--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:41:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1446/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.17 -530.97
2 -528.16 -535.17
--------------------------------------
TOTAL -528.16 -534.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891379 0.090049 0.335766 1.468647 0.855588 1501.00 1501.00 1.000
r(A<->C){all} 0.171798 0.021513 0.000123 0.474220 0.132412 203.75 215.39 1.000
r(A<->G){all} 0.162405 0.018600 0.000152 0.436624 0.126169 294.57 296.02 1.002
r(A<->T){all} 0.163950 0.018947 0.000062 0.440607 0.127735 206.49 243.98 1.000
r(C<->G){all} 0.163935 0.020031 0.000012 0.451965 0.124518 175.89 233.12 1.000
r(C<->T){all} 0.172531 0.020725 0.000036 0.459989 0.136821 59.27 196.52 1.000
r(G<->T){all} 0.165382 0.020739 0.000215 0.458477 0.127024 202.26 231.06 1.001
pi(A){all} 0.237040 0.000467 0.195635 0.279782 0.236671 1062.00 1177.18 1.000
pi(C){all} 0.288840 0.000540 0.244169 0.334342 0.288013 1175.04 1221.83 1.000
pi(G){all} 0.288633 0.000521 0.248184 0.336029 0.287691 1268.38 1384.69 1.000
pi(T){all} 0.185487 0.000389 0.150375 0.226425 0.185219 1199.17 1350.08 1.001
alpha{1,2} 0.429706 0.246545 0.000127 1.444819 0.243643 1289.27 1314.49 1.000
alpha{3} 0.464504 0.248288 0.000170 1.444966 0.292586 1173.64 1283.64 1.000
pinvar{all} 0.995799 0.000026 0.986436 0.999994 0.997452 1436.14 1458.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -509.565175
Model 2: PositiveSelection -509.565124
Model 0: one-ratio -509.565124
Model 7: beta -509.565175
Model 8: beta&w>1 -509.565124
Model 0 vs 1 1.0199999996984843E-4
Model 2 vs 1 1.0199999996984843E-4
Model 8 vs 7 1.0199999996984843E-4
>C1
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C2
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C3
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C4
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C5
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C6
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=128
C1 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C2 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C3 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C4 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C5 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C6 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
**************************************************
C1 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C2 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C3 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C4 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C5 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C6 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
**************************************************
C1 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C2 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C3 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C4 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C5 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C6 QGRLFNFVSKLRGGMQNNVGLELRVSGS
****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3840]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3840]--->[3840]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.648 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C2 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C3 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C4 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C5 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
C6 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
**************************************************
C1 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C2 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C3 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C4 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C5 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
C6 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
**************************************************
C1 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C2 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C3 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C4 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C5 QGRLFNFVSKLRGGMQNNVGLELRVSGS
C6 QGRLFNFVSKLRGGMQNNVGLELRVSGS
****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
C2 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
C3 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
C4 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
C5 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
C6 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
**************************************************
C1 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
C2 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
C3 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
C4 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
C5 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
C6 CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
**************************************************
C1 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
C2 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
C3 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
C4 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
C5 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
C6 CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
**************************************************
C1 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
C2 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
C3 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
C4 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
C5 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
C6 AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
**************************************************
C1 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
C2 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
C3 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
C4 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
C5 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
C6 TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
**************************************************
C1 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
C2 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
C3 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
C4 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
C5 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
C6 AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
**************************************************
C1 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
C2 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
C3 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
C4 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
C5 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
C6 CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
**************************************************
C1 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
C2 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
C3 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
C4 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
C5 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
C6 CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
**********************************
>C1
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C2
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C3
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C4
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C5
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C6
GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC
CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG
CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC
AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG
TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA
AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC
CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA
CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>C1
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C2
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C3
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C4
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C5
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
>C6
VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
QGRLFNFVSKLRGGMQNNVGLELRVSGS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 384 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855211
Setting output file names to "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1503934359
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5079250553
Seed = 321823154
Swapseed = 1579855211
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -859.410362 -- -24.965149
Chain 2 -- -859.410362 -- -24.965149
Chain 3 -- -859.410362 -- -24.965149
Chain 4 -- -859.410362 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -859.410280 -- -24.965149
Chain 2 -- -859.410280 -- -24.965149
Chain 3 -- -859.410411 -- -24.965149
Chain 4 -- -859.410280 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-859.410] (-859.410) (-859.410) (-859.410) * [-859.410] (-859.410) (-859.410) (-859.410)
500 -- (-535.454) (-544.100) [-540.614] (-539.109) * (-538.644) [-542.529] (-544.840) (-539.786) -- 0:00:00
1000 -- (-537.093) [-540.211] (-531.646) (-545.141) * [-533.522] (-539.677) (-551.772) (-534.590) -- 0:00:00
1500 -- (-534.311) (-536.226) [-539.211] (-538.537) * (-552.372) (-535.939) [-536.480] (-542.002) -- 0:00:00
2000 -- (-545.593) (-544.435) [-538.415] (-544.303) * (-538.772) (-541.487) [-532.527] (-535.263) -- 0:00:00
2500 -- (-545.051) [-537.961] (-534.442) (-540.512) * (-535.581) [-544.108] (-536.101) (-545.390) -- 0:00:00
3000 -- [-532.915] (-540.244) (-539.226) (-535.426) * (-538.673) (-535.780) (-535.373) [-535.893] -- 0:00:00
3500 -- (-533.927) [-535.455] (-541.904) (-537.954) * [-536.553] (-534.042) (-536.920) (-537.546) -- 0:00:00
4000 -- [-535.088] (-536.161) (-537.497) (-537.344) * (-537.942) (-545.476) (-540.804) [-535.257] -- 0:00:00
4500 -- (-536.923) [-538.289] (-532.816) (-536.437) * (-538.986) (-536.551) (-532.903) [-537.310] -- 0:00:00
5000 -- (-538.194) [-540.305] (-538.582) (-536.267) * (-541.422) (-546.174) (-548.401) [-534.476] -- 0:00:00
Average standard deviation of split frequencies: 0.096027
5500 -- (-541.943) [-537.097] (-533.553) (-535.248) * (-539.961) (-545.130) (-535.904) [-535.285] -- 0:00:00
6000 -- (-541.365) (-542.799) [-536.026] (-534.841) * [-533.462] (-538.962) (-540.122) (-539.698) -- 0:00:00
6500 -- (-539.872) (-548.955) [-536.853] (-536.337) * (-532.343) [-534.234] (-537.090) (-539.003) -- 0:00:00
7000 -- (-541.325) (-541.602) (-540.661) [-536.846] * (-535.730) (-535.638) [-535.871] (-540.706) -- 0:00:00
7500 -- [-536.044] (-544.146) (-538.180) (-542.221) * [-535.595] (-531.168) (-537.485) (-540.284) -- 0:00:00
8000 -- (-531.804) [-532.830] (-538.955) (-535.608) * (-537.671) (-549.419) (-534.664) [-544.629] -- 0:00:00
8500 -- (-537.443) (-537.890) [-535.662] (-539.910) * (-542.468) (-541.303) [-533.448] (-535.636) -- 0:00:00
9000 -- (-537.121) (-536.857) [-537.240] (-537.210) * (-540.344) [-535.688] (-534.354) (-540.219) -- 0:00:00
9500 -- (-536.707) (-559.041) [-545.178] (-535.379) * (-547.023) (-536.543) (-537.144) [-537.785] -- 0:00:00
10000 -- (-543.539) (-549.869) (-540.369) [-535.516] * (-541.125) [-535.378] (-551.735) (-543.562) -- 0:00:00
Average standard deviation of split frequencies: 0.063836
10500 -- (-540.275) [-536.815] (-534.983) (-544.295) * [-534.687] (-541.334) (-533.381) (-535.482) -- 0:00:00
11000 -- (-531.612) [-529.909] (-555.586) (-541.018) * (-540.928) (-536.149) [-537.508] (-542.279) -- 0:00:00
11500 -- (-529.354) (-530.658) (-547.825) [-542.148] * (-536.531) (-538.569) (-541.780) [-541.270] -- 0:00:00
12000 -- (-528.095) (-530.771) [-538.405] (-547.353) * (-546.640) [-535.938] (-539.560) (-536.476) -- 0:00:00
12500 -- (-527.103) (-530.527) [-540.959] (-546.774) * (-542.532) [-535.189] (-541.808) (-533.803) -- 0:00:00
13000 -- [-528.358] (-528.106) (-550.932) (-541.881) * (-537.699) (-542.427) (-536.193) [-537.405] -- 0:00:00
13500 -- [-528.883] (-526.694) (-542.678) (-549.723) * [-535.982] (-532.787) (-541.185) (-537.821) -- 0:00:00
14000 -- [-527.425] (-528.995) (-551.696) (-537.935) * (-540.969) [-535.423] (-543.462) (-543.007) -- 0:00:00
14500 -- (-530.099) [-527.616] (-532.274) (-547.407) * (-532.948) (-538.264) [-537.529] (-541.232) -- 0:00:00
15000 -- (-528.715) [-527.515] (-530.845) (-537.782) * (-533.901) (-536.734) (-543.169) [-542.329] -- 0:01:05
Average standard deviation of split frequencies: 0.064818
15500 -- [-528.477] (-531.132) (-532.071) (-539.467) * (-533.844) [-541.478] (-543.655) (-544.356) -- 0:01:03
16000 -- (-527.966) [-528.784] (-528.534) (-544.186) * [-534.975] (-541.785) (-534.453) (-539.138) -- 0:01:01
16500 -- [-527.950] (-527.833) (-530.252) (-539.433) * (-542.082) (-540.901) [-542.999] (-549.091) -- 0:00:59
17000 -- (-527.469) (-528.511) [-528.713] (-540.974) * [-540.520] (-538.499) (-536.837) (-530.024) -- 0:00:57
17500 -- (-531.192) (-526.918) (-529.053) [-534.153] * (-541.920) (-546.812) (-547.587) [-528.085] -- 0:00:56
18000 -- (-528.313) (-528.484) (-529.641) [-535.150] * (-531.533) (-533.476) (-534.841) [-527.042] -- 0:00:54
18500 -- [-527.981] (-527.956) (-529.150) (-541.162) * (-534.315) (-541.464) (-542.735) [-530.062] -- 0:00:53
19000 -- (-529.714) (-527.271) [-531.074] (-541.281) * (-534.534) [-538.668] (-534.660) (-529.910) -- 0:00:51
19500 -- (-529.231) [-529.213] (-531.554) (-545.533) * (-536.044) (-535.634) [-540.116] (-528.044) -- 0:00:50
20000 -- [-526.883] (-526.809) (-530.014) (-541.718) * [-533.215] (-536.513) (-539.522) (-529.377) -- 0:00:49
Average standard deviation of split frequencies: 0.069630
20500 -- (-531.323) [-529.815] (-527.792) (-546.791) * [-535.716] (-538.984) (-537.443) (-526.751) -- 0:00:47
21000 -- (-529.491) [-527.503] (-528.233) (-540.754) * (-536.948) (-537.952) (-538.321) [-527.284] -- 0:00:46
21500 -- (-530.407) [-526.660] (-527.269) (-547.210) * (-538.548) [-539.765] (-545.754) (-527.362) -- 0:00:45
22000 -- (-527.314) (-527.532) [-529.757] (-546.844) * (-541.412) (-537.938) [-533.239] (-527.224) -- 0:00:44
22500 -- (-526.743) [-526.772] (-528.376) (-535.959) * (-534.416) (-533.793) (-564.209) [-530.295] -- 0:00:43
23000 -- (-530.866) [-527.422] (-529.906) (-530.517) * (-536.282) [-542.485] (-555.972) (-529.034) -- 0:00:42
23500 -- (-530.890) (-528.488) [-528.266] (-526.979) * [-537.854] (-532.506) (-528.826) (-529.511) -- 0:00:41
24000 -- (-530.039) (-527.867) (-526.594) [-530.149] * [-531.717] (-533.949) (-530.345) (-527.560) -- 0:00:40
24500 -- (-527.157) (-527.994) (-526.923) [-529.824] * [-542.961] (-540.558) (-530.541) (-527.565) -- 0:00:39
25000 -- (-529.219) (-531.404) [-528.052] (-531.488) * [-540.238] (-539.338) (-529.173) (-532.972) -- 0:00:39
Average standard deviation of split frequencies: 0.046976
25500 -- (-529.481) (-529.342) (-529.705) [-527.200] * (-539.158) (-545.757) (-532.033) [-530.497] -- 0:00:38
26000 -- (-526.966) (-535.451) [-531.022] (-527.645) * (-539.293) (-536.507) (-531.158) [-528.264] -- 0:00:37
26500 -- (-526.967) [-531.370] (-528.312) (-527.385) * (-538.363) (-546.870) [-527.615] (-528.696) -- 0:00:36
27000 -- [-526.863] (-534.121) (-528.236) (-530.721) * (-543.118) [-534.214] (-526.944) (-528.551) -- 0:00:36
27500 -- (-534.130) [-529.161] (-529.066) (-528.460) * (-535.249) (-539.028) (-527.741) [-528.636] -- 0:00:35
28000 -- [-529.034] (-529.906) (-529.462) (-530.394) * (-538.668) (-541.643) (-529.559) [-530.528] -- 0:00:34
28500 -- (-528.092) (-529.470) (-528.746) [-527.916] * (-540.757) (-543.106) (-529.054) [-530.033] -- 0:00:34
29000 -- (-527.180) (-529.401) [-531.651] (-533.660) * (-536.691) (-534.655) [-526.898] (-530.229) -- 0:00:33
29500 -- (-529.109) [-529.247] (-528.285) (-531.929) * [-533.391] (-534.265) (-527.162) (-528.658) -- 0:00:32
30000 -- (-532.320) [-532.933] (-530.761) (-531.778) * [-538.806] (-535.592) (-528.503) (-527.476) -- 0:00:32
Average standard deviation of split frequencies: 0.038796
30500 -- (-534.282) (-533.348) [-527.505] (-529.642) * [-542.497] (-535.068) (-527.402) (-530.962) -- 0:00:31
31000 -- [-535.240] (-529.667) (-527.464) (-526.857) * (-538.397) (-542.583) (-527.911) [-527.823] -- 0:00:31
