-451.474] (-451.486) (-451.881) (-451.761) -- 0:00:03
939500 -- (-453.849) (-452.431) (-450.187) [-451.239] * (-449.977) [-451.440] (-451.119) (-455.056) -- 0:00:03
940000 -- (-455.680) [-450.788] (-450.324) (-450.040) * [-449.971] (-451.885) (-449.277) (-452.143) -- 0:00:03
Average standard deviation of split frequencies: 0.007083
940500 -- [-451.106] (-450.927) (-450.452) (-450.532) * [-449.338] (-451.469) (-449.664) (-449.956) -- 0:00:03
941000 -- (-452.399) [-452.487] (-450.045) (-453.432) * (-450.421) [-453.308] (-450.896) (-450.133) -- 0:00:03
941500 -- (-450.494) (-451.019) [-453.610] (-451.820) * (-449.862) (-449.478) [-451.544] (-452.478) -- 0:00:03
942000 -- (-454.293) [-449.671] (-453.670) (-460.075) * (-457.528) [-453.841] (-452.319) (-451.537) -- 0:00:03
942500 -- (-457.954) (-452.266) (-453.742) [-456.903] * (-454.361) (-450.065) [-452.321] (-449.591) -- 0:00:03
943000 -- (-451.808) (-449.765) [-452.440] (-452.390) * (-450.348) (-453.256) (-451.169) [-453.606] -- 0:00:03
943500 -- [-451.060] (-450.521) (-452.689) (-451.952) * (-455.069) (-451.470) (-451.830) [-452.059] -- 0:00:03
944000 -- (-450.551) [-450.342] (-451.282) (-452.596) * (-450.207) (-451.610) (-456.692) [-451.321] -- 0:00:03
944500 -- (-450.696) (-451.916) (-453.322) [-452.069] * (-451.552) [-450.327] (-452.644) (-451.390) -- 0:00:03
945000 -- (-450.435) (-451.254) [-451.259] (-449.682) * (-451.093) [-450.569] (-456.302) (-450.480) -- 0:00:03
Average standard deviation of split frequencies: 0.007375
945500 -- (-450.720) (-452.921) (-452.527) [-449.554] * [-451.306] (-451.130) (-454.033) (-457.577) -- 0:00:03
946000 -- [-451.324] (-450.480) (-453.484) (-449.888) * (-452.383) (-451.860) (-453.293) [-452.143] -- 0:00:03
946500 -- [-451.829] (-450.332) (-450.557) (-452.118) * (-449.587) (-451.226) (-451.926) [-450.265] -- 0:00:03
947000 -- (-451.833) [-450.519] (-453.315) (-455.580) * (-452.241) (-451.785) [-450.694] (-452.335) -- 0:00:03
947500 -- (-451.287) [-451.020] (-456.585) (-453.817) * (-450.035) [-449.616] (-450.917) (-452.500) -- 0:00:03
948000 -- (-451.243) [-451.118] (-449.616) (-451.819) * [-451.009] (-450.891) (-449.822) (-450.550) -- 0:00:03
948500 -- (-449.883) (-450.869) (-449.817) [-450.579] * (-450.511) (-451.463) [-451.730] (-455.539) -- 0:00:03
949000 -- (-451.458) [-451.338] (-452.619) (-450.763) * [-450.625] (-450.538) (-451.415) (-450.457) -- 0:00:03
949500 -- (-451.330) [-452.308] (-454.621) (-451.435) * [-451.299] (-454.581) (-453.453) (-451.959) -- 0:00:02
950000 -- (-451.509) [-451.180] (-453.442) (-451.940) * (-451.531) [-450.762] (-451.372) (-450.357) -- 0:00:02
Average standard deviation of split frequencies: 0.006942
950500 -- (-451.687) [-450.778] (-450.371) (-452.123) * (-450.069) (-450.920) [-452.105] (-450.386) -- 0:00:02
951000 -- (-453.192) [-452.003] (-450.684) (-455.732) * (-449.877) (-450.451) (-450.162) [-450.613] -- 0:00:02
951500 -- (-449.488) [-450.915] (-452.658) (-449.889) * (-449.776) [-451.629] (-450.749) (-464.093) -- 0:00:02
952000 -- [-449.987] (-453.834) (-449.843) (-453.471) * (-451.651) (-451.344) (-450.065) [-457.626] -- 0:00:02
952500 -- (-450.200) (-454.719) [-451.516] (-451.475) * [-451.138] (-456.399) (-449.239) (-456.156) -- 0:00:02
953000 -- (-450.589) [-449.241] (-452.078) (-450.176) * (-451.065) [-451.594] (-451.102) (-453.212) -- 0:00:02
953500 -- (-449.594) (-451.120) (-452.901) [-450.605] * (-450.565) (-452.577) [-453.053] (-451.510) -- 0:00:02
954000 -- (-451.537) (-452.723) (-451.337) [-451.520] * (-451.206) [-451.702] (-451.073) (-450.344) -- 0:00:02
954500 -- [-449.748] (-452.542) (-449.916) (-450.406) * (-451.452) (-452.414) [-450.955] (-454.364) -- 0:00:02
955000 -- (-451.544) (-453.730) (-449.836) [-450.025] * (-453.926) (-455.218) [-451.163] (-456.524) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
955500 -- (-451.549) (-453.085) [-450.551] (-449.988) * (-452.454) (-452.556) [-451.122] (-455.398) -- 0:00:02
956000 -- (-458.782) (-449.994) (-452.599) [-450.521] * [-450.390] (-453.886) (-450.041) (-451.761) -- 0:00:02
956500 -- (-451.637) [-452.058] (-457.123) (-451.201) * (-452.361) (-454.991) (-449.991) [-452.905] -- 0:00:02
957000 -- (-451.725) (-450.808) [-453.684] (-452.478) * (-450.387) [-450.694] (-450.644) (-450.364) -- 0:00:02