31500 -- (-528.563) (-527.446) [-529.114] (-529.082) * (-535.377) (-534.883) [-527.158] (-529.576) -- 0:00:30
32000 -- (-528.128) [-528.917] (-530.094) (-529.127) * (-538.161) [-542.770] (-530.510) (-527.337) -- 0:01:00
32500 -- [-528.642] (-529.591) (-528.534) (-528.199) * (-538.203) (-538.292) (-528.133) [-529.073] -- 0:00:59
33000 -- (-528.016) (-529.927) [-528.573] (-528.376) * [-528.759] (-538.657) (-527.821) (-531.543) -- 0:00:58
33500 -- [-528.784] (-531.616) (-530.277) (-529.740) * (-532.737) (-539.561) (-527.054) [-529.749] -- 0:00:57
34000 -- [-527.258] (-527.699) (-528.369) (-529.114) * (-528.276) (-538.345) (-533.576) [-529.081] -- 0:00:56
34500 -- [-527.835] (-529.312) (-527.695) (-528.308) * (-535.640) (-544.994) [-530.853] (-534.563) -- 0:00:55
35000 -- [-527.369] (-529.353) (-530.069) (-528.379) * (-530.969) (-538.816) (-530.049) [-528.137] -- 0:00:55
Average standard deviation of split frequencies: 0.037216
35500 -- [-529.828] (-528.208) (-528.215) (-529.365) * (-528.445) (-537.044) (-528.333) [-530.903] -- 0:00:54
36000 -- (-527.309) (-533.690) (-527.829) [-532.059] * (-529.367) (-537.829) [-527.675] (-530.046) -- 0:00:53
36500 -- (-527.744) (-530.964) [-530.486] (-533.757) * (-529.221) [-535.188] (-528.391) (-531.120) -- 0:00:52
37000 -- [-529.558] (-527.546) (-530.128) (-530.381) * (-528.339) [-532.723] (-527.702) (-529.507) -- 0:00:52
37500 -- [-527.648] (-530.525) (-527.360) (-530.836) * (-528.711) (-538.994) (-528.158) [-528.016] -- 0:00:51
38000 -- (-528.819) [-533.778] (-527.863) (-530.067) * (-529.694) (-540.356) [-527.219] (-528.774) -- 0:00:50
38500 -- (-530.658) [-527.605] (-527.726) (-527.781) * (-527.672) [-540.390] (-531.852) (-528.265) -- 0:00:49
39000 -- (-527.249) (-528.026) (-529.298) [-526.998] * (-528.360) (-534.814) [-528.421] (-528.245) -- 0:00:49
39500 -- (-526.984) (-528.503) (-527.598) [-528.524] * (-529.224) (-538.100) (-534.394) [-527.125] -- 0:00:48
40000 -- (-531.548) (-530.385) (-529.085) [-527.683] * (-529.569) (-538.171) (-528.600) [-530.809] -- 0:00:48
Average standard deviation of split frequencies: 0.031115
40500 -- (-530.005) (-535.653) [-529.173] (-527.785) * (-527.266) (-539.441) (-527.398) [-527.168] -- 0:00:47
41000 -- (-527.168) (-528.525) (-527.596) [-527.945] * (-530.005) (-533.776) [-526.501] (-530.211) -- 0:00:46
41500 -- [-526.515] (-528.488) (-532.532) (-530.061) * (-529.391) (-540.550) (-528.022) [-527.714] -- 0:00:46
42000 -- [-531.686] (-526.987) (-532.659) (-528.924) * (-528.694) (-540.255) [-527.315] (-530.913) -- 0:00:45
42500 -- (-528.927) [-528.134] (-528.713) (-530.922) * (-528.095) (-562.393) [-528.938] (-528.298) -- 0:00:45
43000 -- [-531.143] (-529.034) (-529.738) (-529.178) * (-527.705) (-541.150) (-530.209) [-530.365] -- 0:00:44
43500 -- (-532.673) [-528.751] (-527.308) (-529.046) * (-528.362) (-535.006) (-530.228) [-529.528] -- 0:00:43
44000 -- [-529.788] (-527.189) (-529.149) (-530.691) * (-527.910) (-531.013) (-529.545) [-527.694] -- 0:00:43
44500 -- [-528.737] (-530.179) (-527.360) (-528.999) * (-528.841) [-529.733] (-529.994) (-526.711) -- 0:00:42
45000 -- (-531.118) (-528.155) [-528.838] (-531.031) * (-528.398) (-530.129) [-529.631] (-526.971) -- 0:00:42
Average standard deviation of split frequencies: 0.022033
45500 -- (-531.462) [-529.515] (-527.944) (-529.347) * (-530.197) [-530.040] (-530.368) (-527.433) -- 0:00:41
46000 -- [-528.583] (-530.750) (-528.098) (-529.057) * (-526.797) (-529.614) (-530.959) [-527.047] -- 0:00:41
46500 -- (-529.981) (-526.750) [-528.469] (-530.834) * (-527.730) (-528.518) [-529.627] (-534.281) -- 0:00:41
47000 -- [-531.865] (-528.285) (-528.891) (-529.520) * (-530.832) (-532.830) [-528.981] (-527.062) -- 0:00:40
47500 -- (-528.428) [-529.999] (-530.216) (-528.454) * (-530.153) (-530.349) (-527.471) [-528.689] -- 0:00:40
48000 -- (-529.977) [-528.665] (-529.614) (-527.386) * (-530.289) (-530.156) (-529.007) [-527.756] -- 0:00:39
48500 -- (-528.804) [-528.348] (-528.683) (-530.039) * (-527.680) [-527.952] (-528.963) (-535.636) -- 0:00:39
49000 -- (-530.759) [-529.147] (-529.342) (-527.684) * [-529.395] (-529.880) (-527.691) (-529.930) -- 0:00:58
49500 -- (-531.624) (-530.240) [-530.493] (-529.005) * (-532.946) [-527.806] (-529.685) (-528.562) -- 0:00:57
50000 -- (-530.372) [-530.540] (-530.034) (-531.967) * (-527.041) (-530.792) (-530.378) [-530.442] -- 0:00:57
Average standard deviation of split frequencies: 0.025254
50500 -- (-528.878) (-530.902) [-528.346] (-529.309) * (-527.331) (-531.380) (-530.776) [-529.727] -- 0:00:56
51000 -- (-531.347) (-529.669) [-526.659] (-530.372) * (-529.358) (-527.764) [-531.065] (-531.803) -- 0:00:55
51500 -- (-528.643) (-533.173) [-526.724] (-531.812) * (-530.170) (-527.112) (-527.940) [-528.743] -- 0:00:55
52000 -- (-531.612) (-532.564) (-526.617) [-526.709] * (-527.930) (-527.559) (-532.964) [-531.546] -- 0:00:54
52500 -- (-530.853) (-531.563) [-527.416] (-529.037) * [-528.269] (-531.677) (-528.660) (-529.364) -- 0:00:54
53000 -- (-528.304) (-528.751) [-528.450] (-528.795) * (-528.750) [-533.309] (-527.354) (-530.776) -- 0:00:53
53500 -- (-527.451) (-528.436) [-527.801] (-529.164) * [-527.792] (-529.515) (-530.103) (-529.156) -- 0:00:53
54000 -- (-528.951) (-528.618) [-528.696] (-529.140) * [-527.951] (-529.236) (-529.086) (-527.864) -- 0:00:52
54500 -- [-537.878] (-530.805) (-528.686) (-531.101) * (-531.644) (-530.132) [-532.627] (-528.236) -- 0:00:52
55000 -- (-531.073) (-530.121) [-527.712] (-530.718) * [-529.773] (-529.589) (-530.091) (-528.622) -- 0:00:51
Average standard deviation of split frequencies: 0.033229
55500 -- [-527.806] (-529.098) (-528.474) (-530.654) * [-527.863] (-531.133) (-529.415) (-529.130) -- 0:00:51
56000 -- [-527.423] (-529.167) (-528.280) (-527.487) * (-535.780) [-528.227] (-530.390) (-528.080) -- 0:00:50
56500 -- (-528.839) (-528.471) [-528.967] (-527.096) * [-529.953] (-527.731) (-528.704) (-528.268) -- 0:00:50
57000 -- (-528.505) [-528.123] (-531.539) (-531.803) * [-530.265] (-528.345) (-530.805) (-527.022) -- 0:00:49
57500 -- [-527.200] (-531.532) (-529.116) (-529.255) * (-528.585) [-527.668] (-526.718) (-526.679) -- 0:00:49
58000 -- [-527.618] (-530.663) (-533.715) (-530.421) * (-528.793) (-528.091) (-527.880) [-528.107] -- 0:00:48
58500 -- (-529.154) (-528.247) [-530.944] (-528.800) * (-527.688) [-530.062] (-528.026) (-537.937) -- 0:00:48
59000 -- (-530.730) [-533.159] (-533.760) (-530.702) * (-527.599) (-528.846) [-528.555] (-532.188) -- 0:00:47
59500 -- [-530.199] (-529.026) (-530.662) (-530.273) * (-527.362) [-528.892] (-529.374) (-529.620) -- 0:00:47
60000 -- (-530.179) [-526.992] (-532.728) (-529.067) * (-528.842) (-527.600) (-529.499) [-531.493] -- 0:00:47
Average standard deviation of split frequencies: 0.031470
60500 -- (-530.700) (-527.179) (-527.232) [-529.741] * [-527.401] (-527.802) (-529.051) (-527.385) -- 0:00:46
61000 -- (-529.593) (-529.114) (-528.898) [-528.252] * (-527.074) (-527.810) [-529.902] (-529.688) -- 0:00:46
61500 -- [-529.461] (-528.250) (-528.518) (-529.654) * (-529.704) (-527.911) [-529.692] (-529.682) -- 0:00:45
62000 -- (-530.675) (-527.236) (-529.571) [-530.649] * (-527.611) [-527.911] (-531.482) (-530.723) -- 0:00:45
62500 -- (-530.113) (-528.591) (-529.394) [-535.383] * (-526.769) (-528.668) [-531.180] (-531.171) -- 0:00:45
63000 -- [-533.311] (-527.244) (-528.202) (-532.744) * (-529.099) (-536.630) (-531.320) [-527.402] -- 0:00:44
63500 -- (-528.991) (-528.742) [-527.786] (-528.578) * [-530.183] (-527.980) (-527.989) (-527.122) -- 0:00:44
64000 -- [-528.617] (-527.753) (-528.561) (-531.571) * (-529.925) (-530.487) (-528.677) [-527.863] -- 0:00:43
64500 -- (-527.048) (-527.244) (-532.344) [-530.781] * (-529.541) [-527.968] (-530.518) (-527.513) -- 0:00:43
65000 -- (-528.290) (-527.251) (-528.095) [-529.569] * (-529.476) [-529.826] (-532.894) (-526.991) -- 0:00:43
Average standard deviation of split frequencies: 0.025169
65500 -- [-526.821] (-530.488) (-527.656) (-531.448) * [-529.202] (-529.652) (-527.314) (-527.872) -- 0:00:57
66000 -- [-527.108] (-533.658) (-527.385) (-528.520) * (-527.494) (-527.889) [-528.618] (-527.474) -- 0:00:56
66500 -- (-528.725) [-530.752] (-527.740) (-528.815) * (-527.233) (-531.568) (-526.633) [-527.747] -- 0:00:56
67000 -- (-528.875) (-527.746) [-529.399] (-530.139) * [-527.359] (-528.127) (-527.466) (-527.946) -- 0:00:55
67500 -- (-529.436) [-527.252] (-528.142) (-528.970) * (-528.723) (-527.473) [-530.868] (-529.038) -- 0:00:55
68000 -- (-529.548) (-535.385) (-527.763) [-532.838] * [-527.901] (-527.624) (-532.002) (-532.036) -- 0:00:54
68500 -- [-527.858] (-528.486) (-531.113) (-531.918) * (-536.376) (-531.075) (-529.890) [-529.059] -- 0:00:54
69000 -- (-529.719) (-528.663) (-531.303) [-528.461] * (-530.040) (-536.300) [-526.891] (-527.790) -- 0:00:53
69500 -- (-533.333) (-530.277) [-531.477] (-527.847) * (-528.405) (-527.843) [-528.845] (-527.295) -- 0:00:53
70000 -- (-531.641) (-529.148) (-532.156) [-528.153] * (-529.719) (-527.375) (-533.529) [-528.455] -- 0:00:53
Average standard deviation of split frequencies: 0.024015
70500 -- (-532.115) (-527.087) (-531.878) [-527.726] * (-528.428) (-528.856) [-532.339] (-527.352) -- 0:00:52
71000 -- [-527.985] (-528.733) (-533.840) (-527.456) * (-528.094) (-531.075) [-527.966] (-529.623) -- 0:00:52
71500 -- (-528.596) (-529.204) [-531.683] (-527.552) * (-530.523) (-527.579) [-528.471] (-529.140) -- 0:00:51
72000 -- (-532.029) (-527.353) (-532.879) [-527.018] * (-527.063) [-528.242] (-531.792) (-528.491) -- 0:00:51
72500 -- (-529.301) (-530.770) (-527.870) [-527.001] * (-529.628) (-529.710) (-526.936) [-528.186] -- 0:00:51
73000 -- (-529.124) [-527.367] (-529.285) (-531.256) * (-530.644) [-529.998] (-529.311) (-527.929) -- 0:00:50
73500 -- (-532.194) [-527.683] (-527.398) (-527.390) * (-527.554) (-527.756) (-531.083) [-529.309] -- 0:00:50
74000 -- (-528.559) (-531.310) (-527.389) [-529.803] * (-527.436) (-529.199) [-532.267] (-529.291) -- 0:00:50
74500 -- (-531.519) (-529.493) [-528.557] (-528.399) * (-527.735) (-528.636) [-529.768] (-529.105) -- 0:00:49
75000 -- (-530.009) (-530.721) (-528.185) [-527.671] * (-526.809) (-528.639) [-529.890] (-528.624) -- 0:00:49
Average standard deviation of split frequencies: 0.023334
75500 -- (-532.742) [-528.677] (-529.483) (-528.257) * (-527.107) (-530.388) [-528.108] (-528.114) -- 0:00:48
76000 -- (-530.081) (-528.255) [-529.491] (-530.526) * (-526.991) (-530.500) (-529.853) [-527.506] -- 0:00:48
76500 -- (-529.653) [-533.733] (-529.438) (-529.782) * (-528.750) [-532.596] (-531.432) (-529.741) -- 0:00:48
77000 -- (-529.822) (-527.202) (-529.118) [-528.819] * (-531.005) (-532.346) [-527.773] (-527.664) -- 0:00:47
77500 -- (-527.847) [-527.867] (-530.825) (-531.737) * (-530.625) (-530.849) [-532.072] (-532.488) -- 0:00:47
78000 -- (-527.248) (-529.713) (-531.100) [-527.508] * (-532.718) (-530.092) (-529.999) [-527.761] -- 0:00:47
78500 -- (-527.250) (-529.828) [-526.969] (-527.597) * (-532.736) [-528.537] (-528.659) (-528.039) -- 0:00:46
79000 -- [-527.862] (-528.535) (-530.376) (-529.551) * (-528.087) (-530.025) [-529.682] (-530.146) -- 0:00:46
79500 -- (-529.980) [-527.215] (-530.959) (-533.532) * [-528.741] (-535.284) (-527.500) (-530.376) -- 0:00:46
80000 -- (-530.135) (-528.695) (-529.003) [-532.669] * (-527.417) (-529.423) (-530.953) [-528.743] -- 0:00:46
Average standard deviation of split frequencies: 0.023668
80500 -- (-528.794) (-531.612) [-527.808] (-532.926) * (-527.264) [-527.822] (-528.479) (-534.352) -- 0:00:45
81000 -- (-527.451) [-527.305] (-527.794) (-528.447) * (-529.461) [-530.495] (-528.455) (-528.546) -- 0:00:45
81500 -- (-527.366) (-529.867) (-533.509) [-528.458] * (-529.263) [-529.297] (-530.113) (-529.205) -- 0:00:56
82000 -- [-526.839] (-530.598) (-529.959) (-527.038) * (-527.052) (-530.354) (-533.615) [-527.182] -- 0:00:55
82500 -- (-528.328) [-530.459] (-527.068) (-528.613) * (-530.852) [-534.404] (-527.765) (-528.917) -- 0:00:55
83000 -- [-529.268] (-531.949) (-527.251) (-529.790) * (-527.213) (-529.257) (-530.461) [-528.588] -- 0:00:55
83500 -- (-530.984) [-530.788] (-528.473) (-527.849) * (-527.299) (-531.172) (-528.738) [-528.753] -- 0:00:54
84000 -- [-528.762] (-527.046) (-535.832) (-528.070) * (-527.315) (-530.020) [-530.161] (-528.330) -- 0:00:54
84500 -- [-527.822] (-533.352) (-529.507) (-527.524) * (-528.482) (-534.806) [-529.448] (-529.543) -- 0:00:54
85000 -- (-528.418) (-531.709) [-529.260] (-528.958) * (-527.896) (-529.450) (-528.926) [-529.488] -- 0:00:53
Average standard deviation of split frequencies: 0.021404
85500 -- (-527.059) (-534.024) (-526.823) [-527.406] * (-526.722) [-531.140] (-532.511) (-530.169) -- 0:00:53
86000 -- (-532.814) (-531.081) [-529.005] (-532.223) * (-528.923) (-530.204) (-532.467) [-528.043] -- 0:00:53
86500 -- [-527.006] (-530.892) (-528.814) (-529.242) * [-529.033] (-530.712) (-529.704) (-530.412) -- 0:00:52
87000 -- (-531.215) [-529.053] (-529.437) (-528.498) * (-529.617) [-529.225] (-530.147) (-528.327) -- 0:00:52
87500 -- [-531.501] (-529.316) (-528.038) (-529.089) * (-529.758) [-528.369] (-528.134) (-527.526) -- 0:00:52
88000 -- (-530.043) (-528.949) (-527.951) [-530.614] * (-527.801) (-530.284) (-529.198) [-526.838] -- 0:00:51
88500 -- (-529.223) (-527.319) (-528.591) [-527.464] * (-529.503) (-537.068) [-528.219] (-528.847) -- 0:00:51
89000 -- [-527.244] (-532.188) (-531.939) (-528.676) * (-532.169) (-528.437) (-527.908) [-527.298] -- 0:00:51
89500 -- (-527.724) (-528.460) (-530.856) [-528.303] * (-528.597) [-529.097] (-530.300) (-529.583) -- 0:00:50
90000 -- (-527.817) (-528.364) [-529.470] (-528.946) * [-528.902] (-530.301) (-528.958) (-536.628) -- 0:00:50
Average standard deviation of split frequencies: 0.018458
90500 -- (-530.671) (-527.233) [-529.442] (-527.616) * [-530.861] (-530.007) (-526.991) (-530.979) -- 0:00:50
91000 -- (-527.401) (-528.306) (-527.436) [-527.070] * (-531.666) [-526.676] (-526.728) (-527.287) -- 0:00:49
91500 -- [-529.287] (-526.963) (-530.125) (-527.145) * [-529.380] (-528.560) (-527.430) (-529.389) -- 0:00:49
92000 -- [-528.231] (-527.711) (-530.059) (-539.323) * (-532.695) (-528.250) (-528.522) [-528.019] -- 0:00:49
92500 -- (-528.337) (-530.189) [-527.061] (-529.477) * (-532.620) (-531.296) [-532.158] (-528.932) -- 0:00:49
93000 -- [-527.932] (-529.425) (-526.706) (-528.201) * [-527.735] (-528.226) (-529.073) (-536.437) -- 0:00:48
93500 -- (-529.223) [-532.013] (-527.489) (-530.098) * (-526.964) [-528.297] (-527.232) (-531.054) -- 0:00:48
94000 -- [-528.827] (-530.169) (-530.818) (-528.924) * (-526.889) [-528.608] (-527.374) (-530.593) -- 0:00:48
94500 -- [-531.931] (-531.594) (-535.102) (-528.883) * (-526.758) (-527.895) [-527.620] (-530.050) -- 0:00:47
95000 -- (-530.873) (-528.050) (-533.502) [-527.851] * (-528.437) (-532.610) [-528.773] (-530.111) -- 0:00:47
Average standard deviation of split frequencies: 0.017187
95500 -- (-528.478) [-529.064] (-528.181) (-528.568) * [-526.998] (-527.370) (-529.951) (-531.541) -- 0:00:47
96000 -- (-533.875) [-529.363] (-533.168) (-528.160) * (-532.911) (-529.962) [-528.510] (-528.272) -- 0:00:47
96500 -- [-529.968] (-529.252) (-532.946) (-527.877) * [-532.793] (-530.135) (-529.318) (-527.029) -- 0:00:46
97000 -- [-529.693] (-527.699) (-531.127) (-528.380) * [-531.135] (-528.199) (-534.773) (-527.340) -- 0:00:46
97500 -- (-527.458) (-527.785) [-530.807] (-528.322) * (-528.423) [-527.844] (-529.605) (-528.421) -- 0:00:46
98000 -- [-526.945] (-529.849) (-528.219) (-531.076) * (-533.154) [-528.058] (-527.895) (-528.150) -- 0:00:55
98500 -- [-528.645] (-532.897) (-530.337) (-535.383) * (-532.682) (-528.148) [-527.608] (-529.918) -- 0:00:54
99000 -- [-533.922] (-528.902) (-533.672) (-527.016) * (-527.214) (-528.844) [-530.665] (-529.643) -- 0:00:54
99500 -- (-527.098) [-527.809] (-528.262) (-533.148) * (-530.056) (-527.886) [-529.663] (-533.651) -- 0:00:54
100000 -- (-527.678) [-527.380] (-530.843) (-531.882) * (-528.780) (-528.325) (-528.223) [-528.821] -- 0:00:54
Average standard deviation of split frequencies: 0.018485
100500 -- (-528.147) [-527.036] (-528.686) (-533.733) * [-528.115] (-529.490) (-529.847) (-528.242) -- 0:00:53
101000 -- [-527.537] (-528.273) (-526.818) (-532.156) * (-530.347) [-527.155] (-527.341) (-530.646) -- 0:00:53
101500 -- (-526.989) (-527.753) [-528.382] (-528.309) * (-532.393) (-527.865) (-528.129) [-529.393] -- 0:00:53
102000 -- (-528.495) (-530.332) (-529.819) [-528.495] * (-529.691) [-527.600] (-528.313) (-527.378) -- 0:00:52
102500 -- [-530.638] (-528.964) (-530.391) (-527.161) * (-531.634) (-528.912) [-528.369] (-529.433) -- 0:00:52
103000 -- (-529.204) [-529.895] (-530.647) (-530.492) * (-532.869) [-530.020] (-527.578) (-528.998) -- 0:00:52
103500 -- (-528.596) (-530.529) [-527.690] (-528.856) * (-528.361) [-528.666] (-527.574) (-529.228) -- 0:00:51
104000 -- (-527.755) [-527.929] (-528.855) (-528.496) * [-530.166] (-529.902) (-528.227) (-527.648) -- 0:00:51
104500 -- [-527.906] (-530.430) (-528.850) (-528.219) * (-529.492) (-531.322) [-528.769] (-531.073) -- 0:00:51
105000 -- [-528.897] (-529.507) (-528.123) (-527.628) * (-530.120) [-527.708] (-529.054) (-529.203) -- 0:00:51
Average standard deviation of split frequencies: 0.016942
105500 -- (-529.136) (-530.967) [-527.009] (-527.350) * (-531.191) (-527.536) [-529.628] (-528.218) -- 0:00:50
106000 -- (-533.202) (-528.356) (-526.970) [-529.162] * [-527.943] (-527.490) (-530.313) (-527.321) -- 0:00:50
106500 -- (-528.730) (-529.252) (-528.753) [-530.349] * [-526.755] (-529.044) (-527.259) (-527.583) -- 0:00:50
107000 -- [-533.998] (-531.181) (-527.868) (-531.148) * (-530.891) (-529.532) (-532.401) [-529.402] -- 0:00:50
107500 -- [-528.356] (-530.369) (-529.236) (-532.835) * (-529.960) (-529.107) (-530.066) [-527.627] -- 0:00:49
108000 -- (-527.012) [-529.437] (-529.695) (-529.071) * (-529.409) (-531.572) (-531.404) [-529.134] -- 0:00:49
108500 -- (-527.262) [-528.578] (-528.379) (-529.578) * (-529.436) (-530.993) (-529.303) [-529.014] -- 0:00:49
109000 -- (-527.158) (-527.484) [-530.284] (-527.233) * (-529.040) [-535.055] (-528.098) (-530.370) -- 0:00:49
109500 -- (-530.332) (-528.479) (-533.487) [-530.908] * (-530.527) [-531.445] (-528.356) (-529.450) -- 0:00:48
110000 -- (-527.596) (-528.964) (-528.397) [-530.235] * (-529.566) (-530.252) (-529.423) [-527.655] -- 0:00:48
Average standard deviation of split frequencies: 0.016227
110500 -- (-526.863) (-528.562) [-528.808] (-540.882) * (-532.071) (-528.123) (-528.709) [-529.940] -- 0:00:48
111000 -- (-527.560) [-528.557] (-528.957) (-531.981) * (-531.747) (-529.835) (-530.474) [-528.121] -- 0:00:48
111500 -- [-529.466] (-527.675) (-528.712) (-529.045) * [-529.194] (-532.190) (-535.797) (-530.039) -- 0:00:47
112000 -- [-527.969] (-528.247) (-530.020) (-530.843) * (-528.057) (-529.340) (-536.538) [-529.862] -- 0:00:47
112500 -- [-528.188] (-531.526) (-528.338) (-528.395) * (-529.702) (-527.886) (-530.405) [-527.954] -- 0:00:47
113000 -- [-528.968] (-529.270) (-529.505) (-527.014) * (-532.636) (-529.973) (-528.451) [-530.032] -- 0:00:47
113500 -- (-531.005) [-526.906] (-529.312) (-537.263) * (-528.785) [-528.202] (-527.044) (-529.057) -- 0:00:46
114000 -- [-526.911] (-530.829) (-527.668) (-531.599) * (-527.367) (-527.015) (-528.731) [-528.447] -- 0:00:46
114500 -- (-528.904) (-530.691) (-527.157) [-531.090] * (-529.578) [-527.541] (-531.141) (-527.721) -- 0:00:46
115000 -- [-527.906] (-530.818) (-527.426) (-529.781) * [-528.876] (-527.533) (-528.427) (-527.693) -- 0:00:53
Average standard deviation of split frequencies: 0.016662
115500 -- (-527.182) [-531.480] (-529.039) (-527.852) * [-528.782] (-529.181) (-531.080) (-527.532) -- 0:00:53
116000 -- (-528.561) (-530.576) [-531.045] (-530.431) * (-528.143) (-529.472) (-528.595) [-530.982] -- 0:00:53
116500 -- (-526.967) (-531.003) (-527.996) [-529.313] * (-527.694) [-528.725] (-529.444) (-528.192) -- 0:00:53
117000 -- (-527.032) [-526.825] (-528.318) (-526.890) * (-527.294) (-531.732) [-529.373] (-527.537) -- 0:00:52
117500 -- [-530.418] (-527.620) (-528.412) (-528.272) * (-528.195) (-529.593) [-526.814] (-527.912) -- 0:00:52
118000 -- (-527.580) (-528.596) (-528.308) [-528.474] * (-528.286) (-529.605) (-529.010) [-531.058] -- 0:00:52
118500 -- (-532.328) [-528.529] (-530.705) (-530.750) * [-528.689] (-529.294) (-529.228) (-531.929) -- 0:00:52
119000 -- [-528.620] (-530.600) (-528.267) (-531.438) * (-530.847) (-529.146) (-529.204) [-527.389] -- 0:00:51
119500 -- (-532.064) (-529.357) (-529.537) [-529.659] * [-529.905] (-532.008) (-530.418) (-531.854) -- 0:00:51
120000 -- (-527.381) (-528.617) (-529.149) [-528.318] * (-528.583) [-529.317] (-528.477) (-532.945) -- 0:00:51
Average standard deviation of split frequencies: 0.015431
120500 -- (-527.652) (-527.926) (-527.581) [-528.428] * (-527.742) (-528.775) [-527.810] (-530.895) -- 0:00:51
121000 -- [-527.388] (-531.497) (-527.594) (-528.519) * (-530.986) (-527.436) [-527.677] (-528.986) -- 0:00:50
121500 -- (-529.684) (-529.987) [-528.974] (-527.829) * [-528.055] (-526.747) (-530.095) (-534.044) -- 0:00:50
122000 -- (-528.533) (-530.006) [-526.722] (-529.152) * [-528.763] (-528.955) (-527.928) (-528.861) -- 0:00:50
122500 -- (-529.304) (-532.952) [-526.732] (-527.302) * [-530.651] (-529.005) (-527.509) (-527.758) -- 0:00:50
123000 -- [-528.455] (-532.281) (-527.776) (-529.152) * [-528.006] (-527.737) (-527.680) (-527.890) -- 0:00:49
123500 -- [-527.864] (-527.986) (-529.250) (-530.491) * (-527.613) (-528.627) (-530.985) [-527.020] -- 0:00:49
124000 -- (-531.280) (-528.717) (-531.211) [-528.534] * [-529.409] (-530.278) (-529.632) (-526.665) -- 0:00:49
124500 -- (-531.281) (-527.366) (-527.813) [-527.522] * (-528.696) [-530.665] (-528.598) (-528.756) -- 0:00:49
125000 -- (-530.949) (-528.146) (-528.106) [-528.676] * (-526.715) (-527.040) [-528.052] (-530.901) -- 0:00:49
Average standard deviation of split frequencies: 0.015143
125500 -- (-531.817) (-528.793) [-529.817] (-527.991) * (-529.103) (-527.968) [-533.092] (-529.606) -- 0:00:48
126000 -- (-529.305) (-530.869) (-532.162) [-529.931] * (-530.354) (-527.369) [-528.553] (-529.157) -- 0:00:48
126500 -- (-531.658) (-527.499) (-528.492) [-529.508] * (-531.628) (-527.957) (-529.836) [-530.588] -- 0:00:48
127000 -- (-529.761) [-529.208] (-528.117) (-528.853) * (-531.823) (-534.333) [-527.565] (-530.330) -- 0:00:48
127500 -- (-531.072) [-528.433] (-529.893) (-527.475) * (-534.551) [-529.945] (-529.965) (-531.573) -- 0:00:47
128000 -- (-528.220) (-529.427) [-530.959] (-534.054) * (-528.023) (-541.242) [-530.607] (-529.381) -- 0:00:47
128500 -- [-527.378] (-529.324) (-532.350) (-535.369) * (-531.629) (-539.361) [-532.474] (-530.196) -- 0:00:47
129000 -- (-528.919) (-527.656) [-529.848] (-530.274) * (-531.488) [-528.878] (-528.308) (-528.812) -- 0:00:47
129500 -- (-527.602) (-529.208) (-527.085) [-527.387] * [-532.184] (-529.031) (-527.299) (-528.261) -- 0:00:47
130000 -- (-532.706) (-530.315) [-528.379] (-528.796) * (-531.165) (-527.323) [-529.375] (-529.112) -- 0:00:46
Average standard deviation of split frequencies: 0.015805
130500 -- (-532.078) (-528.803) (-533.592) [-528.600] * (-529.577) (-531.689) (-528.583) [-529.423] -- 0:00:46
131000 -- (-529.566) (-527.006) [-530.064] (-528.759) * (-531.284) (-535.244) (-528.901) [-530.666] -- 0:00:46
131500 -- (-527.647) [-527.179] (-530.061) (-529.264) * (-530.201) (-530.572) (-528.444) [-530.917] -- 0:00:46
132000 -- (-528.064) (-527.736) [-530.639] (-529.752) * (-528.373) [-528.496] (-527.355) (-533.756) -- 0:00:52
132500 -- [-527.473] (-530.384) (-528.200) (-528.798) * (-526.584) [-527.805] (-529.771) (-528.007) -- 0:00:52
133000 -- (-530.054) (-528.731) [-527.251] (-527.632) * (-528.626) (-530.187) (-528.154) [-526.576] -- 0:00:52
133500 -- (-530.211) (-527.407) (-528.490) [-527.437] * (-530.042) (-529.670) (-530.019) [-527.415] -- 0:00:51
134000 -- (-527.635) (-529.109) [-528.719] (-534.874) * [-527.809] (-532.749) (-528.108) (-526.875) -- 0:00:51
134500 -- (-527.702) (-529.960) (-529.144) [-529.811] * (-527.450) [-527.117] (-527.814) (-527.468) -- 0:00:51
135000 -- (-528.575) (-535.735) (-530.926) [-531.427] * (-528.036) (-527.118) [-529.848] (-527.820) -- 0:00:51
Average standard deviation of split frequencies: 0.016753
135500 -- (-527.845) (-530.217) [-529.501] (-538.620) * [-529.060] (-532.601) (-528.846) (-529.098) -- 0:00:51
136000 -- (-527.364) (-528.635) [-530.796] (-529.154) * (-531.469) (-529.717) (-528.582) [-532.463] -- 0:00:50
136500 -- (-528.589) [-532.176] (-527.998) (-528.810) * (-529.884) (-529.862) (-530.442) [-531.022] -- 0:00:50
137000 -- (-528.935) (-528.430) (-527.741) [-528.188] * (-531.573) [-528.542] (-531.115) (-531.220) -- 0:00:50
137500 -- (-531.199) [-527.470] (-529.196) (-530.073) * (-528.181) (-528.932) [-532.005] (-528.656) -- 0:00:50
138000 -- [-528.371] (-528.010) (-527.635) (-530.439) * (-528.609) (-528.429) (-534.543) [-529.509] -- 0:00:49
138500 -- (-530.984) (-527.603) [-530.118] (-530.278) * (-528.650) [-529.120] (-534.418) (-528.384) -- 0:00:49
139000 -- [-527.105] (-527.914) (-527.689) (-530.463) * (-530.921) [-529.414] (-529.392) (-528.352) -- 0:00:49
139500 -- (-528.244) (-528.545) (-528.738) [-527.432] * [-526.596] (-530.495) (-528.678) (-534.172) -- 0:00:49
140000 -- (-528.676) (-527.241) (-530.172) [-527.526] * (-527.280) (-528.251) [-528.366] (-533.346) -- 0:00:49
Average standard deviation of split frequencies: 0.015345
140500 -- [-528.261] (-530.190) (-527.948) (-529.394) * [-531.233] (-529.917) (-528.931) (-530.830) -- 0:00:48
141000 -- (-529.102) (-531.609) (-527.901) [-528.643] * [-529.163] (-530.109) (-529.418) (-533.704) -- 0:00:48
141500 -- (-529.177) [-528.461] (-530.783) (-527.114) * (-530.237) (-526.954) (-528.425) [-531.162] -- 0:00:48
142000 -- (-533.509) (-529.288) (-527.626) [-527.355] * [-532.953] (-529.690) (-528.455) (-530.384) -- 0:00:48
142500 -- (-530.335) (-527.378) (-528.897) [-527.909] * (-533.672) [-529.671] (-527.907) (-530.172) -- 0:00:48
143000 -- (-528.413) (-527.723) (-527.802) [-527.617] * (-531.018) (-529.739) [-527.029] (-532.443) -- 0:00:47
143500 -- (-529.039) (-527.697) [-526.897] (-532.064) * [-530.434] (-528.686) (-528.509) (-530.475) -- 0:00:47
144000 -- [-531.955] (-528.601) (-526.501) (-531.379) * [-529.465] (-530.537) (-531.395) (-530.051) -- 0:00:47
144500 -- (-529.473) [-528.519] (-529.040) (-528.108) * (-529.024) [-530.057] (-531.062) (-531.027) -- 0:00:47
145000 -- (-527.921) (-526.610) [-529.310] (-528.018) * (-527.305) [-532.986] (-528.111) (-528.587) -- 0:00:47
Average standard deviation of split frequencies: 0.016144
145500 -- (-531.203) (-529.675) [-528.532] (-527.123) * (-527.139) (-529.275) [-527.674] (-530.730) -- 0:00:46
146000 -- [-528.851] (-529.132) (-531.118) (-528.167) * [-527.616] (-530.388) (-529.352) (-530.750) -- 0:00:46
146500 -- (-528.099) (-530.680) (-530.187) [-527.902] * (-526.835) (-528.620) [-529.296] (-528.881) -- 0:00:46
147000 -- (-530.589) (-530.626) [-530.429] (-528.511) * (-529.052) (-527.668) [-529.284] (-532.821) -- 0:00:46
147500 -- (-528.894) (-530.830) [-527.915] (-530.292) * [-528.143] (-530.817) (-530.000) (-527.559) -- 0:00:46
148000 -- (-530.830) (-528.212) [-528.939] (-527.881) * (-530.204) [-530.070] (-528.417) (-533.098) -- 0:00:46
148500 -- [-530.322] (-528.666) (-528.970) (-533.963) * (-531.243) (-536.219) [-528.103] (-527.609) -- 0:00:45
149000 -- (-530.975) (-527.309) [-526.824] (-527.812) * (-529.534) (-527.244) (-528.386) [-529.177] -- 0:00:51
149500 -- (-531.072) (-530.807) [-529.074] (-528.459) * (-528.377) [-527.346] (-528.626) (-527.734) -- 0:00:51
150000 -- [-530.206] (-527.712) (-528.071) (-528.295) * (-529.977) (-529.885) [-528.013] (-527.198) -- 0:00:51
Average standard deviation of split frequencies: 0.013009
150500 -- (-532.178) [-526.973] (-528.755) (-529.541) * (-527.486) (-527.922) [-528.332] (-530.486) -- 0:00:50
151000 -- (-531.885) (-526.870) (-527.492) [-527.095] * (-527.575) [-526.467] (-530.679) (-527.413) -- 0:00:50
151500 -- [-527.695] (-527.746) (-529.830) (-527.865) * (-528.689) (-528.981) [-528.711] (-531.627) -- 0:00:50
152000 -- [-528.103] (-531.318) (-530.240) (-527.172) * (-528.477) (-531.374) [-528.782] (-528.282) -- 0:00:50
152500 -- (-528.327) (-529.077) (-530.015) [-526.884] * (-529.003) [-529.637] (-530.057) (-528.506) -- 0:00:50
153000 -- (-528.059) (-529.864) [-527.926] (-529.491) * (-529.583) (-536.601) [-528.926] (-528.496) -- 0:00:49
153500 -- (-526.728) (-534.172) [-528.836] (-530.792) * (-531.086) (-529.201) (-529.752) [-529.370] -- 0:00:49
154000 -- (-527.864) [-530.783] (-529.898) (-529.006) * (-533.014) (-527.386) (-530.829) [-531.902] -- 0:00:49
154500 -- (-528.117) (-529.252) [-528.213] (-527.143) * [-527.568] (-527.980) (-527.027) (-530.821) -- 0:00:49
155000 -- [-531.385] (-528.373) (-531.394) (-528.231) * [-528.575] (-530.923) (-528.648) (-533.315) -- 0:00:49
Average standard deviation of split frequencies: 0.013865
155500 -- [-528.958] (-529.782) (-532.462) (-528.451) * (-528.713) (-527.405) [-528.690] (-531.940) -- 0:00:48
156000 -- (-529.394) (-530.708) [-527.198] (-528.548) * (-530.573) (-530.504) (-528.650) [-527.157] -- 0:00:48
156500 -- (-531.322) (-527.525) (-528.065) [-528.241] * (-530.923) (-531.713) (-530.959) [-528.519] -- 0:00:48
157000 -- (-529.673) [-529.159] (-528.538) (-529.794) * (-527.567) [-529.329] (-531.178) (-527.042) -- 0:00:48
157500 -- (-528.521) (-529.256) [-529.435] (-530.361) * [-528.157] (-529.638) (-528.248) (-529.551) -- 0:00:48
158000 -- (-528.931) (-527.532) [-530.329] (-531.533) * [-528.023] (-529.966) (-529.174) (-535.771) -- 0:00:47
158500 -- (-528.109) [-528.822] (-530.627) (-530.042) * (-527.425) [-532.546] (-529.195) (-528.064) -- 0:00:47
159000 -- [-529.347] (-530.222) (-530.423) (-529.022) * (-527.164) (-528.023) [-529.213] (-533.448) -- 0:00:47
159500 -- (-527.771) [-529.515] (-529.674) (-529.339) * (-531.312) (-529.525) [-529.583] (-530.866) -- 0:00:47
160000 -- (-531.174) (-528.283) (-530.311) [-529.710] * [-527.530] (-529.169) (-531.486) (-528.891) -- 0:00:47
Average standard deviation of split frequencies: 0.015361
160500 -- (-529.299) (-532.227) (-531.018) [-532.211] * [-527.536] (-528.268) (-532.931) (-527.782) -- 0:00:47
161000 -- (-529.050) (-530.292) [-531.063] (-530.296) * (-533.054) (-528.180) [-529.603] (-529.470) -- 0:00:46
161500 -- (-529.194) (-530.865) (-527.307) [-527.154] * (-528.306) [-528.012] (-531.333) (-528.765) -- 0:00:46
162000 -- (-530.400) (-527.519) (-528.544) [-527.293] * (-527.753) [-529.248] (-529.661) (-532.788) -- 0:00:46
162500 -- (-529.745) [-530.742] (-528.004) (-529.776) * (-527.071) [-528.643] (-530.439) (-530.893) -- 0:00:46
163000 -- (-529.385) [-531.341] (-527.202) (-528.206) * (-527.100) (-528.095) [-529.553] (-526.731) -- 0:00:46
163500 -- (-529.715) (-531.947) (-533.735) [-527.599] * (-531.021) [-527.697] (-530.586) (-528.355) -- 0:00:46
164000 -- (-527.835) (-527.600) [-533.809] (-530.622) * [-530.720] (-527.175) (-530.956) (-533.872) -- 0:00:45
164500 -- [-526.898] (-528.847) (-530.332) (-527.959) * (-527.672) (-526.970) (-529.006) [-528.917] -- 0:00:45
165000 -- [-528.868] (-530.700) (-528.625) (-526.794) * (-530.919) (-534.816) [-529.186] (-527.309) -- 0:00:45
Average standard deviation of split frequencies: 0.016471
165500 -- (-530.424) (-533.052) [-528.645] (-527.039) * [-529.507] (-527.027) (-528.581) (-530.846) -- 0:00:50
166000 -- (-530.881) [-535.441] (-528.408) (-526.726) * (-530.872) (-527.450) [-527.491] (-529.643) -- 0:00:50
166500 -- (-528.759) [-530.167] (-527.991) (-527.443) * (-527.792) [-527.318] (-529.895) (-531.277) -- 0:00:50
167000 -- (-528.320) [-528.124] (-530.048) (-526.694) * (-527.014) (-530.202) (-528.480) [-528.159] -- 0:00:49
167500 -- [-530.655] (-531.129) (-529.040) (-526.910) * [-527.350] (-527.890) (-526.853) (-527.621) -- 0:00:49
168000 -- (-529.024) (-528.153) [-528.195] (-527.037) * [-529.422] (-529.367) (-526.905) (-529.747) -- 0:00:49
168500 -- (-531.593) (-528.368) [-528.016] (-527.252) * (-529.219) (-528.547) (-526.684) [-532.123] -- 0:00:49
169000 -- (-529.012) (-531.365) [-527.648] (-526.812) * (-529.077) [-528.205] (-527.193) (-533.740) -- 0:00:49
169500 -- (-529.535) (-528.842) (-529.279) [-529.950] * (-529.507) (-528.700) (-526.652) [-529.675] -- 0:00:48
170000 -- [-528.901] (-529.139) (-529.259) (-528.885) * (-529.228) [-528.037] (-530.558) (-529.567) -- 0:00:48
Average standard deviation of split frequencies: 0.016137
170500 -- (-530.864) (-530.009) [-528.005] (-527.927) * [-528.552] (-530.385) (-529.613) (-529.859) -- 0:00:48
171000 -- [-527.510] (-528.810) (-529.099) (-531.866) * [-530.765] (-526.953) (-529.390) (-528.921) -- 0:00:48
171500 -- (-527.594) [-529.128] (-530.101) (-530.442) * (-530.720) (-530.600) (-529.308) [-527.589] -- 0:00:48
172000 -- (-533.617) [-532.536] (-529.022) (-529.753) * (-528.884) [-527.328] (-528.342) (-531.383) -- 0:00:48
172500 -- (-533.107) (-531.095) (-530.011) [-530.249] * (-534.640) (-528.222) [-532.345] (-527.483) -- 0:00:47
173000 -- (-529.061) (-531.836) [-529.122] (-530.066) * (-532.774) (-529.262) [-528.726] (-527.550) -- 0:00:47
173500 -- [-527.898] (-526.974) (-527.705) (-527.631) * (-531.574) (-528.057) [-529.513] (-529.598) -- 0:00:47
174000 -- [-527.614] (-531.004) (-535.980) (-526.819) * [-529.032] (-529.545) (-530.852) (-531.882) -- 0:00:47