957500 -- (-451.686) (-451.308) [-455.787] (-451.252) * (-450.764) [-451.357] (-451.007) (-449.501) -- 0:00:02
958000 -- (-449.804) (-449.602) [-456.025] (-451.549) * (-452.853) [-452.361] (-451.750) (-451.459) -- 0:00:02
958500 -- [-449.701] (-451.386) (-450.916) (-449.685) * (-450.377) [-450.215] (-450.398) (-451.461) -- 0:00:02
959000 -- [-451.934] (-451.893) (-453.083) (-450.669) * [-450.121] (-449.686) (-450.310) (-450.349) -- 0:00:02
959500 -- (-451.872) (-450.557) (-452.242) [-451.542] * (-451.697) (-454.185) (-455.391) [-450.658] -- 0:00:02
960000 -- [-450.299] (-451.456) (-450.332) (-449.417) * (-452.322) (-452.385) (-452.087) [-451.103] -- 0:00:02
Average standard deviation of split frequencies: 0.007230
960500 -- (-450.566) (-452.710) [-451.125] (-452.223) * [-450.271] (-451.205) (-449.999) (-452.694) -- 0:00:02
961000 -- (-453.019) (-450.862) (-450.025) [-451.710] * [-455.011] (-452.131) (-450.975) (-456.076) -- 0:00:02
961500 -- (-457.550) (-450.058) (-451.405) [-451.409] * (-452.659) (-453.103) [-451.487] (-449.677) -- 0:00:02
962000 -- (-455.220) (-452.165) (-453.282) [-452.497] * (-452.487) (-452.007) (-459.883) [-449.784] -- 0:00:02
962500 -- (-451.873) (-451.232) [-453.078] (-452.941) * (-451.697) (-451.859) (-449.165) [-449.954] -- 0:00:02
963000 -- (-454.376) [-453.146] (-450.375) (-452.792) * (-449.875) (-452.709) [-453.907] (-451.206) -- 0:00:02
963500 -- [-453.504] (-451.719) (-453.266) (-449.758) * (-449.875) (-451.621) (-451.441) [-449.696] -- 0:00:02
964000 -- [-452.661] (-452.625) (-455.220) (-454.022) * (-449.643) (-450.709) [-452.282] (-453.030) -- 0:00:02
964500 -- [-454.710] (-451.443) (-456.252) (-453.847) * (-449.996) [-451.208] (-449.619) (-451.403) -- 0:00:02
965000 -- (-451.884) (-450.487) (-451.872) [-454.366] * (-452.772) [-450.164] (-450.602) (-451.602) -- 0:00:02
Average standard deviation of split frequencies: 0.006864
965500 -- (-449.992) (-454.070) (-451.378) [-455.468] * (-452.629) (-452.200) [-450.911] (-452.399) -- 0:00:02
966000 -- (-452.646) (-449.336) [-450.093] (-456.283) * (-449.936) (-454.070) (-455.267) [-453.780] -- 0:00:02
966500 -- [-452.180] (-450.060) (-454.289) (-453.967) * [-452.848] (-454.676) (-450.754) (-451.759) -- 0:00:01
967000 -- (-458.105) [-450.796] (-451.629) (-451.940) * (-451.270) (-456.082) (-450.710) [-450.791] -- 0:00:01
967500 -- [-452.381] (-450.589) (-450.997) (-452.594) * [-451.730] (-452.587) (-449.779) (-449.514) -- 0:00:01
968000 -- (-451.579) (-451.343) [-450.361] (-454.351) * [-451.129] (-453.874) (-449.727) (-450.027) -- 0:00:01
968500 -- (-452.189) (-451.662) (-452.710) [-451.740] * (-452.607) (-451.573) (-450.264) [-449.544] -- 0:00:01
969000 -- (-450.889) [-450.453] (-452.798) (-456.783) * (-452.688) (-454.334) [-449.406] (-449.481) -- 0:00:01
969500 -- (-451.621) [-453.617] (-452.759) (-452.008) * (-451.518) [-452.527] (-452.495) (-452.489) -- 0:00:01
970000 -- (-452.365) [-451.555] (-454.528) (-451.422) * (-454.006) [-452.135] (-455.151) (-450.385) -- 0:00:01
Average standard deviation of split frequencies: 0.007123
970500 -- [-451.430] (-455.064) (-451.635) (-450.237) * (-454.404) [-450.693] (-449.944) (-452.355) -- 0:00:01
971000 -- [-451.610] (-450.194) (-450.261) (-451.794) * (-451.015) (-451.809) [-451.705] (-449.344) -- 0:00:01
971500 -- (-450.161) (-452.641) [-451.987] (-449.804) * (-451.444) (-450.638) (-454.245) [-451.410] -- 0:00:01
972000 -- (-451.240) [-454.285] (-451.096) (-449.921) * [-451.442] (-455.557) (-454.460) (-452.558) -- 0:00:01
972500 -- [-454.152] (-454.823) (-450.884) (-453.471) * [-451.305] (-450.651) (-452.597) (-451.849) -- 0:00:01
973000 -- [-450.735] (-451.959) (-450.884) (-453.935) * (-452.413) (-453.538) (-456.250) [-451.631] -- 0:00:01
973500 -- [-452.820] (-453.553) (-450.710) (-457.890) * (-454.175) (-452.479) [-453.226] (-453.503) -- 0:00:01
974000 -- (-452.434) (-454.023) [-450.269] (-449.879) * (-454.816) (-450.514) [-450.536] (-452.680) -- 0:00:01
974500 -- (-453.088) [-461.220] (-450.272) (-450.326) * (-453.445) (-452.514) (-449.418) [-449.749] -- 0:00:01
975000 -- (-450.144) (-449.971) (-451.893) [-449.436] * (-452.844) (-451.688) [-450.984] (-450.074) -- 0:00:01
Average standard deviation of split frequencies: 0.007116
975500 -- (-452.532) (-451.812) [-452.250] (-452.387) * (-449.352) [-453.027] (-452.484) (-450.154) -- 0:00:01
976000 -- (-449.568) [-451.849] (-450.652) (-450.219) * [-450.147] (-450.035) (-454.070) (-450.886) -- 0:00:01
976500 -- (-451.615) (-450.391) [-452.416] (-451.004) * (-449.536) (-450.204) [-455.553] (-450.033) -- 0:00:01
977000 -- (-450.025) [-451.134] (-452.944) (-450.289) * (-450.789) (-452.597) [-457.449] (-451.787) -- 0:00:01
977500 -- (-452.277) (-451.138) [-450.255] (-449.903) * (-452.156) (-451.164) (-452.899) [-454.115] -- 0:00:01
978000 -- (-454.650) (-451.999) [-451.086] (-449.376) * [-449.442] (-449.419) (-450.816) (-451.700) -- 0:00:01
978500 -- (-454.536) [-450.288] (-452.775) (-449.333) * (-449.710) (-449.447) (-449.680) [-451.355] -- 0:00:01
979000 -- (-453.781) (-452.724) [-450.533] (-450.707) * (-450.813) (-450.599) [-450.325] (-456.123) -- 0:00:01
979500 -- (-450.195) [-449.583] (-452.533) (-455.271) * (-451.437) (-449.971) [-452.353] (-451.792) -- 0:00:01
980000 -- [-452.388] (-450.531) (-452.791) (-454.642) * (-450.655) [-451.576] (-452.137) (-454.126) -- 0:00:01
Average standard deviation of split frequencies: 0.007114
980500 -- (-449.633) [-451.505] (-449.479) (-453.634) * (-449.875) [-452.167] (-450.848) (-450.130) -- 0:00:01
981000 -- (-451.674) (-450.255) [-451.192] (-452.326) * (-452.792) (-451.986) (-453.978) [-452.303] -- 0:00:01
981500 -- (-451.759) (-449.461) (-451.962) [-455.182] * [-455.849] (-451.967) (-450.353) (-450.927) -- 0:00:01
982000 -- [-450.721] (-450.330) (-449.842) (-451.898) * [-452.376] (-454.404) (-457.473) (-454.976) -- 0:00:01
982500 -- [-453.353] (-450.161) (-451.658) (-454.134) * (-450.874) (-454.388) [-452.764] (-450.971) -- 0:00:01
983000 -- [-451.639] (-451.222) (-453.144) (-454.174) * (-452.389) (-452.045) [-451.663] (-450.891) -- 0:00:01
983500 -- (-450.359) (-453.906) (-452.024) [-452.471] * (-450.757) (-451.916) (-456.123) [-450.844] -- 0:00:00
984000 -- (-452.414) (-450.089) [-451.306] (-452.175) * (-449.680) [-452.341] (-450.532) (-450.246) -- 0:00:00
984500 -- (-455.627) (-452.398) (-449.641) [-449.815] * (-452.833) (-450.929) [-449.905] (-450.558) -- 0:00:00
985000 -- (-450.611) (-450.411) [-450.136] (-451.057) * [-451.116] (-452.498) (-450.250) (-449.678) -- 0:00:00
Average standard deviation of split frequencies: 0.007363
985500 -- [-451.528] (-451.723) (-452.240) (-451.987) * (-455.303) (-450.805) (-449.881) [-451.945] -- 0:00:00
986000 -- (-451.278) (-451.524) (-453.570) [-450.530] * (-453.302) (-451.750) (-449.956) [-450.351] -- 0:00:00
986500 -- (-454.022) (-452.514) (-451.522) [-451.225] * (-452.419) [-451.041] (-452.208) (-451.016) -- 0:00:00
987000 -- [-454.975] (-451.206) (-452.352) (-451.149) * (-450.135) (-452.906) [-450.141] (-450.981) -- 0:00:00
987500 -- (-452.062) (-452.720) (-452.118) [-451.228] * [-449.514] (-450.543) (-450.748) (-450.655) -- 0:00:00
988000 -- (-450.986) (-451.137) (-450.927) [-450.913] * (-450.508) [-449.471] (-451.536) (-450.536) -- 0:00:00
988500 -- [-451.162] (-450.947) (-451.063) (-450.740) * (-453.514) (-455.816) [-450.961] (-449.126) -- 0:00:00
989000 -- (-449.742) (-451.981) (-456.207) [-450.239] * (-450.180) (-454.290) [-452.988] (-453.005) -- 0:00:00
989500 -- (-450.121) (-450.504) (-451.458) [-450.665] * [-450.536] (-456.551) (-451.043) (-455.829) -- 0:00:00
990000 -- [-449.406] (-450.058) (-458.568) (-452.164) * (-452.087) (-452.579) (-453.053) [-454.106] -- 0:00:00
Average standard deviation of split frequencies: 0.006979
990500 -- [-449.875] (-456.855) (-454.758) (-452.826) * [-450.745] (-450.919) (-449.970) (-451.113) -- 0:00:00
991000 -- (-452.152) (-456.899) [-451.453] (-451.452) * (-452.879) (-450.694) [-449.660] (-450.898) -- 0:00:00
991500 -- (-452.232) (-457.089) (-450.987) [-451.029] * (-451.148) (-453.425) (-449.542) [-450.734] -- 0:00:00
992000 -- [-450.038] (-449.980) (-449.567) (-450.912) * (-452.104) [-452.456] (-449.517) (-455.149) -- 0:00:00
992500 -- (-451.869) (-455.219) (-453.044) [-457.018] * (-450.751) (-452.721) [-451.030] (-454.014) -- 0:00:00
993000 -- (-450.305) [-449.465] (-455.009) (-455.685) * (-451.828) (-451.927) [-450.001] (-454.009) -- 0:00:00
993500 -- (-449.940) [-452.499] (-452.056) (-453.225) * (-449.603) (-454.659) (-456.802) [-452.469] -- 0:00:00