174500 -- (-528.754) (-531.423) [-529.008] (-527.729) * (-532.184) (-532.067) [-529.301] (-528.509) -- 0:00:47
175000 -- (-527.118) (-529.684) [-528.614] (-528.033) * (-527.954) (-527.593) [-527.801] (-529.173) -- 0:00:47
Average standard deviation of split frequencies: 0.017707
175500 -- [-528.149] (-527.474) (-529.077) (-527.038) * (-529.564) (-527.063) (-529.415) [-532.777] -- 0:00:46
176000 -- (-528.081) [-530.320] (-528.571) (-531.105) * (-528.617) [-527.646] (-528.082) (-530.080) -- 0:00:46
176500 -- (-529.580) (-527.874) (-528.559) [-528.170] * [-527.258] (-528.371) (-527.840) (-527.565) -- 0:00:46
177000 -- [-528.712] (-528.358) (-526.994) (-527.278) * (-527.778) (-529.560) [-530.031] (-527.178) -- 0:00:46
177500 -- [-528.790] (-526.901) (-530.753) (-528.822) * (-528.691) (-528.982) (-530.883) [-529.185] -- 0:00:46
178000 -- [-531.187] (-529.441) (-529.236) (-528.464) * (-528.451) (-528.101) (-532.901) [-529.148] -- 0:00:46
178500 -- [-531.227] (-527.534) (-533.890) (-528.658) * (-529.418) (-528.175) (-529.350) [-532.380] -- 0:00:46
179000 -- (-528.434) (-529.214) [-531.426] (-529.343) * (-533.704) (-532.109) (-527.135) [-529.408] -- 0:00:45
179500 -- (-529.839) [-528.957] (-536.205) (-529.125) * (-527.723) [-528.546] (-529.994) (-527.951) -- 0:00:45
180000 -- (-528.860) (-526.903) (-532.536) [-528.650] * (-531.162) [-527.491] (-529.844) (-532.024) -- 0:00:45
Average standard deviation of split frequencies: 0.018265
180500 -- (-529.982) [-527.370] (-528.658) (-527.535) * (-527.785) (-529.311) (-528.618) [-529.819] -- 0:00:45
181000 -- (-528.171) (-531.564) [-528.865] (-532.172) * (-529.807) [-528.545] (-528.206) (-534.925) -- 0:00:45
181500 -- [-527.383] (-528.080) (-528.173) (-529.452) * (-529.312) (-527.759) [-528.268] (-529.895) -- 0:00:45
182000 -- (-528.957) (-526.930) (-529.625) [-530.788] * (-528.633) [-528.434] (-527.792) (-530.147) -- 0:00:44
182500 -- (-529.889) (-529.961) [-528.667] (-528.325) * [-527.994] (-528.779) (-529.695) (-529.618) -- 0:00:49
183000 -- [-529.642] (-529.550) (-529.612) (-528.963) * [-529.613] (-529.257) (-527.496) (-527.521) -- 0:00:49
183500 -- (-531.156) [-528.977] (-527.878) (-531.184) * (-528.881) (-528.972) [-531.227] (-533.284) -- 0:00:48
184000 -- (-528.136) (-531.639) (-528.707) [-528.124] * (-527.417) [-529.887] (-534.601) (-531.622) -- 0:00:48
184500 -- (-529.927) (-527.851) (-531.534) [-530.361] * (-527.380) (-529.126) [-529.306] (-528.753) -- 0:00:48
185000 -- (-528.496) (-526.945) (-533.085) [-529.177] * (-529.068) [-529.182] (-528.311) (-527.319) -- 0:00:48
Average standard deviation of split frequencies: 0.018275
185500 -- (-527.474) (-530.105) (-528.057) [-528.594] * (-531.603) (-528.912) [-527.041] (-527.902) -- 0:00:48
186000 -- (-528.158) [-527.331] (-529.416) (-529.179) * (-530.237) (-531.539) (-528.081) [-526.742] -- 0:00:48
186500 -- (-528.377) [-528.697] (-528.043) (-529.184) * (-533.432) [-527.747] (-530.252) (-527.130) -- 0:00:47
187000 -- (-527.609) [-528.827] (-529.966) (-527.902) * [-529.816] (-530.476) (-530.584) (-528.317) -- 0:00:47
187500 -- (-528.079) (-528.528) [-531.657] (-528.249) * (-527.387) (-528.855) [-530.066] (-526.596) -- 0:00:47
188000 -- (-528.413) [-528.300] (-529.682) (-528.537) * [-529.635] (-528.491) (-530.802) (-531.853) -- 0:00:47
188500 -- (-528.123) (-528.741) (-529.137) [-528.555] * (-531.569) (-530.409) [-530.643] (-533.779) -- 0:00:47
189000 -- (-528.817) [-528.118] (-527.367) (-527.007) * [-530.651] (-531.332) (-528.949) (-531.145) -- 0:00:47
189500 -- [-530.160] (-529.295) (-532.587) (-526.678) * (-530.769) (-527.543) (-528.756) [-528.769] -- 0:00:47
190000 -- (-530.494) [-531.567] (-526.849) (-529.757) * (-533.124) [-526.801] (-527.657) (-534.149) -- 0:00:46
Average standard deviation of split frequencies: 0.015875
190500 -- (-530.124) (-529.031) [-527.359] (-528.262) * (-531.608) [-529.385] (-528.530) (-530.011) -- 0:00:46
191000 -- (-529.870) [-527.094] (-527.073) (-527.077) * (-528.334) (-530.787) (-530.360) [-526.961] -- 0:00:46
191500 -- (-529.546) (-531.782) (-528.976) [-528.621] * (-528.645) (-529.415) (-530.735) [-527.306] -- 0:00:46
192000 -- [-529.848] (-531.413) (-528.520) (-529.514) * (-527.693) (-527.627) [-528.554] (-532.627) -- 0:00:46
192500 -- (-527.381) (-528.918) (-530.238) [-527.428] * (-526.961) (-527.915) [-527.346] (-527.550) -- 0:00:46
193000 -- (-528.487) (-533.174) (-527.922) [-528.413] * [-527.004] (-526.780) (-528.405) (-529.324) -- 0:00:45
193500 -- (-532.784) (-531.474) (-528.526) [-526.914] * (-527.366) [-528.147] (-526.905) (-527.674) -- 0:00:45
194000 -- (-531.034) [-528.213] (-527.385) (-527.672) * (-527.810) (-528.971) (-527.049) [-528.197] -- 0:00:45
194500 -- (-527.142) (-530.972) [-528.424] (-527.879) * (-528.476) [-530.369] (-527.118) (-530.196) -- 0:00:45
195000 -- (-528.717) [-532.854] (-533.051) (-530.736) * (-529.059) [-529.024] (-529.221) (-528.279) -- 0:00:45
Average standard deviation of split frequencies: 0.016583
195500 -- (-528.087) [-529.439] (-528.831) (-527.886) * (-528.488) [-527.462] (-529.664) (-529.594) -- 0:00:45
196000 -- (-531.446) (-528.171) (-527.171) [-527.194] * [-527.819] (-527.326) (-527.658) (-529.155) -- 0:00:45
196500 -- [-531.292] (-529.192) (-530.484) (-526.911) * (-532.353) [-527.805] (-528.467) (-527.413) -- 0:00:44
197000 -- (-532.813) (-529.617) (-527.207) [-530.083] * (-532.752) (-528.507) (-531.128) [-529.661] -- 0:00:48
197500 -- (-527.694) [-530.786] (-532.222) (-528.949) * (-527.899) (-529.261) [-532.041] (-530.153) -- 0:00:48
198000 -- (-529.870) [-534.621] (-529.767) (-528.491) * (-528.511) [-530.313] (-528.405) (-529.665) -- 0:00:48
198500 -- (-532.753) (-527.459) [-527.759] (-528.776) * (-530.940) (-531.080) (-528.919) [-527.855] -- 0:00:48
199000 -- (-527.780) (-528.991) (-527.702) [-529.612] * [-531.722] (-531.044) (-529.155) (-529.588) -- 0:00:48
199500 -- (-529.443) (-527.954) [-527.994] (-529.335) * (-527.393) (-531.394) (-529.262) [-529.887] -- 0:00:48
200000 -- [-528.372] (-528.079) (-527.228) (-530.484) * (-528.432) [-528.406] (-528.300) (-528.478) -- 0:00:48
Average standard deviation of split frequencies: 0.016705
200500 -- (-527.498) [-527.804] (-532.081) (-534.799) * [-529.855] (-531.570) (-527.472) (-527.577) -- 0:00:47
201000 -- (-530.027) [-527.965] (-530.127) (-529.881) * (-527.479) (-527.845) (-530.206) [-529.749] -- 0:00:47
201500 -- (-529.207) (-527.381) (-528.763) [-527.675] * (-534.123) (-530.121) (-527.214) [-529.174] -- 0:00:47
202000 -- (-530.238) (-527.683) [-530.281] (-531.227) * (-532.109) (-528.621) [-527.215] (-527.598) -- 0:00:47
202500 -- (-530.377) (-529.376) (-528.094) [-529.568] * (-528.291) [-530.147] (-528.424) (-528.384) -- 0:00:47
203000 -- (-530.369) (-529.876) (-529.837) [-529.844] * (-529.977) (-528.003) [-528.537] (-530.515) -- 0:00:47
203500 -- (-527.655) (-529.239) (-528.727) [-528.745] * (-530.825) (-528.956) (-528.553) [-530.863] -- 0:00:46
204000 -- (-527.098) (-531.053) [-527.081] (-529.459) * (-529.089) [-528.226] (-528.546) (-526.867) -- 0:00:46
204500 -- (-531.977) (-528.800) [-530.681] (-526.882) * (-528.172) [-530.238] (-530.402) (-528.044) -- 0:00:46
205000 -- (-532.822) (-526.423) (-530.058) [-527.333] * (-527.743) (-528.254) (-534.625) [-527.810] -- 0:00:46
Average standard deviation of split frequencies: 0.017223
205500 -- (-527.397) [-527.052] (-529.101) (-527.840) * (-526.940) (-528.578) (-529.467) [-527.266] -- 0:00:46
206000 -- (-526.844) (-528.850) [-530.664] (-527.289) * (-528.013) [-527.186] (-528.625) (-529.080) -- 0:00:46
206500 -- (-530.409) (-530.571) (-529.315) [-528.563] * (-527.177) (-526.623) [-526.928] (-528.800) -- 0:00:46
207000 -- (-527.071) (-528.469) [-532.832] (-528.585) * (-530.466) (-528.295) [-526.982] (-531.066) -- 0:00:45
207500 -- [-526.955] (-526.826) (-536.173) (-528.438) * (-530.549) (-531.007) [-526.944] (-528.407) -- 0:00:45
208000 -- [-527.828] (-526.713) (-528.383) (-528.585) * [-529.423] (-527.877) (-532.062) (-527.714) -- 0:00:45
208500 -- (-529.105) (-527.693) [-528.483] (-527.010) * [-529.635] (-528.132) (-529.669) (-526.731) -- 0:00:45
209000 -- (-529.835) [-526.918] (-529.240) (-528.414) * (-526.740) [-527.819] (-532.331) (-526.698) -- 0:00:45
209500 -- (-530.145) [-529.084] (-528.674) (-532.173) * (-528.802) [-529.360] (-528.519) (-527.847) -- 0:00:45
210000 -- (-530.032) [-530.221] (-529.451) (-530.503) * (-527.535) (-528.907) [-531.401] (-528.620) -- 0:00:45
Average standard deviation of split frequencies: 0.015104
210500 -- (-527.736) [-528.223] (-528.364) (-532.172) * [-527.399] (-528.876) (-528.299) (-528.726) -- 0:00:45
211000 -- (-529.590) (-530.184) (-527.227) [-530.705] * (-527.691) (-528.854) (-528.340) [-526.894] -- 0:00:44
211500 -- [-527.180] (-528.102) (-527.887) (-528.915) * (-527.302) [-529.684] (-527.795) (-529.926) -- 0:00:44
212000 -- (-527.149) [-527.292] (-529.311) (-529.359) * (-527.646) [-527.516] (-530.629) (-532.087) -- 0:00:44
212500 -- (-528.293) [-527.137] (-529.240) (-529.665) * [-527.114] (-527.673) (-529.772) (-529.018) -- 0:00:44
213000 -- (-529.696) (-527.594) (-529.216) [-532.011] * (-529.710) (-529.995) (-527.704) [-529.859] -- 0:00:44
213500 -- (-531.325) (-532.233) (-532.886) [-526.901] * [-528.945] (-528.297) (-527.826) (-530.548) -- 0:00:47
214000 -- (-531.404) [-528.506] (-530.656) (-526.720) * (-529.075) [-528.845] (-528.019) (-527.685) -- 0:00:47
214500 -- (-527.443) [-530.578] (-534.598) (-529.269) * (-530.412) (-530.161) [-529.036] (-529.174) -- 0:00:47
215000 -- (-526.704) (-530.488) (-530.484) [-528.472] * [-530.584] (-529.384) (-528.570) (-527.677) -- 0:00:47
Average standard deviation of split frequencies: 0.015507
215500 -- (-527.768) (-529.902) [-528.195] (-531.446) * (-529.661) (-529.182) (-530.258) [-528.497] -- 0:00:47
216000 -- [-528.466] (-527.569) (-528.856) (-530.863) * (-528.507) (-530.214) (-527.645) [-528.956] -- 0:00:47
216500 -- (-527.891) [-527.187] (-529.454) (-529.527) * [-530.238] (-529.290) (-527.926) (-529.489) -- 0:00:47
217000 -- (-529.115) (-531.255) (-527.995) [-529.953] * [-529.044] (-527.492) (-528.907) (-528.817) -- 0:00:46
217500 -- (-528.171) [-530.282] (-528.241) (-528.275) * (-529.037) (-528.890) [-529.005] (-529.868) -- 0:00:46
218000 -- [-527.320] (-534.690) (-528.749) (-532.804) * (-527.381) (-528.219) [-529.705] (-527.937) -- 0:00:46
218500 -- (-528.687) (-527.925) [-529.874] (-529.969) * (-530.518) [-529.999] (-533.694) (-529.992) -- 0:00:46
219000 -- (-530.165) (-528.762) [-528.931] (-527.241) * (-532.471) [-529.777] (-527.894) (-527.790) -- 0:00:46
219500 -- (-530.447) (-529.340) [-530.700] (-527.726) * (-532.818) [-530.466] (-530.425) (-529.226) -- 0:00:46
220000 -- (-527.146) (-530.616) (-531.374) [-528.465] * (-529.147) (-536.900) [-527.955] (-528.060) -- 0:00:46
Average standard deviation of split frequencies: 0.016129
220500 -- (-529.552) (-533.416) [-529.231] (-528.117) * (-528.845) (-527.208) (-529.964) [-530.162] -- 0:00:45
221000 -- (-528.492) (-527.113) [-527.661] (-530.668) * (-528.307) (-530.263) (-530.262) [-528.338] -- 0:00:45
221500 -- (-531.950) (-528.441) (-528.693) [-528.963] * (-528.929) (-534.170) [-530.078] (-527.580) -- 0:00:45
222000 -- (-527.939) (-531.508) [-527.628] (-531.367) * [-527.937] (-531.507) (-527.048) (-530.667) -- 0:00:45
222500 -- (-533.487) [-528.510] (-528.280) (-528.646) * (-530.949) (-531.116) [-527.357] (-529.451) -- 0:00:45
223000 -- (-530.734) (-528.740) [-528.183] (-528.099) * (-530.211) (-528.465) [-527.855] (-529.391) -- 0:00:45
223500 -- [-527.128] (-529.376) (-528.446) (-531.110) * (-530.514) [-527.235] (-531.249) (-528.103) -- 0:00:45
224000 -- (-527.910) (-527.459) (-530.504) [-529.479] * (-531.041) (-529.355) (-531.367) [-527.675] -- 0:00:45
224500 -- (-527.605) (-528.492) (-531.871) [-528.018] * (-529.438) (-532.725) [-528.713] (-527.098) -- 0:00:44
225000 -- (-529.647) (-528.851) (-529.535) [-527.565] * (-526.865) [-533.475] (-528.722) (-529.148) -- 0:00:44
Average standard deviation of split frequencies: 0.017730
225500 -- (-529.780) (-529.967) [-528.140] (-526.733) * (-533.050) [-529.872] (-527.390) (-528.009) -- 0:00:44
226000 -- (-530.380) (-533.503) (-527.208) [-531.170] * (-530.443) [-529.893] (-529.216) (-528.299) -- 0:00:44
226500 -- [-527.345] (-529.754) (-530.480) (-530.437) * [-528.313] (-528.535) (-530.534) (-528.985) -- 0:00:44
227000 -- (-527.094) [-527.317] (-531.405) (-529.634) * [-530.452] (-527.640) (-531.304) (-527.752) -- 0:00:44
227500 -- (-527.359) (-528.213) (-534.799) [-529.957] * (-528.676) (-526.759) (-528.250) [-527.047] -- 0:00:44
228000 -- (-527.206) (-530.282) (-527.671) [-530.650] * (-528.811) (-531.852) (-527.504) [-533.508] -- 0:00:44
228500 -- (-528.264) (-529.351) (-527.516) [-531.191] * [-528.464] (-532.927) (-529.706) (-528.145) -- 0:00:43
229000 -- (-528.602) [-529.176] (-530.839) (-530.011) * [-527.611] (-533.203) (-530.788) (-530.532) -- 0:00:43
229500 -- (-530.067) (-528.924) [-530.498] (-528.296) * [-528.057] (-530.283) (-529.438) (-530.754) -- 0:00:43
230000 -- (-527.458) (-527.426) (-532.835) [-528.669] * (-527.548) [-530.601] (-534.708) (-529.101) -- 0:00:46
Average standard deviation of split frequencies: 0.016962
230500 -- (-528.317) (-529.753) (-538.500) [-526.962] * (-528.543) (-529.433) [-531.038] (-530.902) -- 0:00:46
231000 -- [-529.444] (-529.962) (-527.524) (-529.770) * [-527.161] (-533.279) (-529.776) (-532.837) -- 0:00:46
231500 -- (-526.967) (-529.430) [-527.794] (-528.777) * (-531.018) [-532.992] (-527.603) (-529.544) -- 0:00:46
232000 -- [-529.107] (-528.757) (-527.044) (-528.305) * (-529.925) (-529.703) (-528.190) [-527.725] -- 0:00:46
232500 -- (-530.751) (-528.365) [-530.905] (-526.924) * (-527.881) (-531.179) [-532.130] (-531.847) -- 0:00:46
233000 -- (-527.193) (-537.527) [-530.095] (-528.267) * (-527.714) [-528.308] (-529.948) (-531.162) -- 0:00:46
233500 -- [-527.104] (-532.463) (-530.125) (-529.521) * (-532.385) [-528.170] (-527.071) (-529.697) -- 0:00:45
234000 -- (-530.135) [-530.913] (-527.328) (-531.466) * (-529.759) (-529.089) [-527.794] (-527.052) -- 0:00:45
234500 -- (-529.098) (-530.816) [-526.782] (-528.726) * (-531.584) [-529.012] (-528.236) (-527.091) -- 0:00:45
235000 -- (-533.820) (-529.111) [-526.789] (-528.853) * (-533.262) (-529.978) [-528.777] (-528.438) -- 0:00:45
Average standard deviation of split frequencies: 0.016779
235500 -- (-527.181) [-527.534] (-529.117) (-527.476) * [-529.690] (-532.597) (-529.544) (-528.224) -- 0:00:45
236000 -- [-528.281] (-528.865) (-530.337) (-527.293) * [-527.214] (-529.907) (-531.498) (-527.989) -- 0:00:45
236500 -- (-527.633) (-528.643) [-532.030] (-527.818) * (-528.173) (-528.450) (-529.316) [-528.175] -- 0:00:45
237000 -- [-528.013] (-529.641) (-528.755) (-526.727) * (-530.056) [-531.842] (-532.871) (-528.894) -- 0:00:45
237500 -- [-527.110] (-528.292) (-531.749) (-529.513) * (-528.009) (-529.676) (-531.098) [-527.247] -- 0:00:44
238000 -- (-530.588) (-530.987) [-530.119] (-526.911) * (-528.535) (-527.860) (-531.397) [-527.510] -- 0:00:44
238500 -- (-527.151) [-528.073] (-527.912) (-531.367) * (-527.885) (-527.731) (-527.455) [-528.608] -- 0:00:44
239000 -- (-531.490) (-527.914) [-531.383] (-527.983) * [-527.994] (-528.098) (-528.857) (-530.336) -- 0:00:44
239500 -- (-530.035) (-528.204) [-528.540] (-527.579) * [-528.900] (-529.019) (-528.162) (-526.641) -- 0:00:44
240000 -- (-528.661) (-529.998) (-528.112) [-527.772] * [-530.833] (-529.012) (-530.264) (-533.204) -- 0:00:44
Average standard deviation of split frequencies: 0.017335
240500 -- (-528.270) [-530.237] (-530.403) (-528.022) * (-529.018) [-527.066] (-527.557) (-528.083) -- 0:00:44
241000 -- [-528.084] (-530.812) (-527.777) (-528.857) * (-529.808) [-528.100] (-530.550) (-528.921) -- 0:00:44
241500 -- (-534.908) (-527.362) (-529.414) [-528.919] * (-530.258) [-528.119] (-526.790) (-530.086) -- 0:00:43
242000 -- (-528.402) (-528.130) (-537.024) [-527.678] * [-530.594] (-533.075) (-528.531) (-530.448) -- 0:00:43
242500 -- (-528.031) [-531.628] (-532.146) (-528.330) * [-527.364] (-527.532) (-530.414) (-530.828) -- 0:00:43
243000 -- (-527.373) (-530.362) [-530.166] (-529.883) * (-528.020) [-527.087] (-528.471) (-528.287) -- 0:00:43
243500 -- [-529.858] (-529.111) (-527.480) (-527.974) * (-530.380) (-528.440) [-530.105] (-529.995) -- 0:00:43
244000 -- [-527.975] (-527.554) (-528.196) (-531.921) * [-529.030] (-527.996) (-531.140) (-529.689) -- 0:00:43
244500 -- (-527.885) (-528.427) (-527.017) [-530.843] * (-529.995) (-527.910) (-529.594) [-529.213] -- 0:00:43
245000 -- (-530.579) (-530.931) (-529.833) [-529.857] * (-529.452) [-530.407] (-529.713) (-530.577) -- 0:00:43