994000 -- (-452.059) (-452.760) (-452.194) [-450.397] * [-450.150] (-451.699) (-453.630) (-450.659) -- 0:00:00
994500 -- (-452.884) (-452.919) [-451.635] (-455.038) * (-452.227) (-450.696) [-454.795] (-449.640) -- 0:00:00
995000 -- [-450.470] (-450.123) (-455.410) (-457.498) * (-451.040) (-450.581) [-453.827] (-450.406) -- 0:00:00
Average standard deviation of split frequencies: 0.006879
995500 -- (-451.568) (-450.828) [-453.551] (-452.205) * (-450.183) (-449.760) [-450.368] (-449.198) -- 0:00:00
996000 -- (-450.718) [-451.092] (-452.618) (-451.504) * (-449.949) (-449.393) [-450.031] (-449.486) -- 0:00:00
996500 -- (-450.116) [-450.225] (-453.030) (-451.208) * (-452.273) (-449.956) [-450.273] (-453.410) -- 0:00:00
997000 -- (-452.166) (-449.734) (-450.856) [-453.007] * (-454.038) [-449.241] (-449.728) (-451.640) -- 0:00:00
997500 -- (-451.971) [-449.770] (-451.544) (-451.955) * (-454.816) (-456.767) (-450.429) [-453.268] -- 0:00:00
998000 -- (-450.553) (-450.403) [-453.183] (-450.410) * (-453.323) (-450.554) [-452.970] (-454.295) -- 0:00:00
998500 -- (-450.263) (-450.499) [-451.872] (-452.520) * (-450.853) (-452.938) (-451.780) [-452.018] -- 0:00:00
999000 -- (-452.289) [-449.333] (-449.947) (-451.101) * (-453.926) (-450.479) [-452.780] (-453.254) -- 0:00:00
999500 -- [-452.296] (-449.967) (-451.723) (-450.588) * [-449.432] (-451.963) (-449.749) (-452.229) -- 0:00:00
1000000 -- (-449.782) (-451.605) [-452.276] (-450.914) * (-450.358) [-450.434] (-450.950) (-457.160) -- 0:00:00
Average standard deviation of split frequencies: 0.007066
Analysis completed in 59 seconds
Analysis used 57.95 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -449.03
Likelihood of best state for "cold" chain of run 2 was -449.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.4 % ( 31 %) Dirichlet(Pi{all})
37.4 % ( 31 %) Slider(Pi{all})
78.7 % ( 53 %) Multiplier(Alpha{1,2})
77.9 % ( 58 %) Multiplier(Alpha{3})
25.4 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
31.0 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.7 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.7 % ( 23 %) Dirichlet(Pi{all})
37.5 % ( 26 %) Slider(Pi{all})
79.0 % ( 55 %) Multiplier(Alpha{1,2})
77.2 % ( 51 %) Multiplier(Alpha{3})
25.5 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 93 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166630 0.82 0.67
3 | 167373 166890 0.84
4 | 165840 166777 166490
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166796 0.82 0.67
3 | 166403 166921 0.84
4 | 166310 167002 166568
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -450.88
| 2 1 1 2 |
|1 1 2 1 2 |
| 11 1 1 |
| 11 11 1 11 2 1 22 1 1 2 2 *|
| 2 112 2 2* 1 *21 1 2 1 1 |
| 1 2 2 2 1 2 2 1 2 1 2 2 2* 2 |
|2 1 2 211 1 1*2 1 2 2 2 1 * *11 * |
| 22 2 2 2 1 2 21 2 2 12 1 |
| 2 1 2 2 1 12 |
| 2 2 2 11 2 |
| 1 1 1 2 |
| |
| |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -452.74
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -450.77 -454.67
2 -450.83 -453.80
--------------------------------------
TOTAL -450.80 -454.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897885 0.089295 0.344640 1.470271 0.865520 1431.14 1466.07 1.000
r(A<->C){all} 0.158490 0.018300 0.000030 0.447328 0.122683 204.86 252.11 1.004
r(A<->G){all} 0.168600 0.021490 0.000080 0.480685 0.126071 185.36 201.30 1.000
r(A<->T){all} 0.170454 0.021158 0.000090 0.450627 0.129797 212.99 240.88 1.000
r(C<->G){all} 0.169292 0.018762 0.000217 0.440570 0.137324 319.66 328.31 1.003
r(C<->T){all} 0.161160 0.018365 0.000059 0.425754 0.128294 274.33 285.68 1.000
r(G<->T){all} 0.172004 0.020828 0.000069 0.463370 0.137361 167.27 207.81 1.000
pi(A){all} 0.201059 0.000481 0.161397 0.245456 0.200608 1308.10 1362.84 1.002
pi(C){all} 0.314125 0.000643 0.265990 0.363353 0.313943 1286.38 1309.25 1.000
pi(G){all} 0.317888 0.000650 0.268543 0.368492 0.317454 1159.09 1244.19 1.000
pi(T){all} 0.166928 0.000405 0.128602 0.206059 0.166339 1208.03 1247.34 1.000
alpha{1,2} 0.417435 0.220183 0.000275 1.357397 0.262032 1176.86 1280.17 1.000
alpha{3} 0.458513 0.231589 0.000128 1.442228 0.304908 1162.95 1230.91 1.000
pinvar{all} 0.994891 0.000040 0.983881 0.999993 0.996896 892.34 1181.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ...**.
9 -- .**...
10 -- .****.
11 -- ..**..
12 -- .***.*
13 -- .**.**
14 -- ..****
15 -- ....**
16 -- ..*.*.
17 -- ..*..*
18 -- .*..*.
19 -- .*.***
20 -- ...*.*
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 449 0.149567 0.019315 0.135909 0.163225 2
8 445 0.148235 0.006124 0.143904 0.152565 2
9 445 0.148235 0.000471 0.147901 0.148568 2
10 439 0.146236 0.013662 0.136576 0.155896 2
11 438 0.145903 0.000942 0.145237 0.146569 2
12 435 0.144903 0.007066 0.139907 0.149900 2
13 431 0.143571 0.009893 0.136576 0.150566 2
14 423 0.140906 0.013662 0.131246 0.150566 2
15 422 0.140573 0.006595 0.135909 0.145237 2
16 420 0.139907 0.005653 0.135909 0.143904 2
17 420 0.139907 0.000000 0.139907 0.139907 2
18 419 0.139574 0.009893 0.132578 0.146569 2
19 415 0.138241 0.006124 0.133911 0.142572 2
20 415 0.138241 0.006124 0.133911 0.142572 2
21 395 0.131579 0.000471 0.131246 0.131912 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099199 0.009805 0.000014 0.301360 0.068799 1.000 2
length{all}[2] 0.100889 0.010062 0.000021 0.298524 0.068605 1.000 2
length{all}[3] 0.097954 0.010083 0.000017 0.290059 0.066506 1.001 2
length{all}[4] 0.103125 0.009932 0.000008 0.302792 0.074034 1.000 2
length{all}[5] 0.098358 0.009445 0.000008 0.288712 0.067081 1.000 2
length{all}[6] 0.099501 0.010542 0.000005 0.302363 0.067842 1.000 2
length{all}[7] 0.097347 0.009011 0.000564 0.287881 0.068500 0.999 2
length{all}[8] 0.105291 0.010534 0.000175 0.309390 0.072717 1.000 2
length{all}[9] 0.097414 0.009558 0.000147 0.303954 0.065786 1.005 2
length{all}[10] 0.101019 0.009726 0.000139 0.295926 0.069382 1.003 2
length{all}[11] 0.095025 0.008934 0.000117 0.287533 0.064391 0.998 2
length{all}[12] 0.100259 0.011408 0.000232 0.321942 0.069766 1.000 2
length{all}[13] 0.102099 0.010425 0.000350 0.311788 0.069278 1.002 2
length{all}[14] 0.101376 0.010697 0.000068 0.292981 0.070596 0.998 2
length{all}[15] 0.103044 0.010735 0.000195 0.299915 0.072426 0.999 2
length{all}[16] 0.099403 0.008592 0.000308 0.288041 0.070654 0.999 2
length{all}[17] 0.096963 0.010470 0.000082 0.316670 0.063022 0.998 2
length{all}[18] 0.097496 0.009454 0.000029 0.274607 0.068330 1.001 2
length{all}[19] 0.101214 0.012005 0.000140 0.277967 0.072359 0.999 2
length{all}[20] 0.094305 0.008825 0.000301 0.249791 0.067733 1.001 2
length{all}[21] 0.100409 0.011254 0.000012 0.308387 0.066046 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007066
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 333
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 111 / 111 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 111 / 111 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076611 0.078858 0.053624 0.106818 0.014370 0.063795 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -471.676125
Iterating by ming2
Initial: fx= 471.676125
x= 0.07661 0.07886 0.05362 0.10682 0.01437 0.06379 0.30000 1.30000
1 h-m-p 0.0000 0.0001 265.1085 ++ 462.425392 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0085 45.1570 -----------.. | 1/8
3 h-m-p 0.0000 0.0004 242.1934 +++ 441.120181 m 0.0004 45 | 2/8
4 h-m-p 0.0022 0.0120 35.1089 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 218.0224 ++ 436.650543 m 0.0001 77 | 3/8
6 h-m-p 0.0007 0.0190 26.1471 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 188.9661 ++ 432.407819 m 0.0001 108 | 4/8
8 h-m-p 0.0009 0.0276 19.4208 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 154.5089 ++ 431.910865 m 0.0000 139 | 5/8
10 h-m-p 0.0002 0.0429 12.9377 ----------.. | 5/8
11 h-m-p 0.0000 0.0003 109.0069 +++ 428.808113 m 0.0003 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 428.808113 m 8.0000 181 | 6/8
13 h-m-p 0.0213 8.0000 0.0013 +++++ 428.808113 m 8.0000 197 | 6/8
14 h-m-p 0.0016 0.3508 6.5915 ++++ 428.808095 m 0.3508 212 | 7/8
15 h-m-p 0.1768 0.8838 2.5174 ++ 428.807821 m 0.8838 223 | 8/8
16 h-m-p 0.0160 8.0000 0.0000 Y 428.807821 0 0.0160 234
Out..