Average standard deviation of split frequencies: 0.017821
245500 -- [-527.572] (-527.588) (-531.367) (-529.882) * [-531.465] (-534.094) (-528.042) (-530.553) -- 0:00:43
246000 -- (-527.491) (-529.288) (-528.243) [-529.010] * (-527.845) (-531.876) [-528.326] (-528.563) -- 0:00:42
246500 -- (-527.960) [-530.559] (-532.467) (-527.820) * (-528.775) (-529.452) (-527.270) [-534.824] -- 0:00:45
247000 -- [-528.834] (-530.932) (-533.032) (-527.236) * [-531.069] (-527.981) (-528.030) (-529.244) -- 0:00:45
247500 -- [-527.521] (-529.639) (-528.818) (-530.314) * (-530.507) (-527.643) (-528.422) [-529.310] -- 0:00:45
248000 -- (-528.528) (-529.204) (-534.233) [-530.111] * (-529.159) [-529.086] (-529.342) (-527.283) -- 0:00:45
248500 -- [-527.841] (-526.889) (-531.641) (-530.581) * (-529.100) [-527.877] (-528.909) (-527.299) -- 0:00:45
249000 -- (-528.939) [-526.791] (-528.788) (-529.031) * (-532.386) (-529.415) [-527.334] (-527.580) -- 0:00:45
249500 -- (-528.252) (-530.584) (-533.295) [-529.112] * (-534.558) (-527.753) [-527.558] (-528.024) -- 0:00:45
250000 -- (-532.827) [-527.426] (-534.168) (-530.924) * (-530.223) [-528.517] (-527.422) (-527.619) -- 0:00:45
Average standard deviation of split frequencies: 0.017490
250500 -- (-527.900) (-529.158) (-526.861) [-530.171] * (-530.280) (-530.856) (-528.283) [-529.610] -- 0:00:44
251000 -- [-530.090] (-528.695) (-526.573) (-529.135) * (-530.412) [-528.037] (-531.966) (-531.009) -- 0:00:44
251500 -- [-530.320] (-532.010) (-527.813) (-527.131) * (-528.979) (-529.278) (-528.685) [-529.648] -- 0:00:44
252000 -- (-529.957) [-532.530] (-531.254) (-527.323) * (-532.529) [-527.956] (-528.133) (-529.804) -- 0:00:44
252500 -- (-528.695) (-527.666) (-528.031) [-528.344] * (-533.268) (-527.867) [-526.566] (-530.492) -- 0:00:44
253000 -- (-535.620) (-527.694) [-530.460] (-526.813) * (-529.421) (-528.383) (-530.722) [-527.580] -- 0:00:44
253500 -- (-531.052) [-527.725] (-529.831) (-528.560) * [-530.901] (-533.013) (-530.115) (-529.533) -- 0:00:44
254000 -- (-529.668) (-528.379) [-527.765] (-526.929) * (-526.761) [-529.707] (-531.920) (-528.393) -- 0:00:44
254500 -- (-528.206) (-528.732) [-527.687] (-529.094) * (-528.579) (-530.487) (-528.487) [-528.152] -- 0:00:43
255000 -- (-528.928) [-527.503] (-533.257) (-530.172) * (-529.299) (-529.905) [-527.509] (-528.624) -- 0:00:43
Average standard deviation of split frequencies: 0.017362
255500 -- (-527.977) (-527.358) (-527.005) [-533.593] * (-526.638) [-528.812] (-529.050) (-529.421) -- 0:00:43
256000 -- (-528.468) (-530.323) [-527.086] (-528.712) * [-529.730] (-529.611) (-527.737) (-528.200) -- 0:00:43
256500 -- (-527.667) (-528.778) [-528.195] (-527.557) * [-527.366] (-532.439) (-527.290) (-527.517) -- 0:00:43
257000 -- (-533.637) (-529.388) [-529.728] (-530.003) * (-527.399) (-533.856) (-528.259) [-529.244] -- 0:00:43
257500 -- (-528.000) (-531.038) (-533.685) [-530.062] * [-527.486] (-529.680) (-531.349) (-528.049) -- 0:00:43
258000 -- (-531.423) (-529.562) (-528.589) [-528.089] * (-528.667) (-529.837) [-527.306] (-533.595) -- 0:00:43
258500 -- (-534.282) (-528.246) [-527.788] (-529.625) * (-526.892) (-533.612) (-528.163) [-529.893] -- 0:00:43
259000 -- (-528.326) (-529.113) (-530.028) [-527.668] * (-530.754) [-528.907] (-530.643) (-529.048) -- 0:00:42
259500 -- (-528.339) (-534.930) [-529.712] (-526.729) * [-531.402] (-528.075) (-528.584) (-526.754) -- 0:00:42
260000 -- (-528.840) (-527.866) [-529.549] (-528.907) * [-527.722] (-530.531) (-528.759) (-527.594) -- 0:00:42
Average standard deviation of split frequencies: 0.018510
260500 -- (-533.201) (-529.049) (-528.322) [-529.180] * (-528.013) (-527.485) (-532.652) [-526.919] -- 0:00:42
261000 -- (-532.280) [-531.577] (-530.736) (-527.637) * (-529.983) (-528.501) (-530.476) [-529.225] -- 0:00:42
261500 -- (-531.224) (-531.042) [-528.609] (-527.382) * [-528.376] (-528.200) (-531.944) (-529.010) -- 0:00:42
262000 -- [-530.954] (-527.147) (-530.995) (-533.230) * [-527.077] (-530.358) (-528.511) (-530.091) -- 0:00:42
262500 -- (-528.377) (-529.028) (-529.365) [-529.691] * (-528.684) [-528.471] (-527.704) (-529.848) -- 0:00:42
263000 -- (-528.997) [-531.880] (-528.452) (-528.330) * (-529.871) [-527.268] (-527.480) (-529.669) -- 0:00:44
263500 -- (-527.033) (-528.687) [-527.982] (-527.816) * (-528.257) (-528.648) [-527.471] (-530.421) -- 0:00:44
264000 -- (-526.827) [-529.214] (-527.698) (-527.864) * (-527.718) (-529.205) [-528.328] (-529.086) -- 0:00:44
264500 -- (-531.573) [-528.511] (-527.764) (-528.753) * [-529.523] (-531.207) (-529.673) (-529.405) -- 0:00:44
265000 -- (-528.916) [-528.853] (-527.594) (-528.123) * [-529.510] (-531.316) (-527.926) (-530.118) -- 0:00:44
Average standard deviation of split frequencies: 0.016119
265500 -- (-527.755) (-531.149) [-527.083] (-528.307) * [-528.635] (-529.570) (-530.099) (-528.708) -- 0:00:44
266000 -- (-536.010) (-532.345) (-527.926) [-530.745] * (-529.524) (-528.663) [-529.390] (-531.894) -- 0:00:44
266500 -- (-534.319) [-528.630] (-528.889) (-531.370) * [-528.218] (-530.286) (-528.055) (-530.154) -- 0:00:44
267000 -- (-531.184) [-533.963] (-530.136) (-531.878) * [-527.278] (-527.723) (-530.246) (-527.599) -- 0:00:43
267500 -- [-526.774] (-528.264) (-529.603) (-527.496) * (-529.011) [-528.953] (-527.881) (-531.434) -- 0:00:43
268000 -- (-527.145) (-528.369) (-528.353) [-529.030] * (-530.614) [-529.147] (-530.303) (-529.023) -- 0:00:43
268500 -- (-528.367) [-527.300] (-528.040) (-527.908) * [-531.707] (-528.004) (-527.524) (-529.139) -- 0:00:43
269000 -- (-528.517) [-528.544] (-529.455) (-529.665) * (-528.040) [-529.408] (-529.669) (-533.719) -- 0:00:43
269500 -- [-530.116] (-531.716) (-528.581) (-527.509) * [-527.725] (-528.616) (-527.829) (-530.589) -- 0:00:43
270000 -- [-527.013] (-530.919) (-529.120) (-528.767) * (-532.837) [-529.977] (-527.989) (-529.949) -- 0:00:43
Average standard deviation of split frequencies: 0.016110
270500 -- (-531.916) (-528.366) (-531.618) [-530.501] * (-531.447) (-527.825) (-531.269) [-527.219] -- 0:00:43
271000 -- (-527.741) (-530.101) [-528.235] (-529.527) * [-528.793] (-527.182) (-528.251) (-527.635) -- 0:00:43
271500 -- (-526.679) [-527.834] (-528.210) (-528.228) * (-528.160) (-529.918) (-527.047) [-530.893] -- 0:00:42
272000 -- (-528.190) (-532.224) [-531.218] (-527.932) * [-529.561] (-527.670) (-527.457) (-528.805) -- 0:00:42
272500 -- [-530.979] (-530.740) (-528.615) (-531.171) * (-530.277) (-529.970) [-530.601] (-527.512) -- 0:00:42
273000 -- (-527.187) (-528.856) [-528.117] (-531.555) * (-529.200) [-530.386] (-528.666) (-530.646) -- 0:00:42
273500 -- (-526.873) [-528.957] (-531.023) (-527.681) * (-528.763) (-526.881) (-529.372) [-530.040] -- 0:00:42
274000 -- (-528.426) [-528.557] (-528.965) (-527.133) * (-529.914) [-526.888] (-530.789) (-528.781) -- 0:00:42
274500 -- [-527.721] (-530.108) (-529.580) (-526.773) * [-527.583] (-528.476) (-528.657) (-529.750) -- 0:00:42
275000 -- [-527.478] (-529.198) (-528.236) (-529.093) * (-532.146) (-527.479) [-529.589] (-528.216) -- 0:00:42
Average standard deviation of split frequencies: 0.014473
275500 -- (-528.117) [-529.832] (-527.409) (-527.692) * (-531.681) [-528.244] (-541.121) (-528.631) -- 0:00:42
276000 -- (-529.133) (-528.241) (-528.434) [-530.878] * (-531.229) (-530.304) [-532.581] (-527.173) -- 0:00:41
276500 -- [-531.614] (-529.719) (-531.373) (-529.246) * (-529.052) (-528.347) [-530.308] (-529.644) -- 0:00:41
277000 -- (-530.218) (-529.376) (-530.720) [-526.951] * (-528.333) [-527.777] (-527.591) (-529.488) -- 0:00:41
277500 -- (-530.286) (-531.014) [-528.276] (-528.826) * (-529.790) (-534.294) [-528.672] (-529.382) -- 0:00:41
278000 -- (-528.301) (-530.549) (-528.947) [-527.507] * (-527.622) (-534.046) [-527.878] (-528.125) -- 0:00:41
278500 -- (-532.449) (-532.460) [-528.249] (-528.704) * (-532.893) (-529.917) [-529.059] (-529.818) -- 0:00:41
279000 -- (-529.277) (-530.976) [-532.946] (-528.142) * (-531.326) (-530.878) [-528.466] (-528.491) -- 0:00:41
279500 -- (-527.398) (-527.509) [-529.314] (-530.259) * [-529.004] (-531.263) (-534.745) (-532.292) -- 0:00:41
280000 -- (-528.073) (-528.129) (-529.882) [-529.004] * (-530.102) (-528.254) (-531.844) [-529.977] -- 0:00:43
Average standard deviation of split frequencies: 0.013260
280500 -- (-528.162) [-531.241] (-537.432) (-527.865) * (-528.288) [-528.396] (-529.581) (-529.700) -- 0:00:43
281000 -- (-529.369) (-529.092) [-530.264] (-528.455) * (-526.716) (-528.028) [-527.761] (-534.516) -- 0:00:43
281500 -- (-527.799) (-528.577) [-528.725] (-527.387) * (-530.855) [-530.178] (-526.961) (-529.803) -- 0:00:43
282000 -- [-527.620] (-528.546) (-528.784) (-528.619) * [-530.123] (-529.239) (-529.051) (-528.904) -- 0:00:43
282500 -- (-527.935) (-528.596) [-528.330] (-530.007) * (-528.942) [-527.011] (-530.494) (-527.327) -- 0:00:43
283000 -- (-529.132) (-529.938) (-529.770) [-529.365] * (-528.630) [-528.802] (-528.575) (-528.746) -- 0:00:43
283500 -- [-527.873] (-529.437) (-527.337) (-529.152) * (-531.563) [-528.981] (-528.279) (-528.584) -- 0:00:42
284000 -- (-527.877) (-528.958) [-532.272] (-530.099) * (-528.204) (-529.862) [-528.585] (-529.142) -- 0:00:42
284500 -- [-528.154] (-529.160) (-530.948) (-529.902) * (-528.459) [-527.646] (-528.357) (-528.245) -- 0:00:42
285000 -- (-528.053) [-529.249] (-526.763) (-529.633) * (-530.300) (-529.138) (-527.261) [-526.706] -- 0:00:42
Average standard deviation of split frequencies: 0.013186
285500 -- (-527.816) [-527.547] (-528.082) (-527.214) * (-527.678) (-529.041) [-529.619] (-527.118) -- 0:00:42
286000 -- (-529.327) (-530.195) (-532.203) [-528.751] * (-527.016) [-527.083] (-527.925) (-531.216) -- 0:00:42
286500 -- [-528.984] (-532.479) (-526.783) (-528.364) * (-528.663) (-527.407) (-529.972) [-528.916] -- 0:00:42
287000 -- (-528.308) (-528.893) (-527.419) [-530.781] * [-529.897] (-526.922) (-528.767) (-528.830) -- 0:00:42
287500 -- (-527.935) (-530.705) (-531.430) [-531.822] * (-530.740) (-526.833) (-528.794) [-528.089] -- 0:00:42
288000 -- (-529.269) (-529.886) [-528.611] (-528.421) * [-531.162] (-531.813) (-530.067) (-526.980) -- 0:00:42
288500 -- (-532.109) (-530.257) (-527.804) [-526.843] * (-527.626) [-532.799] (-527.795) (-528.153) -- 0:00:41
289000 -- [-530.719] (-527.980) (-529.139) (-529.192) * (-527.999) (-528.262) (-527.022) [-529.464] -- 0:00:41
289500 -- (-531.718) [-528.875] (-528.856) (-530.308) * (-529.539) [-530.627] (-533.101) (-530.448) -- 0:00:41
290000 -- (-528.526) (-530.404) (-528.638) [-529.375] * (-528.748) (-530.567) [-530.018] (-532.392) -- 0:00:41
Average standard deviation of split frequencies: 0.014434
290500 -- (-527.901) (-527.966) (-529.250) [-527.959] * (-535.770) [-527.835] (-528.705) (-527.737) -- 0:00:41
291000 -- (-528.860) (-528.120) (-532.275) [-527.767] * (-528.660) [-532.011] (-528.150) (-527.740) -- 0:00:41
291500 -- (-529.256) (-528.373) (-526.938) [-527.690] * (-530.575) [-528.444] (-532.278) (-527.441) -- 0:00:41
292000 -- (-530.172) (-528.200) (-528.623) [-529.412] * (-529.223) (-532.695) [-533.017] (-529.694) -- 0:00:41
292500 -- (-529.086) (-531.068) [-529.424] (-527.546) * (-529.006) (-528.913) [-528.429] (-529.759) -- 0:00:41
293000 -- (-527.519) (-527.660) [-528.665] (-527.324) * (-529.809) (-533.282) (-527.661) [-529.377] -- 0:00:41
293500 -- (-528.902) (-529.176) (-532.311) [-527.490] * [-533.888] (-529.714) (-528.753) (-530.418) -- 0:00:40
294000 -- [-528.641] (-526.745) (-533.916) (-527.883) * (-528.787) [-531.584] (-528.703) (-529.918) -- 0:00:40
294500 -- (-529.662) (-528.659) [-529.787] (-529.520) * (-528.391) (-532.665) [-529.283] (-528.744) -- 0:00:40
295000 -- (-530.397) [-528.139] (-530.629) (-529.127) * (-526.958) (-529.681) [-527.931] (-527.600) -- 0:00:40
Average standard deviation of split frequencies: 0.013625
295500 -- (-526.934) (-532.080) (-526.521) [-528.360] * (-527.966) (-528.585) [-528.483] (-531.224) -- 0:00:40
296000 -- (-529.913) (-529.009) [-530.152] (-527.466) * (-528.124) [-529.923] (-527.157) (-530.459) -- 0:00:40
296500 -- (-530.749) (-527.800) [-529.413] (-531.701) * (-529.496) [-528.238] (-528.199) (-529.976) -- 0:00:40
297000 -- (-528.677) (-527.452) (-529.877) [-529.915] * (-528.630) [-529.265] (-527.827) (-527.050) -- 0:00:42
297500 -- (-532.090) (-527.577) (-529.699) [-528.213] * (-529.414) (-527.285) (-529.455) [-527.157] -- 0:00:42
298000 -- (-531.105) (-527.709) [-526.864] (-531.542) * (-528.482) (-527.758) (-528.324) [-528.825] -- 0:00:42
298500 -- (-535.188) (-530.854) (-527.447) [-529.861] * (-530.504) (-531.651) (-529.613) [-531.616] -- 0:00:42
299000 -- (-532.333) [-527.828] (-527.263) (-530.713) * [-528.796] (-529.451) (-528.474) (-532.609) -- 0:00:42
299500 -- (-531.185) (-530.836) [-531.876] (-528.351) * (-528.138) [-527.011] (-529.045) (-529.153) -- 0:00:42
300000 -- (-529.179) (-527.607) (-531.331) [-528.331] * (-529.655) [-529.899] (-529.851) (-527.229) -- 0:00:42
Average standard deviation of split frequencies: 0.014572
300500 -- (-528.719) (-528.094) [-529.363] (-532.823) * (-530.926) [-530.662] (-529.089) (-528.355) -- 0:00:41
301000 -- (-527.782) (-531.338) (-529.764) [-529.981] * (-531.977) (-531.267) (-527.985) [-527.851] -- 0:00:41
301500 -- (-532.420) [-527.114] (-530.270) (-532.559) * (-531.004) (-529.312) [-529.789] (-529.126) -- 0:00:41
302000 -- (-529.081) (-527.724) (-532.667) [-530.042] * (-529.674) [-527.680] (-529.089) (-529.033) -- 0:00:41
302500 -- (-531.237) (-532.258) (-527.926) [-527.271] * (-528.304) [-528.213] (-530.364) (-526.644) -- 0:00:41
303000 -- [-530.089] (-531.754) (-527.876) (-529.464) * (-528.035) (-528.083) (-530.418) [-531.382] -- 0:00:41
303500 -- (-528.724) [-529.732] (-530.114) (-528.474) * [-533.079] (-527.325) (-527.150) (-528.248) -- 0:00:41
304000 -- (-529.990) [-527.247] (-527.351) (-530.478) * (-530.393) [-527.735] (-527.785) (-529.439) -- 0:00:41
304500 -- (-527.887) [-529.424] (-533.412) (-528.984) * [-533.393] (-528.337) (-532.119) (-527.445) -- 0:00:41
305000 -- (-529.144) (-529.314) [-531.189] (-531.181) * (-530.130) (-529.156) [-529.843] (-528.902) -- 0:00:41
Average standard deviation of split frequencies: 0.014027
305500 -- (-527.505) (-527.164) [-532.077] (-530.824) * (-532.538) [-527.760] (-532.951) (-526.894) -- 0:00:40
306000 -- (-526.837) [-530.856] (-530.877) (-527.583) * (-534.935) [-528.695] (-529.535) (-531.569) -- 0:00:40
306500 -- (-529.166) [-527.501] (-531.033) (-533.876) * (-531.699) [-529.916] (-528.977) (-531.346) -- 0:00:40
307000 -- (-529.556) [-527.023] (-530.328) (-526.730) * (-530.530) [-527.864] (-530.581) (-531.599) -- 0:00:40
307500 -- [-529.296] (-527.099) (-529.003) (-532.913) * (-531.530) (-528.341) (-527.552) [-528.228] -- 0:00:40
308000 -- (-527.379) (-529.346) [-527.390] (-528.415) * (-528.214) (-527.877) [-528.938] (-530.462) -- 0:00:40
308500 -- [-530.408] (-530.641) (-533.032) (-531.806) * (-531.377) [-527.631] (-528.851) (-531.904) -- 0:00:40
309000 -- (-530.087) (-530.784) [-529.589] (-534.897) * (-529.669) (-530.594) [-530.510] (-527.281) -- 0:00:40
309500 -- [-527.920] (-528.162) (-526.610) (-537.748) * (-529.742) [-528.416] (-527.785) (-527.795) -- 0:00:40
310000 -- (-528.737) [-526.953] (-528.640) (-530.869) * (-531.090) [-527.556] (-528.272) (-527.444) -- 0:00:40
Average standard deviation of split frequencies: 0.014775
310500 -- (-529.289) [-535.253] (-528.414) (-528.050) * (-534.339) (-528.329) [-528.090] (-527.539) -- 0:00:39
311000 -- (-529.052) (-532.740) [-527.139] (-527.142) * (-527.976) (-528.842) (-527.877) [-528.349] -- 0:00:39
311500 -- (-533.098) (-529.235) [-528.204] (-527.294) * (-529.862) (-528.994) [-529.574] (-527.127) -- 0:00:39
312000 -- (-532.979) [-530.943] (-526.808) (-528.294) * (-528.581) [-527.039] (-529.354) (-526.853) -- 0:00:39
312500 -- (-528.651) [-531.566] (-526.950) (-528.299) * (-529.708) (-529.159) (-528.861) [-528.955] -- 0:00:39
313000 -- (-528.307) (-527.312) (-526.903) [-528.471] * [-527.594] (-529.969) (-528.311) (-528.244) -- 0:00:39
313500 -- [-528.407] (-527.986) (-528.435) (-527.537) * [-526.862] (-529.130) (-528.637) (-531.305) -- 0:00:41
314000 -- (-529.183) [-529.948] (-527.450) (-528.040) * (-529.736) (-528.450) (-528.945) [-531.876] -- 0:00:41
314500 -- [-530.411] (-529.090) (-530.066) (-528.006) * (-529.119) (-529.229) (-529.109) [-527.701] -- 0:00:41
315000 -- (-529.895) [-529.786] (-532.059) (-530.501) * (-528.128) (-527.011) [-527.759] (-528.365) -- 0:00:41
Average standard deviation of split frequencies: 0.014918
315500 -- [-532.524] (-529.859) (-530.420) (-529.101) * (-530.037) (-528.078) (-529.334) [-526.871] -- 0:00:41
316000 -- [-532.388] (-529.295) (-529.746) (-533.185) * (-527.936) (-528.825) [-526.734] (-528.483) -- 0:00:41
316500 -- [-527.967] (-527.930) (-530.414) (-532.654) * (-530.883) [-529.148] (-528.412) (-527.906) -- 0:00:41
317000 -- (-528.491) (-526.691) (-528.927) [-527.743] * (-527.017) (-532.193) (-527.770) [-529.081] -- 0:00:40
317500 -- (-529.023) (-533.675) (-531.507) [-527.740] * (-529.690) (-531.051) [-527.790] (-530.792) -- 0:00:40
318000 -- [-528.664] (-534.725) (-527.584) (-529.776) * (-529.470) [-529.460] (-531.870) (-530.152) -- 0:00:40
318500 -- [-528.764] (-527.987) (-528.335) (-527.872) * [-530.367] (-528.481) (-528.567) (-528.947) -- 0:00:40
319000 -- [-528.549] (-528.128) (-529.655) (-527.074) * (-531.425) [-529.330] (-528.848) (-527.926) -- 0:00:40
319500 -- (-528.452) (-529.186) [-528.535] (-531.149) * (-530.952) (-527.876) [-527.692] (-527.602) -- 0:00:40
320000 -- (-528.077) (-530.913) [-529.628] (-527.142) * [-530.701] (-528.087) (-527.920) (-527.509) -- 0:00:40
Average standard deviation of split frequencies: 0.015474
320500 -- (-529.722) (-530.036) [-529.726] (-527.709) * (-532.102) (-527.495) (-527.321) [-529.493] -- 0:00:40
321000 -- (-531.093) (-529.945) [-530.613] (-527.686) * (-527.564) [-528.864] (-527.670) (-527.546) -- 0:00:40
321500 -- (-531.648) (-528.067) (-527.349) [-528.284] * [-530.393] (-529.715) (-528.190) (-528.685) -- 0:00:40
322000 -- (-528.903) [-527.597] (-526.760) (-528.179) * (-527.981) (-530.458) [-527.637] (-530.346) -- 0:00:40
322500 -- (-529.361) (-528.192) (-527.940) [-527.325] * (-527.310) (-530.167) [-527.463] (-527.078) -- 0:00:39
323000 -- (-532.200) [-529.084] (-532.483) (-528.253) * (-530.957) (-528.341) (-528.828) [-528.186] -- 0:00:39
323500 -- (-529.305) (-530.467) [-530.723] (-532.725) * (-527.830) (-528.366) [-527.498] (-528.027) -- 0:00:39
324000 -- (-532.948) (-530.095) [-530.190] (-527.827) * (-528.121) [-531.327] (-528.787) (-529.924) -- 0:00:39
324500 -- [-530.296] (-529.054) (-530.655) (-529.137) * [-528.267] (-527.819) (-531.331) (-530.507) -- 0:00:39
325000 -- (-537.357) (-529.980) (-528.314) [-528.976] * (-531.076) (-531.123) (-529.281) [-530.643] -- 0:00:39
Average standard deviation of split frequencies: 0.015526
325500 -- (-528.873) (-529.434) [-528.347] (-529.277) * (-529.532) (-528.788) (-526.802) [-527.565] -- 0:00:39
326000 -- (-527.764) (-528.083) [-528.518] (-526.899) * (-530.034) (-528.716) (-527.681) [-530.274] -- 0:00:39
326500 -- (-530.181) (-528.459) [-527.989] (-529.013) * [-528.201] (-528.300) (-527.016) (-529.758) -- 0:00:39
327000 -- (-531.487) (-527.602) [-529.096] (-528.036) * (-526.670) (-538.459) [-530.655] (-527.223) -- 0:00:39
327500 -- (-532.397) (-530.777) (-527.947) [-530.468] * (-531.306) (-528.671) [-527.641] (-527.339) -- 0:00:39
328000 -- (-528.065) [-527.054] (-529.031) (-529.344) * (-527.832) (-528.426) (-530.336) [-527.099] -- 0:00:38
328500 -- (-526.533) (-526.876) [-527.277] (-527.383) * [-526.816] (-528.481) (-528.340) (-529.024) -- 0:00:38
329000 -- (-528.789) (-526.876) (-528.792) [-527.674] * (-528.396) (-531.044) [-527.720] (-530.526) -- 0:00:38
329500 -- (-529.463) (-527.396) [-528.551] (-532.162) * [-526.956] (-529.778) (-527.499) (-533.565) -- 0:00:38
330000 -- (-527.634) [-529.303] (-539.726) (-529.229) * (-527.524) (-529.230) (-530.120) [-530.411] -- 0:00:40
Average standard deviation of split frequencies: 0.014890
330500 -- [-528.014] (-530.625) (-534.766) (-527.682) * [-529.859] (-526.990) (-529.157) (-532.534) -- 0:00:40
331000 -- [-530.606] (-530.560) (-532.871) (-528.407) * (-533.061) (-528.468) (-527.871) [-529.630] -- 0:00:40
331500 -- (-530.434) (-526.700) [-531.134] (-528.158) * (-531.097) [-528.340] (-530.007) (-527.246) -- 0:00:40
332000 -- (-529.515) (-527.100) (-528.876) [-527.236] * (-528.297) (-529.214) [-529.294] (-530.668) -- 0:00:40
332500 -- (-528.592) [-526.774] (-527.769) (-527.906) * (-527.387) (-528.367) (-529.264) [-527.254] -- 0:00:40
333000 -- [-530.340] (-528.670) (-529.951) (-530.117) * (-528.149) (-534.708) [-528.151] (-528.326) -- 0:00:40
333500 -- (-529.830) [-529.764] (-529.210) (-529.640) * (-528.533) [-527.854] (-532.433) (-530.953) -- 0:00:39
334000 -- (-529.912) [-528.902] (-529.122) (-530.732) * (-528.443) [-528.173] (-529.345) (-529.394) -- 0:00:39
334500 -- (-529.011) [-529.022] (-530.899) (-530.842) * (-527.900) [-527.147] (-528.184) (-531.160) -- 0:00:39
335000 -- (-533.266) (-531.291) [-531.694] (-531.150) * (-533.223) [-529.667] (-533.837) (-529.098) -- 0:00:39
Average standard deviation of split frequencies: 0.014420
335500 -- (-529.602) (-531.744) [-529.838] (-528.724) * (-528.484) [-529.422] (-530.046) (-527.788) -- 0:00:39
336000 -- (-528.853) (-531.169) (-531.092) [-529.522] * [-527.122] (-528.357) (-528.695) (-529.681) -- 0:00:39
336500 -- (-527.640) (-529.070) (-528.978) [-529.397] * (-527.342) (-528.585) [-528.365] (-527.267) -- 0:00:39
337000 -- [-526.672] (-528.471) (-531.391) (-529.034) * [-528.501] (-534.699) (-527.178) (-529.863) -- 0:00:39
337500 -- (-532.095) [-528.717] (-532.368) (-530.504) * [-527.380] (-530.040) (-527.910) (-531.157) -- 0:00:39
338000 -- [-527.948] (-530.499) (-531.430) (-529.552) * (-528.252) (-527.682) [-527.307] (-528.553) -- 0:00:39
338500 -- (-528.888) (-527.859) (-530.291) [-531.141] * (-532.316) (-528.218) (-534.329) [-527.808] -- 0:00:39
339000 -- (-529.059) (-526.961) [-528.131] (-531.339) * (-530.726) (-529.784) [-530.164] (-527.667) -- 0:00:38
339500 -- (-528.134) (-530.958) [-533.382] (-531.141) * (-530.437) (-527.806) [-529.020] (-529.536) -- 0:00:38
340000 -- (-528.843) (-528.824) [-528.630] (-529.317) * (-533.690) [-527.219] (-526.935) (-527.369) -- 0:00:38
Average standard deviation of split frequencies: 0.014453
340500 -- (-528.725) [-528.812] (-532.708) (-532.655) * [-530.835] (-528.166) (-527.937) (-527.184) -- 0:00:38
341000 -- (-530.441) [-527.953] (-527.450) (-527.583) * (-532.507) [-528.379] (-527.570) (-530.453) -- 0:00:38
341500 -- (-530.414) (-528.705) [-529.873] (-529.208) * (-528.630) (-531.044) (-528.919) [-528.281] -- 0:00:38
342000 -- (-532.266) [-528.346] (-532.266) (-529.457) * (-527.552) (-529.969) [-527.922] (-529.949) -- 0:00:38
342500 -- (-528.542) (-529.248) [-531.698] (-529.479) * (-528.384) (-528.439) (-529.602) [-528.607] -- 0:00:38
343000 -- (-527.768) (-529.954) [-529.602] (-530.327) * (-531.038) [-529.367] (-528.361) (-530.918) -- 0:00:38
343500 -- (-531.245) [-532.084] (-528.139) (-527.904) * (-530.819) (-528.303) [-530.310] (-527.422) -- 0:00:38
344000 -- (-532.136) (-531.535) [-529.941] (-528.091) * (-529.814) (-531.218) [-528.981] (-529.302) -- 0:00:38
344500 -- (-528.229) (-530.682) [-527.972] (-529.371) * [-527.963] (-531.962) (-530.647) (-529.771) -- 0:00:38
345000 -- (-527.587) (-527.248) [-528.050] (-530.533) * [-528.986] (-528.420) (-530.549) (-527.445) -- 0:00:37
Average standard deviation of split frequencies: 0.014533
345500 -- [-527.946] (-527.485) (-528.708) (-527.840) * [-531.267] (-535.259) (-527.873) (-530.333) -- 0:00:37
346000 -- (-529.254) (-529.189) [-529.609] (-527.356) * [-527.240] (-528.943) (-527.159) (-527.366) -- 0:00:37
346500 -- (-528.751) (-528.614) (-529.476) [-528.057] * (-531.236) (-528.751) [-530.479] (-527.501) -- 0:00:39
347000 -- (-527.106) (-527.774) (-528.593) [-530.287] * (-532.110) (-527.294) (-530.887) [-528.262] -- 0:00:39
347500 -- (-528.695) (-530.380) [-529.906] (-527.653) * (-527.274) (-527.704) [-529.844] (-530.006) -- 0:00:39
348000 -- (-533.051) [-530.612] (-527.762) (-526.910) * (-530.442) (-529.512) [-528.162] (-529.791) -- 0:00:39
348500 -- [-530.702] (-528.323) (-527.242) (-527.612) * (-531.753) (-527.844) [-528.240] (-530.357) -- 0:00:39
349000 -- (-529.604) [-528.283] (-529.134) (-527.645) * [-532.069] (-527.349) (-529.167) (-537.970) -- 0:00:39
349500 -- (-531.185) [-531.113] (-529.809) (-533.999) * (-533.083) (-526.927) [-528.924] (-528.805) -- 0:00:39
350000 -- [-528.636] (-529.095) (-529.193) (-532.176) * [-530.416] (-529.509) (-529.244) (-526.981) -- 0:00:39
Average standard deviation of split frequencies: 0.014489
350500 -- (-528.468) (-529.679) (-531.966) [-528.298] * (-528.805) [-528.538] (-529.938) (-526.737) -- 0:00:38
351000 -- (-529.076) [-528.236] (-528.101) (-528.424) * (-530.603) (-529.017) (-529.115) [-526.570] -- 0:00:38
351500 -- (-528.116) (-529.880) [-526.695] (-530.702) * (-527.695) (-527.184) [-528.833] (-530.144) -- 0:00:38
352000 -- [-527.897] (-527.930) (-527.668) (-529.523) * [-528.686] (-529.317) (-529.093) (-529.762) -- 0:00:38
352500 -- [-528.754] (-529.053) (-528.845) (-530.327) * (-532.673) (-527.511) (-530.117) [-533.915] -- 0:00:38
353000 -- (-528.234) [-531.302] (-530.409) (-530.667) * (-533.826) (-530.817) (-528.629) [-534.242] -- 0:00:38
353500 -- (-528.338) (-528.289) (-531.326) [-529.064] * (-530.270) (-531.118) (-528.585) [-533.502] -- 0:00:38
354000 -- (-529.963) (-531.331) [-529.307] (-531.952) * (-528.298) [-528.388] (-527.865) (-529.823) -- 0:00:38
354500 -- (-531.061) [-531.894] (-528.289) (-529.600) * (-527.841) (-529.438) (-529.794) [-532.587] -- 0:00:38
355000 -- (-529.399) (-530.471) [-532.028] (-527.872) * (-529.944) [-528.497] (-528.111) (-529.497) -- 0:00:38
Average standard deviation of split frequencies: 0.014419
355500 -- (-528.182) (-530.572) [-528.373] (-528.834) * (-532.954) (-528.990) [-528.385] (-528.589) -- 0:00:38
356000 -- [-531.800] (-527.761) (-528.194) (-529.242) * (-530.165) [-528.183] (-532.115) (-527.444) -- 0:00:37
356500 -- [-531.712] (-527.785) (-529.689) (-529.936) * [-527.583] (-530.232) (-531.577) (-528.636) -- 0:00:37
357000 -- (-530.010) (-527.838) [-529.105] (-527.851) * [-529.032] (-529.183) (-527.106) (-527.841) -- 0:00:37
357500 -- (-528.615) [-528.203] (-532.563) (-533.601) * (-528.923) (-528.493) (-527.592) [-534.886] -- 0:00:37
358000 -- (-527.287) [-528.293] (-527.625) (-536.843) * (-531.430) (-527.964) [-527.575] (-539.450) -- 0:00:37
358500 -- [-527.902] (-530.127) (-533.949) (-527.705) * (-527.207) (-529.864) (-527.592) [-542.465] -- 0:00:37
359000 -- (-535.145) (-528.242) [-527.377] (-529.468) * (-527.112) (-529.137) [-528.181] (-538.400) -- 0:00:37
359500 -- [-528.192] (-527.970) (-531.321) (-528.689) * (-528.502) [-529.795] (-528.190) (-529.791) -- 0:00:37
360000 -- [-528.264] (-531.051) (-527.654) (-528.455) * (-528.401) (-529.811) [-527.392] (-529.330) -- 0:00:37
Average standard deviation of split frequencies: 0.013796
360500 -- (-535.012) (-530.253) (-528.469) [-526.967] * (-527.031) (-528.731) [-528.439] (-528.564) -- 0:00:37
361000 -- (-529.923) (-532.485) [-528.115] (-527.329) * (-528.854) (-529.008) (-529.063) [-531.632] -- 0:00:37
361500 -- (-529.857) (-528.218) (-528.870) [-528.730] * [-531.577] (-527.424) (-527.768) (-528.951) -- 0:00:37
362000 -- (-530.802) [-528.992] (-528.306) (-528.745) * (-527.705) (-529.365) (-528.046) [-527.816] -- 0:00:37
362500 -- (-531.923) (-531.487) [-531.905] (-529.577) * (-530.340) (-530.102) (-528.598) [-528.044] -- 0:00:38
363000 -- (-528.124) (-530.309) (-531.658) [-529.355] * (-531.102) (-530.726) (-531.387) [-528.257] -- 0:00:38
363500 -- [-530.977] (-528.607) (-535.804) (-530.004) * (-528.101) (-531.161) (-528.064) [-528.441] -- 0:00:38
364000 -- (-529.357) (-530.377) (-528.368) [-529.473] * (-528.399) (-532.275) [-528.591] (-530.395) -- 0:00:38
364500 -- (-528.775) [-530.826] (-527.758) (-529.748) * (-528.050) (-528.125) [-526.851] (-530.634) -- 0:00:38
365000 -- (-530.885) (-531.136) [-528.562] (-529.469) * [-529.322] (-531.017) (-528.209) (-529.558) -- 0:00:38
Average standard deviation of split frequencies: 0.013810
365500 -- (-528.455) (-529.106) [-527.524] (-529.905) * (-528.619) (-529.575) [-527.972] (-527.659) -- 0:00:38
366000 -- (-528.291) (-531.561) (-530.349) [-530.916] * (-529.640) (-528.672) (-527.893) [-529.629] -- 0:00:38
366500 -- (-528.547) (-528.293) [-530.347] (-526.847) * (-531.047) (-529.582) [-528.605] (-531.212) -- 0:00:38
367000 -- (-533.922) (-528.619) [-528.897] (-527.405) * (-527.603) [-529.112] (-526.688) (-530.374) -- 0:00:37
367500 -- (-532.111) [-530.585] (-530.736) (-527.321) * (-527.954) (-527.082) (-528.183) [-531.085] -- 0:00:37
368000 -- [-535.078] (-531.276) (-531.285) (-527.437) * (-528.532) (-532.038) [-529.066] (-528.504) -- 0:00:37
368500 -- (-530.060) (-528.794) (-533.701) [-527.217] * (-528.394) (-531.441) (-530.326) [-527.809] -- 0:00:37
369000 -- (-529.011) (-532.157) (-538.138) [-530.230] * [-527.258] (-530.514) (-528.852) (-529.986) -- 0:00:37
369500 -- (-531.701) (-529.811) (-535.655) [-527.853] * [-528.065] (-529.203) (-529.748) (-528.940) -- 0:00:37
370000 -- (-529.690) [-528.646] (-529.035) (-529.588) * (-526.773) (-528.369) [-527.065] (-529.019) -- 0:00:37
Average standard deviation of split frequencies: 0.012576
370500 -- [-529.382] (-529.873) (-529.605) (-529.831) * (-528.381) [-528.534] (-533.770) (-527.907) -- 0:00:37
371000 -- (-527.708) (-530.641) [-527.165] (-529.916) * (-528.483) (-527.027) [-528.334] (-531.421) -- 0:00:37
371500 -- (-528.117) [-528.344] (-534.329) (-529.901) * (-531.879) (-527.272) [-528.533] (-528.463) -- 0:00:37
372000 -- (-527.498) (-527.041) [-529.557] (-532.663) * (-531.112) (-529.337) (-527.873) [-527.661] -- 0:00:37
372500 -- (-527.833) [-532.489] (-527.837) (-527.334) * [-532.795] (-529.227) (-530.396) (-532.349) -- 0:00:37
373000 -- (-528.503) [-528.351] (-530.472) (-527.806) * (-532.483) (-528.971) (-527.793) [-531.449] -- 0:00:36
373500 -- (-529.695) (-527.766) (-531.697) [-528.732] * (-531.153) [-528.512] (-530.812) (-529.307) -- 0:00:36
374000 -- (-531.350) (-529.923) (-526.905) [-527.753] * (-529.436) (-527.472) [-528.442] (-527.987) -- 0:00:36
374500 -- [-535.543] (-530.811) (-528.006) (-527.462) * (-530.451) [-528.304] (-528.437) (-530.220) -- 0:00:36
375000 -- (-532.080) (-529.491) (-527.992) [-529.788] * [-528.245] (-529.944) (-529.326) (-533.023) -- 0:00:36
Average standard deviation of split frequencies: 0.012302
375500 -- (-531.084) (-528.723) (-530.210) [-527.966] * [-530.023] (-531.550) (-528.771) (-529.619) -- 0:00:36
376000 -- [-527.092] (-527.506) (-534.129) (-529.265) * (-527.098) [-528.142] (-527.610) (-528.360) -- 0:00:36
376500 -- [-529.660] (-531.541) (-534.835) (-529.948) * (-534.452) [-529.404] (-527.637) (-531.611) -- 0:00:36
377000 -- (-530.607) (-531.795) (-528.653) [-527.590] * (-532.715) (-530.116) [-527.413] (-530.999) -- 0:00:36
377500 -- (-528.584) (-531.189) [-529.182] (-528.888) * (-527.686) (-530.444) (-528.165) [-527.139] -- 0:00:36
378000 -- [-528.626] (-529.294) (-529.223) (-532.068) * (-527.801) [-528.059] (-528.831) (-527.197) -- 0:00:36
378500 -- (-527.881) [-532.316] (-526.468) (-532.898) * (-530.461) (-527.995) (-528.951) [-527.737] -- 0:00:36
379000 -- [-527.688] (-529.173) (-528.213) (-528.446) * (-528.350) (-526.908) [-530.277] (-531.547) -- 0:00:36
379500 -- (-527.780) (-529.995) (-527.383) [-527.654] * (-527.803) (-529.395) [-528.079] (-528.544) -- 0:00:37
380000 -- [-529.199] (-527.590) (-529.445) (-527.764) * (-528.083) (-527.398) (-529.290) [-528.127] -- 0:00:37
Average standard deviation of split frequencies: 0.011291
380500 -- [-527.283] (-529.150) (-529.255) (-530.685) * (-529.203) (-528.786) (-530.523) [-529.633] -- 0:00:37
381000 -- [-529.746] (-531.621) (-533.691) (-530.354) * (-527.825) [-527.965] (-527.605) (-530.371) -- 0:00:37
381500 -- [-528.720] (-530.775) (-530.084) (-527.062) * (-529.830) [-528.623] (-527.481) (-531.543) -- 0:00:37
382000 -- [-528.726] (-531.472) (-528.283) (-529.245) * (-529.272) [-528.863] (-531.403) (-530.086) -- 0:00:37
382500 -- [-527.743] (-530.597) (-528.349) (-527.855) * (-528.163) (-527.726) [-530.376] (-531.021) -- 0:00:37
383000 -- (-527.910) [-527.359] (-527.574) (-529.948) * (-528.705) (-526.690) [-531.927] (-529.031) -- 0:00:37
383500 -- (-528.555) [-527.801] (-530.418) (-528.016) * (-529.040) (-527.919) [-532.644] (-530.627) -- 0:00:36
384000 -- (-528.467) (-530.562) (-528.609) [-528.965] * [-529.991] (-527.489) (-531.179) (-527.585) -- 0:00:36
384500 -- (-529.305) (-531.669) [-527.949] (-528.504) * [-528.261] (-527.983) (-527.730) (-534.733) -- 0:00:36
385000 -- [-527.192] (-528.720) (-531.772) (-528.173) * [-527.773] (-530.394) (-528.130) (-528.552) -- 0:00:36
Average standard deviation of split frequencies: 0.011063
385500 -- [-527.801] (-528.098) (-528.558) (-530.782) * [-527.831] (-529.045) (-530.179) (-529.955) -- 0:00:36
386000 -- (-527.477) [-528.386] (-529.560) (-531.153) * (-528.448) (-527.155) (-528.595) [-528.346] -- 0:00:36
386500 -- (-527.401) [-526.644] (-530.841) (-528.367) * (-529.470) (-526.820) (-527.624) [-528.958] -- 0:00:36