lnL = -428.807821
235 lfun, 235 eigenQcodon, 1410 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072385 0.049471 0.027928 0.080549 0.041789 0.020699 0.000100 0.747231 0.127360
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.044032
np = 9
lnL0 = -457.257064
Iterating by ming2
Initial: fx= 457.257064
x= 0.07238 0.04947 0.02793 0.08055 0.04179 0.02070 0.00011 0.74723 0.12736
1 h-m-p 0.0000 0.0000 219.8517 ++ 457.117202 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 223.3939 +++ 445.231161 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 120.8827 ++ 442.396090 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0005 127.1776 ++ 437.449600 m 0.0005 51 | 4/9
5 h-m-p 0.0000 0.0001 323.3178 ++ 435.458623 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 1157122.4073 ++ 435.428503 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0020 39.4033 ++++ 433.233726 m 0.0020 89 | 7/9
8 h-m-p 0.0001 0.0003 276.8714 ++ 428.807985 m 0.0003 101 | 8/9
9 h-m-p 1.6000 8.0000 0.0000 --------C 428.807985 0 0.0000 121 | 8/9
10 h-m-p 0.0160 8.0000 0.0000 --C 428.807985 0 0.0003 136
Out..
lnL = -428.807985
137 lfun, 411 eigenQcodon, 1644 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.056884 0.066004 0.054596 0.034617 0.065437 0.055788 0.000100 0.977310 0.405897 0.105415 2.841121
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.550196
np = 11
lnL0 = -459.390298
Iterating by ming2
Initial: fx= 459.390298
x= 0.05688 0.06600 0.05460 0.03462 0.06544 0.05579 0.00011 0.97731 0.40590 0.10541 2.84112
1 h-m-p 0.0000 0.0000 190.7938 ++ 459.240743 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0016 74.6696 ++++ 451.838332 m 0.0016 32 | 2/11
3 h-m-p 0.0003 0.0019 148.9086 ++ 431.439606 m 0.0019 46 | 3/11
4 h-m-p 0.0006 0.0029 24.9269 ++ 430.819267 m 0.0029 60 | 4/11
5 h-m-p 0.0000 0.0001 433.1930 ++ 430.559562 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0002 202.7734 ++ 430.304904 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0000 330783570.1288 ++ 429.473408 m 0.0000 102 | 7/11
8 h-m-p 0.0016 0.0079 55.5124 ++ 428.808079 m 0.0079 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0014 ++ 428.808079 m 8.0000 130 | 8/11
10 h-m-p 0.0100 4.2435 1.1045 -------------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 175 | 8/11
12 h-m-p 0.0160 8.0000 0.2093 ----------N 428.808079 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 428.808079 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 1.4560 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 0.0618 -------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 315 | 8/11
18 h-m-p 0.0160 8.0000 1.3072 -----------N 428.808079 0 0.0000 343 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 428.808079 m 8.0000 360 | 8/11
20 h-m-p 0.0160 8.0000 1.6865 ------------N 428.808079 0 0.0000 389 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 406 | 8/11
22 h-m-p 0.0001 0.0321 140.0323 ---------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 447 | 8/11
24 h-m-p 0.0160 8.0000 0.3537 ----------Y 428.808079 0 0.0000 474 | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 428.808079 m 8.0000 494 | 8/11
26 h-m-p 0.0160 8.0000 1.3827 -----------C 428.808079 0 0.0000 522 | 8/11
27 h-m-p 0.0160 8.0000 0.0002 +++++ 428.808079 m 8.0000 539 | 8/11
28 h-m-p 0.0160 8.0000 1.3914 ----------Y 428.808079 0 0.0000 566 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 583 | 8/11
30 h-m-p 0.0160 8.0000 4.3481 -------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 428.808079 m 8.0000 628 | 8/11
32 h-m-p 0.0160 8.0000 0.2692 +++++ 428.807932 m 8.0000 648 | 8/11
33 h-m-p 0.4382 8.0000 4.9146 ---------------Y 428.807932 0 0.0000 680 | 8/11
34 h-m-p 0.0160 8.0000 0.0011 +++++ 428.807931 m 8.0000 697 | 8/11
35 h-m-p 0.0023 0.7660 3.9407 +++++ 428.807827 m 0.7660 717 | 9/11
36 h-m-p 1.6000 8.0000 0.2387 ++ 428.807822 m 8.0000 731 | 9/11
37 h-m-p 1.6000 8.0000 0.3149 ++ 428.807821 m 8.0000 747 | 9/11
38 h-m-p 1.6000 8.0000 0.2150 ++ 428.807821 m 8.0000 763 | 9/11
39 h-m-p 1.6000 8.0000 0.3758 ++ 428.807821 m 8.0000 779 | 9/11
40 h-m-p 1.6000 8.0000 0.2340 ++ 428.807821 m 8.0000 795 | 9/11
41 h-m-p 1.6000 8.0000 0.3687 ++ 428.807821 m 8.0000 811 | 9/11
42 h-m-p 1.6000 8.0000 0.5526 ++ 428.807821 m 8.0000 827 | 9/11
43 h-m-p 1.6000 8.0000 0.0000 Y 428.807821 0 1.6000 843 | 9/11
44 h-m-p 0.0160 8.0000 0.0000 C 428.807821 0 0.0160 859
Out..