387000 -- (-528.639) [-530.153] (-529.069) (-530.668) * (-527.843) (-530.037) (-528.627) [-530.524] -- 0:00:36
387500 -- (-528.300) (-529.050) [-528.421] (-528.944) * (-529.134) (-527.662) (-528.216) [-531.415] -- 0:00:36
388000 -- (-527.583) [-530.715] (-529.200) (-527.522) * (-528.582) (-529.081) [-527.490] (-527.402) -- 0:00:36
388500 -- (-527.253) (-528.657) [-528.654] (-528.349) * (-531.319) [-528.087] (-528.024) (-527.264) -- 0:00:36
389000 -- [-528.178] (-529.052) (-527.369) (-529.187) * (-528.987) (-536.001) (-527.432) [-527.496] -- 0:00:36
389500 -- (-528.585) [-527.192] (-528.902) (-528.426) * (-529.615) [-530.416] (-528.307) (-528.343) -- 0:00:36
390000 -- (-528.758) (-527.174) [-527.087] (-535.331) * (-531.112) (-529.500) (-528.133) [-528.835] -- 0:00:35
Average standard deviation of split frequencies: 0.010647
390500 -- (-527.688) [-527.717] (-529.779) (-526.681) * (-530.065) (-528.167) [-527.042] (-527.159) -- 0:00:35
391000 -- (-529.410) (-527.246) (-530.586) [-528.449] * [-526.980] (-527.687) (-529.243) (-529.100) -- 0:00:35
391500 -- (-528.318) (-530.548) (-528.556) [-526.900] * [-528.058] (-527.231) (-529.008) (-528.883) -- 0:00:35
392000 -- (-532.214) [-527.180] (-533.964) (-526.717) * (-530.582) [-527.369] (-528.391) (-529.975) -- 0:00:35
392500 -- (-526.984) (-530.249) [-528.188] (-527.898) * (-529.610) [-527.604] (-531.052) (-529.008) -- 0:00:35
393000 -- [-527.392] (-529.402) (-531.565) (-527.438) * [-529.822] (-530.031) (-530.151) (-530.201) -- 0:00:35
393500 -- (-528.548) (-529.742) [-527.562] (-528.145) * [-528.986] (-527.407) (-532.208) (-532.460) -- 0:00:35
394000 -- (-533.656) [-527.915] (-526.578) (-529.306) * [-527.544] (-527.360) (-529.616) (-527.049) -- 0:00:35
394500 -- (-526.583) (-528.463) (-527.637) [-529.684] * (-528.753) (-532.931) (-527.324) [-530.609] -- 0:00:35
395000 -- [-527.276] (-528.843) (-528.376) (-530.257) * (-527.286) (-529.491) (-533.346) [-531.089] -- 0:00:35
Average standard deviation of split frequencies: 0.009873
395500 -- (-527.663) (-529.393) [-526.540] (-529.633) * [-527.887] (-526.784) (-528.006) (-528.483) -- 0:00:35
396000 -- [-527.858] (-528.253) (-527.262) (-528.447) * [-530.388] (-528.069) (-528.121) (-530.409) -- 0:00:36
396500 -- [-531.575] (-529.756) (-528.494) (-528.475) * (-527.350) [-529.385] (-527.442) (-529.726) -- 0:00:36
397000 -- (-536.009) (-529.727) (-527.540) [-529.953] * (-530.257) (-530.481) (-529.351) [-527.891] -- 0:00:36
397500 -- (-529.292) (-530.675) (-531.207) [-527.390] * (-534.139) (-531.379) (-530.087) [-529.079] -- 0:00:36
398000 -- [-527.322] (-530.028) (-528.111) (-529.612) * [-531.939] (-528.728) (-527.995) (-529.086) -- 0:00:36
398500 -- (-529.072) (-532.875) (-528.737) [-529.644] * (-527.497) (-529.229) (-531.603) [-528.000] -- 0:00:36
399000 -- (-530.248) (-528.822) (-530.218) [-529.312] * (-529.765) (-527.698) (-530.521) [-527.269] -- 0:00:36
399500 -- (-531.304) [-528.472] (-534.054) (-529.887) * (-531.323) [-528.516] (-529.582) (-527.166) -- 0:00:36
400000 -- (-532.611) [-529.504] (-529.126) (-528.256) * [-528.035] (-529.367) (-531.823) (-527.226) -- 0:00:36
Average standard deviation of split frequencies: 0.008928
400500 -- [-530.462] (-527.616) (-531.563) (-531.960) * (-528.724) [-528.267] (-530.085) (-528.272) -- 0:00:35
401000 -- (-529.508) (-527.672) [-527.831] (-527.768) * (-528.586) [-528.747] (-529.346) (-528.885) -- 0:00:35
401500 -- [-528.303] (-527.669) (-526.798) (-527.845) * (-529.984) (-529.220) (-528.992) [-528.790] -- 0:00:35
402000 -- (-534.512) (-528.832) (-528.243) [-527.494] * (-527.768) (-534.012) (-537.339) [-527.930] -- 0:00:35
402500 -- (-528.794) (-527.694) [-528.885] (-527.757) * (-536.134) [-530.214] (-536.621) (-527.848) -- 0:00:35
403000 -- (-527.555) (-531.363) [-527.401] (-529.386) * (-528.997) (-531.915) (-529.061) [-528.141] -- 0:00:35
403500 -- (-529.678) (-528.247) (-528.414) [-527.405] * (-532.389) [-531.968] (-527.719) (-532.372) -- 0:00:35
404000 -- (-528.253) [-528.782] (-537.817) (-526.813) * (-532.223) (-531.520) (-528.703) [-526.703] -- 0:00:35
404500 -- (-530.454) (-530.011) [-529.135] (-528.434) * (-529.341) (-528.940) (-528.728) [-534.539] -- 0:00:35
405000 -- [-529.997] (-529.795) (-528.810) (-527.689) * [-529.513] (-529.799) (-530.282) (-529.168) -- 0:00:35
Average standard deviation of split frequencies: 0.009357
405500 -- (-529.107) [-530.991] (-527.834) (-529.428) * [-527.459] (-528.658) (-527.657) (-530.505) -- 0:00:35
406000 -- (-533.859) (-528.159) (-530.173) [-527.686] * [-529.543] (-531.464) (-530.839) (-527.625) -- 0:00:35
406500 -- (-530.644) [-527.424] (-528.229) (-529.797) * (-527.479) [-531.557] (-529.877) (-527.366) -- 0:00:35
407000 -- (-529.103) (-531.488) (-527.940) [-529.503] * [-528.452] (-529.456) (-532.095) (-526.445) -- 0:00:34
407500 -- (-530.628) (-527.775) [-531.768] (-529.128) * [-526.783] (-530.176) (-528.920) (-528.077) -- 0:00:34
408000 -- [-527.335] (-531.173) (-529.119) (-527.769) * [-534.425] (-532.784) (-526.878) (-530.148) -- 0:00:34
408500 -- (-527.797) (-532.273) (-527.214) [-528.489] * (-534.976) [-530.377] (-530.176) (-531.456) -- 0:00:34
409000 -- [-528.402] (-536.739) (-529.929) (-529.572) * [-533.139] (-530.326) (-529.391) (-530.098) -- 0:00:34
409500 -- (-528.047) [-534.076] (-526.748) (-528.456) * [-527.657] (-532.973) (-529.646) (-528.154) -- 0:00:34
410000 -- (-529.421) (-528.589) [-527.704] (-532.893) * (-532.664) (-530.057) [-528.762] (-529.119) -- 0:00:34
Average standard deviation of split frequencies: 0.009375
410500 -- (-528.411) (-527.787) (-528.338) [-527.329] * (-531.988) [-528.667] (-528.178) (-529.059) -- 0:00:34
411000 -- (-530.247) (-529.842) (-528.436) [-528.197] * (-533.949) (-527.134) [-528.618] (-530.901) -- 0:00:34
411500 -- [-531.084] (-528.936) (-528.654) (-528.947) * (-529.468) (-534.931) (-527.536) [-531.047] -- 0:00:34
412000 -- (-529.372) (-528.364) [-528.657] (-530.421) * [-529.628] (-529.545) (-530.250) (-528.068) -- 0:00:34
412500 -- (-527.932) (-528.231) (-527.730) [-531.202] * (-531.298) [-532.619] (-531.232) (-530.650) -- 0:00:34
413000 -- [-527.632] (-531.691) (-529.629) (-528.419) * (-528.549) (-532.334) (-529.659) [-527.429] -- 0:00:35
413500 -- (-526.992) [-531.947] (-528.493) (-529.770) * [-529.722] (-528.845) (-529.889) (-527.898) -- 0:00:35
414000 -- (-531.094) [-529.547] (-529.725) (-533.992) * (-527.236) (-530.763) (-529.053) [-529.305] -- 0:00:35
414500 -- [-530.512] (-529.990) (-527.536) (-529.311) * (-529.776) (-533.177) [-527.058] (-527.453) -- 0:00:35
415000 -- (-528.516) (-529.954) [-529.217] (-527.418) * (-528.255) [-527.145] (-527.584) (-531.103) -- 0:00:35
Average standard deviation of split frequencies: 0.009317
415500 -- (-527.293) [-529.883] (-528.386) (-526.884) * [-528.629] (-530.271) (-528.643) (-527.715) -- 0:00:35
416000 -- (-530.146) (-528.342) [-529.774] (-529.728) * (-530.664) [-528.334] (-528.569) (-528.846) -- 0:00:35
416500 -- [-527.334] (-527.482) (-528.992) (-530.043) * (-532.108) (-528.299) (-527.574) [-529.241] -- 0:00:35
417000 -- (-533.416) [-528.267] (-529.479) (-537.584) * [-528.271] (-527.561) (-530.551) (-527.260) -- 0:00:34
417500 -- (-530.765) (-529.561) [-530.094] (-529.787) * (-529.214) (-529.258) [-528.966] (-528.685) -- 0:00:34
418000 -- (-530.959) (-532.546) [-530.727] (-530.700) * [-532.035] (-527.262) (-528.249) (-528.066) -- 0:00:34
418500 -- (-527.571) (-532.361) (-530.037) [-530.349] * (-528.284) (-527.006) (-530.389) [-531.329] -- 0:00:34
419000 -- (-529.824) (-530.315) (-529.836) [-526.443] * (-527.924) [-526.843] (-528.460) (-535.538) -- 0:00:34
419500 -- (-529.085) (-530.105) (-529.161) [-530.284] * (-532.061) (-527.833) (-528.894) [-527.746] -- 0:00:34
420000 -- (-528.697) (-527.940) (-528.552) [-530.477] * (-530.474) (-528.399) [-526.749] (-533.756) -- 0:00:34
Average standard deviation of split frequencies: 0.010506
420500 -- [-528.893] (-528.001) (-527.725) (-531.895) * (-526.706) (-528.513) [-528.837] (-531.826) -- 0:00:34
421000 -- (-528.456) [-529.704] (-529.057) (-530.556) * [-530.124] (-528.570) (-530.784) (-528.879) -- 0:00:34
421500 -- (-529.740) (-528.928) (-527.680) [-531.050] * (-527.564) [-528.409] (-529.125) (-527.222) -- 0:00:34
422000 -- (-529.492) [-526.922] (-529.885) (-528.066) * (-536.152) (-528.490) (-529.855) [-528.427] -- 0:00:34
422500 -- [-528.204] (-527.575) (-533.315) (-526.722) * (-528.088) (-528.949) (-528.242) [-527.312] -- 0:00:34
423000 -- (-527.125) [-527.784] (-530.820) (-528.931) * (-528.710) (-529.491) [-526.980] (-528.043) -- 0:00:34
423500 -- (-528.567) (-528.829) [-530.002] (-528.105) * (-531.759) [-533.554] (-527.052) (-527.703) -- 0:00:34
424000 -- [-531.595] (-537.950) (-534.536) (-529.570) * [-532.930] (-532.380) (-526.906) (-528.749) -- 0:00:33
424500 -- (-528.973) (-529.734) [-526.960] (-528.429) * [-526.865] (-529.542) (-532.083) (-528.271) -- 0:00:33
425000 -- (-527.841) [-531.577] (-527.863) (-527.611) * (-531.907) (-529.862) (-528.003) [-527.753] -- 0:00:33
Average standard deviation of split frequencies: 0.009829
425500 -- [-529.313] (-529.637) (-526.824) (-529.145) * (-532.178) [-528.449] (-526.749) (-527.526) -- 0:00:33
426000 -- (-531.283) [-528.810] (-529.139) (-528.749) * (-528.255) (-530.421) [-527.111] (-526.778) -- 0:00:33
426500 -- (-531.081) (-530.209) [-531.306] (-533.066) * (-530.044) (-530.115) (-530.654) [-527.244] -- 0:00:33
427000 -- (-527.349) (-527.312) [-530.037] (-527.423) * (-527.894) (-528.783) [-530.077] (-527.500) -- 0:00:33
427500 -- [-526.751] (-530.872) (-530.383) (-528.108) * (-528.241) (-527.899) [-532.601] (-527.282) -- 0:00:33
428000 -- (-530.196) (-529.290) (-528.945) [-529.871] * (-529.553) [-529.463] (-529.810) (-527.661) -- 0:00:33
428500 -- (-527.196) (-527.974) [-529.183] (-529.094) * (-528.830) (-528.092) (-527.960) [-526.903] -- 0:00:33
429000 -- (-530.326) (-527.816) (-528.050) [-528.443] * (-531.896) [-530.933] (-529.551) (-527.454) -- 0:00:33
429500 -- (-530.352) (-530.299) [-527.342] (-528.909) * (-529.057) (-531.536) [-527.034] (-528.069) -- 0:00:34
430000 -- (-529.493) (-527.417) [-529.539] (-530.276) * (-528.250) (-530.457) (-529.085) [-528.668] -- 0:00:34
Average standard deviation of split frequencies: 0.008886
430500 -- [-530.391] (-527.585) (-528.985) (-529.828) * (-527.857) (-531.114) [-527.491] (-530.879) -- 0:00:34
431000 -- (-527.250) (-540.021) (-529.660) [-529.365] * [-528.158] (-527.949) (-526.730) (-528.695) -- 0:00:34
431500 -- [-529.804] (-527.074) (-529.206) (-528.887) * (-529.648) (-530.253) (-527.480) [-527.581] -- 0:00:34
432000 -- (-527.140) (-528.788) (-528.838) [-528.661] * [-528.229] (-529.852) (-527.796) (-527.314) -- 0:00:34
432500 -- [-527.727] (-527.901) (-531.118) (-528.048) * (-528.005) [-529.145] (-528.199) (-531.273) -- 0:00:34
433000 -- (-529.735) (-526.649) (-529.453) [-527.354] * (-527.144) (-535.184) [-531.165] (-534.024) -- 0:00:34
433500 -- (-530.117) [-530.431] (-528.638) (-528.736) * (-528.641) (-529.583) [-528.254] (-530.129) -- 0:00:33
434000 -- (-529.824) (-531.437) (-527.193) [-530.091] * (-528.152) (-529.732) [-529.337] (-528.581) -- 0:00:33
434500 -- [-528.332] (-528.370) (-527.978) (-529.639) * (-527.474) (-531.543) [-527.908] (-532.216) -- 0:00:33
435000 -- [-529.968] (-529.066) (-528.067) (-527.750) * (-529.824) [-529.254] (-527.919) (-533.295) -- 0:00:33
Average standard deviation of split frequencies: 0.008395
435500 -- (-528.618) (-530.696) (-532.662) [-534.113] * [-528.977] (-530.639) (-526.904) (-529.066) -- 0:00:33
436000 -- (-527.515) (-529.824) (-530.850) [-528.265] * (-531.580) (-530.637) [-527.106] (-529.356) -- 0:00:33
436500 -- (-527.731) (-526.665) [-533.459] (-527.668) * (-533.129) (-528.036) (-529.837) [-528.216] -- 0:00:33
437000 -- (-527.873) (-532.951) (-535.252) [-526.910] * (-531.444) [-528.123] (-530.582) (-529.531) -- 0:00:33
437500 -- [-527.742] (-530.892) (-529.507) (-529.098) * (-528.531) (-530.370) (-528.696) [-527.718] -- 0:00:33
438000 -- [-527.884] (-527.909) (-528.967) (-532.246) * (-533.048) [-528.905] (-530.256) (-527.428) -- 0:00:33
438500 -- (-527.364) [-527.884] (-533.668) (-529.509) * (-533.631) [-530.470] (-530.819) (-530.630) -- 0:00:33
439000 -- [-526.754] (-528.393) (-529.591) (-528.923) * (-528.435) (-527.424) (-529.998) [-530.062] -- 0:00:33
439500 -- [-529.954] (-529.337) (-528.356) (-528.483) * [-531.367] (-527.917) (-532.054) (-528.825) -- 0:00:33
440000 -- (-528.110) (-528.825) (-532.540) [-529.743] * (-527.323) (-527.442) [-530.250] (-532.104) -- 0:00:33
Average standard deviation of split frequencies: 0.008243
440500 -- (-526.918) (-527.233) [-528.192] (-528.319) * (-527.801) (-529.748) [-530.798] (-529.475) -- 0:00:33
441000 -- [-528.767] (-527.609) (-529.893) (-528.425) * (-530.047) [-528.202] (-530.473) (-529.095) -- 0:00:32
441500 -- (-528.377) (-527.918) [-529.923] (-528.568) * (-530.168) (-528.351) [-527.848] (-530.721) -- 0:00:32
442000 -- [-527.701] (-528.927) (-530.377) (-527.491) * (-526.727) [-536.094] (-529.291) (-532.126) -- 0:00:32
442500 -- (-528.091) (-527.135) (-531.083) [-528.584] * [-529.892] (-529.387) (-528.341) (-530.332) -- 0:00:32
443000 -- (-527.224) (-528.362) [-527.718] (-529.053) * (-527.412) (-528.533) [-527.308] (-529.491) -- 0:00:32
443500 -- (-528.749) (-528.408) (-530.483) [-528.757] * (-531.335) (-528.224) (-529.461) [-531.283] -- 0:00:32
444000 -- [-526.835] (-529.109) (-529.111) (-529.905) * (-533.790) (-530.778) (-528.621) [-527.575] -- 0:00:32
444500 -- (-528.221) (-531.425) (-530.193) [-528.649] * (-528.518) (-530.256) [-527.633] (-529.397) -- 0:00:32
445000 -- [-530.367] (-529.606) (-527.733) (-532.411) * (-529.429) [-528.406] (-526.914) (-529.944) -- 0:00:32
Average standard deviation of split frequencies: 0.009202
445500 -- (-529.478) [-528.246] (-529.880) (-530.429) * (-535.031) (-529.117) [-526.671] (-527.823) -- 0:00:32
446000 -- [-527.844] (-527.818) (-530.733) (-528.698) * (-532.215) [-533.664] (-528.208) (-528.731) -- 0:00:33
446500 -- [-527.561] (-528.208) (-530.797) (-530.454) * (-529.695) [-528.459] (-527.128) (-530.958) -- 0:00:33
447000 -- (-527.641) (-527.822) [-529.274] (-528.133) * (-532.617) (-530.856) (-529.627) [-527.463] -- 0:00:33
447500 -- (-528.053) (-528.952) (-527.228) [-529.220] * [-529.810] (-533.516) (-529.313) (-528.727) -- 0:00:33
448000 -- (-527.241) [-530.959] (-530.040) (-529.120) * (-530.481) [-529.190] (-528.451) (-529.592) -- 0:00:33
448500 -- (-528.826) (-526.869) (-527.985) [-526.638] * [-527.655] (-530.287) (-529.528) (-531.624) -- 0:00:33
449000 -- (-526.960) (-527.095) [-531.872] (-531.901) * [-527.421] (-530.041) (-530.587) (-527.793) -- 0:00:33
449500 -- (-529.273) [-527.916] (-531.452) (-530.239) * (-527.627) [-529.277] (-529.773) (-530.594) -- 0:00:33
450000 -- [-534.818] (-531.061) (-529.969) (-531.016) * (-529.707) (-527.952) [-529.993] (-528.631) -- 0:00:33
Average standard deviation of split frequencies: 0.008799
450500 -- (-527.213) (-528.794) [-529.177] (-528.658) * (-526.780) [-528.343] (-529.861) (-530.396) -- 0:00:32
451000 -- (-530.190) [-527.090] (-531.459) (-530.425) * (-530.176) (-527.767) [-528.055] (-528.687) -- 0:00:32
451500 -- (-529.622) (-528.281) [-528.977] (-531.574) * (-530.189) (-527.174) [-529.553] (-528.503) -- 0:00:32
452000 -- (-530.396) (-529.229) [-526.997] (-528.519) * (-529.917) (-527.205) [-528.791] (-528.340) -- 0:00:32
452500 -- (-528.227) (-529.013) [-528.518] (-528.498) * (-528.195) (-530.369) (-528.721) [-527.731] -- 0:00:32
453000 -- [-529.627] (-527.005) (-533.119) (-534.943) * [-527.232] (-527.594) (-527.402) (-526.955) -- 0:00:32
453500 -- (-527.725) (-528.695) (-528.611) [-528.541] * (-527.650) [-528.105] (-529.773) (-527.327) -- 0:00:32
454000 -- (-528.957) [-528.580] (-528.406) (-532.054) * (-527.948) [-527.379] (-530.129) (-527.678) -- 0:00:32
454500 -- (-528.209) [-529.070] (-530.577) (-529.557) * (-527.137) (-529.036) (-532.328) [-527.726] -- 0:00:32
455000 -- (-529.518) (-532.590) [-527.323] (-528.870) * (-527.758) (-527.776) [-530.215] (-529.141) -- 0:00:32
Average standard deviation of split frequencies: 0.009182
455500 -- (-532.218) (-527.999) [-527.341] (-528.724) * (-526.904) (-530.472) [-527.674] (-527.149) -- 0:00:32
456000 -- [-529.654] (-526.846) (-533.361) (-528.392) * [-527.641] (-528.427) (-528.700) (-529.984) -- 0:00:32
456500 -- (-529.503) (-528.795) (-529.199) [-526.805] * (-528.138) (-528.437) (-530.443) [-528.869] -- 0:00:32
457000 -- [-529.620] (-531.956) (-527.777) (-532.060) * (-528.464) (-528.228) [-529.391] (-529.171) -- 0:00:32
457500 -- (-532.650) (-528.652) (-531.550) [-528.582] * [-528.352] (-528.372) (-532.457) (-527.923) -- 0:00:32