lnL = -428.807821
860 lfun, 3440 eigenQcodon, 15480 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -428.840332 S = -428.808476 -0.012254
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:04
did 20 / 40 patterns 0:05
did 30 / 40 patterns 0:05
did 40 / 40 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051911 0.040908 0.077686 0.041227 0.023428 0.063934 0.000100 0.541842 1.684722
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.141341
np = 9
lnL0 = -458.398467
Iterating by ming2
Initial: fx= 458.398467
x= 0.05191 0.04091 0.07769 0.04123 0.02343 0.06393 0.00011 0.54184 1.68472
1 h-m-p 0.0000 0.0000 229.2904 ++ 458.269193 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0150 35.8997 +++++ 443.158083 m 0.0150 29 | 2/9
3 h-m-p 0.0000 0.0001 747.3577 ++ 429.145206 m 0.0001 41 | 3/9
4 h-m-p 0.0000 0.0001 25.3923 ++ 428.981510 m 0.0001 53 | 4/9
5 h-m-p 0.0001 0.0031 14.9092 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 194.7218 ++ 428.875770 m 0.0000 84 | 5/9
7 h-m-p 0.0160 8.0000 1.4219 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 168.6779 ++ 428.875031 m 0.0000 119 | 6/9
9 h-m-p 0.0160 8.0000 1.1604 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 137.7060 ++ 428.834581 m 0.0000 154 | 7/9
11 h-m-p 0.0160 8.0000 0.8209 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 97.3812 ++ 428.807821 m 0.0000 191 | 8/9
13 h-m-p 1.5248 8.0000 0.0000 N 428.807821 0 1.5248 203 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 428.807821 0 1.6000 216
Out..
lnL = -428.807821
217 lfun, 2387 eigenQcodon, 13020 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.014367 0.037197 0.082215 0.033364 0.044312 0.012119 0.000100 0.900000 0.625014 1.263223 2.554395
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.438910
np = 11
lnL0 = -450.245185
Iterating by ming2
Initial: fx= 450.245185
x= 0.01437 0.03720 0.08222 0.03336 0.04431 0.01212 0.00011 0.90000 0.62501 1.26322 2.55440
1 h-m-p 0.0000 0.0000 212.9161 ++ 450.019875 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0020 65.3202 ++++ 442.531228 m 0.0020 32 | 2/11
3 h-m-p 0.0000 0.0000 558.3354 ++ 441.464081 m 0.0000 46 | 3/11
4 h-m-p 0.0007 0.0239 18.6530 +++ 434.955844 m 0.0239 61 | 4/11
5 h-m-p 0.0000 0.0001 418.7485 ++ 434.517276 m 0.0001 75 | 5/11
6 h-m-p 0.0000 0.0002 148.2246 ++ 433.704757 m 0.0002 89 | 6/11
7 h-m-p 0.0002 0.0013 124.0381 ++ 431.078059 m 0.0013 103 | 7/11
8 h-m-p 0.0008 0.0041 14.9012 -----------.. | 7/11
9 h-m-p 0.0000 0.0003 91.5196 +++ 428.807932 m 0.0003 141 | 8/11
10 h-m-p 1.6000 8.0000 0.0001 ++ 428.807932 m 8.0000 155 | 8/11
11 h-m-p 0.0003 0.1367 9.7342 +++++ 428.807821 m 0.1367 175 | 9/11
12 h-m-p 1.6000 8.0000 0.0078 ++ 428.807821 m 8.0000 189 | 9/11
13 h-m-p 1.6000 8.0000 0.0074 ++ 428.807821 m 8.0000 205 | 9/11
14 h-m-p 0.0005 0.0027 119.9920 ++ 428.807821 m 0.0027 221 | 9/11
15 h-m-p 1.6000 8.0000 0.0000 N 428.807821 0 1.6000 235 | 10/11
16 h-m-p 0.0160 8.0000 0.0000 Y 428.807821 0 0.0160 251
Out..
lnL = -428.807821
252 lfun, 3024 eigenQcodon, 16632 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -428.849959 S = -428.808476 -0.018347
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:12
did 20 / 40 patterns 0:12
did 30 / 40 patterns 0:12
did 40 / 40 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=111
NC_011896_1_WP_010908338_1_1522_MLBR_RS07215 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
NC_002677_1_NP_302017_1_889_ML1439 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI
**************************************************
NC_011896_1_WP_010908338_1_1522_MLBR_RS07215 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
NC_002677_1_NP_302017_1_889_ML1439 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070 PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE
**************************************************
NC_011896_1_WP_010908338_1_1522_MLBR_RS07215 RLDLIRSRRRG
NC_002677_1_NP_302017_1_889_ML1439 RLDLIRSRRRG
NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855 RLDLIRSRRRG
NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405 RLDLIRSRRRG
NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870 RLDLIRSRRRG
NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070 RLDLIRSRRRG
***********
>NC_011896_1_WP_010908338_1_1522_MLBR_RS07215 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC >NC_002677_1_NP_302017_1_889_ML1439 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC >NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC >NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC >NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC >NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070 ATGGCTGATCGAGTCCTGAGAGGCAGTCGCCTCGGTGCCGTGAGCTACGA GACCGATCGCAACCACGATCTCGCGCCACGTCAGATAGCGCGGTACCGCA CCGACAACGGCGAGGAGTTCGAAGTGCCCTTCGCTGACGACGCTGATATA CCCGGTACCTGGCTGTGTCGCAACGGCATGGAAGGCACCCTGATCGAGGG TGACCTGCCTGAGCCGAAGATGGTCAAGCCCCCGCGTACGCACTGGGACA TGCTGTTGGAGCGCCGCTCCATCGAGGAGCTCGAAGAACTACTCAAGGAG CGCTTGGACTTGATCCGGTCCCGCCGCCGCGGC
>NC_011896_1_WP_010908338_1_1522_MLBR_RS07215 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG >NC_002677_1_NP_302017_1_889_ML1439 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG >NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG >NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG >NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG >NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDADI PGTWLCRNGMEGTLIEGDLPEPKMVKPPRTHWDMLLERRSIEELEELLKE RLDLIRSRRRG
#NEXUS
[ID: 5771744554]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908338_1_1522_MLBR_RS07215
NC_002677_1_NP_302017_1_889_ML1439
NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855
NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405
NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870
NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908338_1_1522_MLBR_RS07215,
2 NC_002677_1_NP_302017_1_889_ML1439,
3 NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855,
4 NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405,
5 NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870,
6 NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06879859,2:0.06860523,3:0.06650557,4:0.0740337,5:0.06708107,6:0.06784174);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06879859,2:0.06860523,3:0.06650557,4:0.0740337,5:0.06708107,6:0.06784174);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -450.77 -454.67
2 -450.83 -453.80
--------------------------------------
TOTAL -450.80 -454.33
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1439/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897885 0.089295 0.344640 1.470271 0.865520 1431.14 1466.07 1.000
r(A<->C){all} 0.158490 0.018300 0.000030 0.447328 0.122683 204.86 252.11 1.004
r(A<->G){all} 0.168600 0.021490 0.000080 0.480685 0.126071 185.36 201.30 1.000
r(A<->T){all} 0.170454 0.021158 0.000090 0.450627 0.129797 212.99 240.88 1.000
r(C<->G){all} 0.169292 0.018762 0.000217 0.440570 0.137324 319.66 328.31 1.003
r(C<->T){all} 0.161160 0.018365 0.000059 0.425754 0.128294 274.33 285.68 1.000
r(G<->T){all} 0.172004 0.020828 0.000069 0.463370 0.137361 167.27 207.81 1.000
pi(A){all} 0.201059 0.000481 0.161397 0.245456 0.200608 1308.10 1362.84 1.002
pi(C){all} 0.314125 0.000643 0.265990 0.363353 0.313943 1286.38 1309.25 1.000
pi(G){all} 0.317888 0.000650 0.268543 0.368492 0.317454 1159.09 1244.19 1.000
pi(T){all} 0.166928 0.000405 0.128602 0.206059 0.166339 1208.03 1247.34 1.000
alpha{1,2} 0.417435 0.220183 0.000275 1.357397 0.262032 1176.86 1280.17 1.000
alpha{3} 0.458513 0.231589 0.000128 1.442228 0.304908 1162.95 1230.91 1.000
pinvar{all} 0.994891 0.000040 0.983881 0.999993 0.996896 892.34 1181.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1439/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 111
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 10 10 10 10 10 10
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 4 4 4 4 4 4 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 1 1 1 1 1 1 | GAC 6 6 6 6 6 6 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 2 2 2 2 2 2 | GAG 9 9 9 9 9 9 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908338_1_1522_MLBR_RS07215
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
#2: NC_002677_1_NP_302017_1_889_ML1439
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
#3: NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
#4: NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
#5: NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
#6: NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6
TTC 12 | TCC 12 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 0 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 12
CTC 24 | CCC 18 | CAC 12 | CGC 60
CTA 6 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 30 | CCG 12 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 18 | ACC 24 | AAC 18 | AGC 6
ATA 12 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 24 | ACG 6 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 24 | Gly G GGT 18
GTC 12 | GCC 6 | GAC 36 | GGC 30
GTA 0 | GCA 0 | Glu E GAA 24 | GGA 0
GTG 12 | GCG 12 | GAG 54 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10811 C:0.31532 A:0.20721 G:0.36937
position 2: T:0.25225 C:0.18018 A:0.30631 G:0.26126
position 3: T:0.13514 C:0.45045 A:0.09009 G:0.32432
Average T:0.16517 C:0.31532 A:0.20120 G:0.31832
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -428.807821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908338_1_1522_MLBR_RS07215: 0.000004, NC_002677_1_NP_302017_1_889_ML1439: 0.000004, NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855: 0.000004, NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405: 0.000004, NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870: 0.000004, NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 56.4 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -428.807985 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.801482 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908338_1_1522_MLBR_RS07215: 0.000004, NC_002677_1_NP_302017_1_889_ML1439: 0.000004, NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855: 0.000004, NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405: 0.000004, NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870: 0.000004, NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.80148 0.19852
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 56.4 0.1985 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -428.807821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908338_1_1522_MLBR_RS07215: 0.000004, NC_002677_1_NP_302017_1_889_ML1439: 0.000004, NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855: 0.000004, NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405: 0.000004, NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870: 0.000004, NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908338_1_1522_MLBR_RS07215)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -428.807821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.699887
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908338_1_1522_MLBR_RS07215: 0.000004, NC_002677_1_NP_302017_1_889_ML1439: 0.000004, NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855: 0.000004, NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405: 0.000004, NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870: 0.000004, NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.69989
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -428.807821 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.509345 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908338_1_1522_MLBR_RS07215: 0.000004, NC_002677_1_NP_302017_1_889_ML1439: 0.000004, NZ_LVXE01000004_1_WP_010908338_1_1743_A3216_RS02855: 0.000004, NZ_LYPH01000077_1_WP_010908338_1_2576_A8144_RS12405: 0.000004, NZ_CP029543_1_WP_010908338_1_1546_DIJ64_RS07870: 0.000004, NZ_AP014567_1_WP_010908338_1_1586_JK2ML_RS08070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.50934
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 276.6 56.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908338_1_1522_MLBR_RS07215)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:13
Model 1: NearlyNeutral -428.807985 Model 2: PositiveSelection -428.807821 Model 0: one-ratio -428.807821 Model 7: beta -428.807821 Model 8: beta&w>1 -428.807821 Model 0 vs 1 3.2799999996768747E-4 Model 2 vs 1 3.2799999996768747E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