458000 -- (-529.552) [-527.249] (-529.738) (-527.405) * (-529.539) (-526.951) [-527.151] (-532.013) -- 0:00:31
458500 -- [-529.963] (-528.819) (-526.767) (-529.145) * [-528.546] (-539.692) (-528.423) (-528.312) -- 0:00:31
459000 -- [-529.320] (-527.026) (-528.070) (-531.865) * (-531.330) (-528.330) (-527.790) [-526.812] -- 0:00:31
459500 -- (-528.183) [-528.823] (-528.066) (-530.521) * (-532.008) [-527.520] (-533.505) (-527.640) -- 0:00:31
460000 -- (-526.658) (-532.687) (-527.745) [-528.804] * (-533.503) (-527.658) (-531.224) [-530.781] -- 0:00:31
Average standard deviation of split frequencies: 0.008247
460500 -- (-533.672) (-530.395) [-528.100] (-531.240) * [-531.026] (-530.795) (-527.503) (-529.690) -- 0:00:31
461000 -- [-528.374] (-529.171) (-527.362) (-529.396) * (-529.717) [-526.547] (-530.591) (-527.634) -- 0:00:31
461500 -- [-528.602] (-529.875) (-527.865) (-530.345) * (-526.797) [-528.074] (-531.955) (-527.515) -- 0:00:31
462000 -- (-529.227) [-530.333] (-530.313) (-530.166) * (-530.140) [-528.065] (-527.755) (-532.161) -- 0:00:32
462500 -- [-528.118] (-526.718) (-527.942) (-531.336) * (-529.970) (-527.029) [-528.017] (-528.601) -- 0:00:32
463000 -- (-527.562) (-528.037) (-529.576) [-530.148] * (-530.760) (-529.824) (-528.344) [-528.746] -- 0:00:32
463500 -- (-530.642) (-526.928) (-530.058) [-526.661] * (-529.283) [-528.460] (-527.980) (-532.680) -- 0:00:32
464000 -- (-536.507) (-527.791) [-527.457] (-527.681) * (-528.887) (-528.570) (-528.119) [-529.421] -- 0:00:32
464500 -- (-528.417) [-527.611] (-529.172) (-528.617) * (-528.984) (-531.314) (-529.809) [-529.016] -- 0:00:32
465000 -- (-532.091) (-533.633) [-532.601] (-527.562) * (-528.384) (-530.697) (-529.242) [-527.699] -- 0:00:32
Average standard deviation of split frequencies: 0.008152
465500 -- (-534.449) (-532.190) [-528.972] (-528.709) * (-526.881) [-533.969] (-530.079) (-528.502) -- 0:00:32
466000 -- (-527.700) [-529.189] (-529.923) (-527.873) * (-528.758) (-528.397) (-531.154) [-529.615] -- 0:00:32
466500 -- (-528.138) (-530.782) [-528.528] (-528.757) * (-527.722) [-532.242] (-535.715) (-528.065) -- 0:00:32
467000 -- (-531.283) (-531.570) [-528.488] (-527.868) * (-528.653) [-528.559] (-527.761) (-528.335) -- 0:00:31
467500 -- (-527.868) (-530.491) (-532.151) [-528.627] * (-530.301) (-529.679) [-527.911] (-529.136) -- 0:00:31
468000 -- [-529.149] (-531.591) (-527.676) (-528.487) * (-529.548) (-529.735) [-529.664] (-528.678) -- 0:00:31
468500 -- (-530.533) (-529.140) [-528.041] (-527.743) * (-530.133) [-530.427] (-531.002) (-529.815) -- 0:00:31
469000 -- [-529.967] (-528.461) (-529.414) (-531.683) * (-527.538) (-527.067) [-530.368] (-527.399) -- 0:00:31
469500 -- (-529.358) (-532.279) (-528.068) [-528.619] * (-527.144) (-528.311) [-527.728] (-530.431) -- 0:00:31
470000 -- (-528.953) (-529.536) [-528.982] (-527.162) * [-527.268] (-529.533) (-528.228) (-529.119) -- 0:00:31
Average standard deviation of split frequencies: 0.008366
470500 -- (-532.616) [-532.442] (-527.761) (-532.086) * (-528.871) (-527.467) (-527.928) [-526.654] -- 0:00:31
471000 -- (-530.985) [-528.223] (-527.135) (-528.555) * (-529.009) [-528.987] (-527.656) (-528.208) -- 0:00:31
471500 -- (-529.622) (-527.277) (-530.256) [-528.096] * (-529.303) (-527.649) [-528.585] (-528.670) -- 0:00:31
472000 -- [-529.437] (-531.464) (-529.889) (-528.771) * (-527.660) (-526.887) [-528.769] (-531.719) -- 0:00:31
472500 -- (-531.626) [-527.933] (-526.790) (-529.130) * (-532.320) (-529.616) (-530.303) [-530.223] -- 0:00:31
473000 -- [-528.841] (-528.756) (-527.976) (-527.895) * [-532.124] (-529.526) (-528.801) (-529.017) -- 0:00:31
473500 -- (-527.799) (-529.560) [-528.278] (-528.750) * (-533.713) (-528.210) [-528.608] (-528.388) -- 0:00:31
474000 -- (-528.389) (-527.599) [-532.038] (-532.299) * (-527.757) (-530.147) [-528.283] (-530.052) -- 0:00:31
474500 -- (-529.564) [-530.652] (-528.054) (-530.998) * (-527.851) (-527.153) [-530.283] (-529.001) -- 0:00:31
475000 -- (-529.971) (-528.469) [-532.936] (-528.746) * (-529.450) (-530.328) (-530.316) [-529.369] -- 0:00:30
Average standard deviation of split frequencies: 0.008505
475500 -- (-526.934) (-528.979) (-529.310) [-527.208] * (-527.317) [-529.720] (-532.596) (-531.564) -- 0:00:30
476000 -- (-530.595) (-528.975) [-529.333] (-527.704) * (-529.361) (-527.243) (-532.585) [-529.449] -- 0:00:30
476500 -- [-527.351] (-529.544) (-529.018) (-527.608) * (-528.758) [-532.111] (-531.166) (-531.096) -- 0:00:30
477000 -- [-528.442] (-529.057) (-527.060) (-529.451) * (-528.558) (-529.367) [-528.965] (-533.550) -- 0:00:30
477500 -- (-532.568) (-527.885) [-526.741] (-528.379) * (-529.746) [-533.126] (-528.459) (-533.876) -- 0:00:30
478000 -- [-530.867] (-528.476) (-527.757) (-527.987) * (-529.600) (-530.310) [-528.217] (-533.474) -- 0:00:30
478500 -- (-527.997) (-528.670) [-530.087] (-528.378) * (-527.662) [-530.398] (-529.083) (-530.503) -- 0:00:30
479000 -- (-530.598) (-531.376) [-527.058] (-528.379) * (-529.244) [-530.816] (-528.739) (-529.523) -- 0:00:31
479500 -- (-530.918) [-528.464] (-529.949) (-531.863) * (-537.203) (-530.110) (-528.965) [-526.906] -- 0:00:31
480000 -- (-529.908) (-527.732) (-527.408) [-529.173] * (-527.759) (-532.360) (-536.004) [-528.454] -- 0:00:31
Average standard deviation of split frequencies: 0.008581
480500 -- (-528.457) (-532.020) (-530.265) [-527.109] * [-528.419] (-530.164) (-530.051) (-528.816) -- 0:00:31
481000 -- (-530.254) (-528.975) (-530.050) [-527.300] * (-528.802) (-528.663) (-529.223) [-529.515] -- 0:00:31
481500 -- (-528.542) (-532.532) (-527.640) [-528.292] * [-528.712] (-528.167) (-527.856) (-527.950) -- 0:00:31
482000 -- (-528.313) (-529.420) [-527.377] (-528.620) * (-534.167) [-527.650] (-528.791) (-529.359) -- 0:00:31
482500 -- [-528.635] (-528.036) (-527.716) (-531.839) * [-528.034] (-527.714) (-531.458) (-534.893) -- 0:00:31
483000 -- (-528.831) (-531.219) (-527.808) [-529.144] * [-527.711] (-530.438) (-530.302) (-533.381) -- 0:00:31
483500 -- (-529.446) (-529.228) [-532.018] (-527.248) * (-527.579) (-531.906) [-531.165] (-526.682) -- 0:00:30
484000 -- (-532.012) [-528.679] (-527.722) (-526.638) * [-529.090] (-534.693) (-529.163) (-528.713) -- 0:00:30
484500 -- (-528.120) (-534.392) (-528.528) [-526.916] * (-528.170) [-531.264] (-527.488) (-530.082) -- 0:00:30
485000 -- (-531.158) (-527.278) (-530.304) [-526.906] * (-529.897) [-533.241] (-527.784) (-528.625) -- 0:00:30
Average standard deviation of split frequencies: 0.009033
485500 -- (-528.523) [-527.493] (-529.898) (-527.585) * (-528.178) (-528.581) (-526.881) [-527.872] -- 0:00:30
486000 -- [-528.493] (-527.390) (-528.592) (-527.505) * (-529.972) (-528.648) (-528.300) [-529.736] -- 0:00:30
486500 -- [-530.562] (-529.401) (-527.553) (-527.430) * (-528.947) (-528.655) (-528.519) [-527.119] -- 0:00:30
487000 -- [-528.660] (-528.326) (-530.577) (-527.507) * (-527.241) (-528.415) (-530.032) [-527.120] -- 0:00:30
487500 -- [-529.243] (-528.917) (-527.693) (-532.024) * [-527.290] (-526.928) (-527.809) (-528.361) -- 0:00:30
488000 -- (-527.719) [-529.433] (-527.604) (-527.830) * (-529.110) (-527.028) [-529.313] (-531.118) -- 0:00:30
488500 -- (-527.805) [-529.770] (-529.263) (-532.737) * (-529.538) (-528.092) [-529.374] (-538.024) -- 0:00:30
489000 -- (-535.179) [-527.789] (-528.841) (-527.188) * [-527.917] (-532.358) (-528.309) (-529.493) -- 0:00:30
489500 -- (-527.414) [-528.301] (-533.256) (-528.080) * [-528.282] (-529.132) (-528.116) (-527.174) -- 0:00:30
490000 -- (-527.846) (-530.413) (-527.644) [-530.541] * (-528.301) (-529.853) (-528.160) [-527.563] -- 0:00:30
Average standard deviation of split frequencies: 0.008286
490500 -- [-530.840] (-529.593) (-529.635) (-528.534) * (-529.806) (-527.839) (-528.018) [-527.390] -- 0:00:30
491000 -- (-530.605) [-527.412] (-526.779) (-528.703) * [-528.556] (-530.374) (-532.614) (-529.424) -- 0:00:30
491500 -- (-526.944) (-527.336) [-527.343] (-530.837) * (-530.031) (-527.790) (-533.056) [-527.691] -- 0:00:30
492000 -- (-527.939) [-529.653] (-528.389) (-527.273) * (-529.158) (-527.879) [-528.979] (-528.706) -- 0:00:29
492500 -- (-527.571) [-530.261] (-527.383) (-528.650) * [-527.769] (-527.961) (-531.480) (-529.954) -- 0:00:29
493000 -- (-527.787) [-528.868] (-527.295) (-529.839) * [-529.350] (-531.512) (-527.958) (-526.745) -- 0:00:29
493500 -- (-526.766) (-527.338) [-529.024] (-526.852) * (-527.352) (-528.275) (-528.688) [-527.331] -- 0:00:29
494000 -- (-527.984) (-528.923) (-526.965) [-528.486] * (-531.141) (-529.261) [-529.928] (-528.146) -- 0:00:29
494500 -- (-527.001) [-528.099] (-528.377) (-528.923) * (-529.719) (-526.707) (-529.009) [-527.617] -- 0:00:29
495000 -- (-527.068) [-529.654] (-528.200) (-532.277) * (-532.766) [-527.975] (-529.099) (-530.212) -- 0:00:29
Average standard deviation of split frequencies: 0.007841
495500 -- (-527.040) (-532.342) [-528.070] (-529.175) * (-531.654) (-530.904) (-530.820) [-530.476] -- 0:00:30
496000 -- (-528.949) (-527.979) (-527.891) [-530.958] * (-527.839) (-530.952) (-529.898) [-530.005] -- 0:00:30
496500 -- (-527.076) (-532.182) (-527.647) [-528.931] * [-528.195] (-528.805) (-529.018) (-528.571) -- 0:00:30
497000 -- (-527.639) (-527.022) (-528.523) [-530.168] * (-534.541) [-527.589] (-528.075) (-532.600) -- 0:00:30
497500 -- (-532.551) (-527.630) [-527.360] (-528.912) * (-530.296) [-528.098] (-528.807) (-528.618) -- 0:00:30
498000 -- (-531.501) (-530.739) [-528.593] (-531.237) * (-528.364) (-532.920) [-529.154] (-527.075) -- 0:00:30
498500 -- [-527.575] (-530.517) (-530.975) (-528.785) * (-528.942) [-528.927] (-527.680) (-528.559) -- 0:00:30
499000 -- (-527.638) [-527.195] (-530.623) (-529.272) * [-530.230] (-528.576) (-530.283) (-530.343) -- 0:00:30
499500 -- (-531.831) [-528.312] (-530.742) (-527.217) * (-529.801) (-527.462) (-528.276) [-530.747] -- 0:00:30
500000 -- (-531.634) (-527.590) (-529.385) [-527.054] * (-528.933) (-528.993) (-528.379) [-527.709] -- 0:00:30
Average standard deviation of split frequencies: 0.007643
500500 -- (-527.934) (-528.274) (-532.077) [-530.678] * (-528.285) (-531.252) (-527.914) [-531.489] -- 0:00:29
501000 -- (-527.286) [-527.663] (-529.989) (-530.077) * [-529.160] (-531.886) (-528.491) (-530.857) -- 0:00:29
501500 -- [-529.487] (-529.599) (-530.040) (-528.146) * (-533.186) (-530.055) (-531.038) [-528.020] -- 0:00:29
502000 -- (-529.559) (-529.650) [-527.956] (-527.147) * (-531.397) [-529.333] (-527.583) (-531.412) -- 0:00:29
502500 -- [-528.086] (-527.588) (-526.932) (-529.260) * (-530.616) (-532.365) (-527.129) [-528.257] -- 0:00:29
503000 -- (-530.111) (-530.875) [-526.882] (-529.565) * [-528.517] (-529.440) (-527.254) (-532.177) -- 0:00:29
503500 -- [-528.444] (-527.953) (-528.019) (-531.412) * (-527.276) (-529.576) (-527.190) [-531.416] -- 0:00:29
504000 -- [-528.285] (-528.135) (-526.550) (-529.465) * (-529.240) (-531.515) [-527.634] (-532.566) -- 0:00:29
504500 -- (-529.122) (-527.862) (-531.109) [-529.983] * (-529.602) [-527.739] (-526.954) (-527.936) -- 0:00:29
505000 -- (-532.902) (-527.549) [-530.499] (-528.554) * (-527.514) (-527.145) [-527.129] (-529.539) -- 0:00:29
Average standard deviation of split frequencies: 0.007672
505500 -- (-531.014) [-527.933] (-529.062) (-529.582) * (-528.470) [-530.159] (-526.882) (-528.923) -- 0:00:29
506000 -- (-528.501) (-531.937) [-527.669] (-528.228) * (-529.458) [-530.101] (-527.277) (-531.352) -- 0:00:29
506500 -- [-528.527] (-527.777) (-528.276) (-531.525) * (-527.917) (-529.693) [-528.078] (-534.196) -- 0:00:29
507000 -- (-530.190) [-526.899] (-531.089) (-531.533) * (-529.054) (-531.165) [-527.835] (-533.805) -- 0:00:29
507500 -- (-532.713) [-529.230] (-528.879) (-527.435) * (-526.794) (-529.238) [-530.508] (-527.190) -- 0:00:29
508000 -- [-531.055] (-530.203) (-527.767) (-530.081) * [-530.055] (-529.040) (-527.442) (-530.689) -- 0:00:29
508500 -- (-528.374) (-532.932) (-529.671) [-527.053] * (-531.638) (-529.140) [-527.313] (-529.037) -- 0:00:28
509000 -- (-530.854) (-529.113) (-528.101) [-529.094] * (-530.501) [-529.301] (-527.793) (-531.955) -- 0:00:28
509500 -- (-529.749) [-527.641] (-528.605) (-527.223) * (-528.030) [-529.426] (-529.677) (-527.320) -- 0:00:28
510000 -- (-532.683) (-528.552) [-528.600] (-527.635) * [-527.710] (-532.298) (-528.824) (-530.708) -- 0:00:28
Average standard deviation of split frequencies: 0.008037
510500 -- (-528.304) (-531.517) (-532.356) [-527.755] * [-529.812] (-530.031) (-530.990) (-528.705) -- 0:00:28
511000 -- (-527.595) (-534.563) (-530.213) [-530.044] * (-527.190) (-527.275) (-528.724) [-527.431] -- 0:00:28
511500 -- [-529.380] (-528.031) (-528.987) (-527.627) * (-528.566) (-529.044) (-534.003) [-529.108] -- 0:00:28
512000 -- (-535.150) (-528.264) (-530.671) [-529.045] * (-528.891) (-527.808) (-529.110) [-528.668] -- 0:00:28
512500 -- (-531.066) (-527.205) (-531.859) [-528.226] * (-529.314) (-531.142) (-527.086) [-528.930] -- 0:00:29
513000 -- (-530.711) (-530.328) [-528.000] (-528.666) * (-534.501) (-528.011) [-529.893] (-529.659) -- 0:00:29
513500 -- (-532.150) (-527.578) (-527.462) [-530.179] * (-531.419) (-527.350) (-530.627) [-528.735] -- 0:00:29
514000 -- (-527.346) (-529.636) (-527.377) [-532.389] * (-529.453) (-530.398) (-528.154) [-528.482] -- 0:00:29
514500 -- (-530.096) [-529.257] (-529.332) (-526.885) * (-527.985) [-527.394] (-527.028) (-527.350) -- 0:00:29
515000 -- (-528.022) [-527.283] (-529.564) (-527.559) * (-532.686) (-528.602) (-526.771) [-529.930] -- 0:00:29
Average standard deviation of split frequencies: 0.008222
515500 -- (-530.456) [-528.480] (-529.266) (-527.542) * [-528.556] (-528.428) (-528.048) (-533.317) -- 0:00:29
516000 -- (-527.908) (-528.397) (-531.554) [-528.194] * (-528.178) (-527.076) (-528.354) [-529.894] -- 0:00:29
516500 -- [-527.161] (-528.545) (-528.334) (-533.275) * (-528.145) [-527.615] (-527.769) (-530.221) -- 0:00:29
517000 -- [-528.193] (-530.957) (-527.288) (-528.742) * (-529.530) (-532.878) [-529.459] (-527.444) -- 0:00:28
517500 -- (-530.806) (-532.272) [-529.267] (-527.478) * [-527.406] (-527.490) (-526.950) (-528.425) -- 0:00:28
518000 -- [-528.862] (-531.307) (-528.274) (-529.174) * [-528.617] (-528.202) (-526.918) (-528.558) -- 0:00:28
518500 -- [-528.323] (-528.091) (-526.930) (-532.185) * (-528.155) (-529.959) [-529.249] (-532.448) -- 0:00:28
519000 -- (-528.629) (-527.196) [-526.899] (-529.698) * (-529.236) [-528.451] (-527.981) (-527.431) -- 0:00:28
519500 -- (-527.038) (-528.283) (-527.673) [-528.970] * [-527.961] (-528.681) (-528.861) (-528.257) -- 0:00:28
520000 -- (-531.531) (-526.909) [-527.743] (-529.394) * (-528.315) (-527.207) (-529.121) [-531.685] -- 0:00:28
Average standard deviation of split frequencies: 0.008269
520500 -- (-527.785) [-527.942] (-531.115) (-529.292) * (-527.863) (-528.023) (-528.750) [-530.069] -- 0:00:28
521000 -- [-529.762] (-527.789) (-530.506) (-528.652) * (-528.918) (-530.468) (-533.334) [-529.021] -- 0:00:28
521500 -- (-528.911) [-526.972] (-528.693) (-527.157) * (-531.882) [-527.191] (-530.459) (-530.330) -- 0:00:28
522000 -- (-528.136) (-528.827) (-527.762) [-529.954] * (-530.113) [-526.972] (-528.144) (-531.558) -- 0:00:28
522500 -- (-530.729) [-528.041] (-527.593) (-528.711) * [-531.303] (-534.962) (-528.127) (-529.600) -- 0:00:28
523000 -- [-528.775] (-530.988) (-529.377) (-526.580) * [-529.090] (-528.590) (-527.374) (-533.517) -- 0:00:28
523500 -- (-527.587) (-531.726) (-529.021) [-528.588] * (-529.363) (-529.222) [-527.942] (-526.516) -- 0:00:28
524000 -- (-527.010) [-531.458] (-532.973) (-527.593) * (-528.918) (-527.239) [-527.665] (-529.672) -- 0:00:28
524500 -- [-528.000] (-528.634) (-527.231) (-528.670) * (-528.682) (-529.039) [-526.519] (-529.730) -- 0:00:28
525000 -- (-528.508) [-528.278] (-528.936) (-530.480) * [-532.431] (-533.693) (-532.239) (-528.268) -- 0:00:28
Average standard deviation of split frequencies: 0.008122
525500 -- [-529.898] (-532.750) (-529.153) (-529.507) * (-530.029) (-526.738) (-530.771) [-531.340] -- 0:00:27
526000 -- [-527.086] (-529.388) (-531.801) (-530.521) * [-530.241] (-527.193) (-527.881) (-529.962) -- 0:00:27
526500 -- (-530.940) [-528.605] (-529.001) (-530.917) * (-530.782) (-530.390) [-527.433] (-528.210) -- 0:00:27
527000 -- (-529.337) [-530.067] (-527.264) (-530.814) * (-529.344) (-529.154) (-533.017) [-528.252] -- 0:00:27
527500 -- (-532.152) (-529.286) (-528.651) [-527.334] * [-527.797] (-529.379) (-528.627) (-530.077) -- 0:00:27
528000 -- (-531.465) (-529.105) [-529.273] (-529.633) * (-529.690) (-528.365) (-530.680) [-531.565] -- 0:00:27
528500 -- (-527.978) [-531.557] (-527.796) (-529.126) * (-528.532) [-528.706] (-527.780) (-527.687) -- 0:00:27
529000 -- (-530.898) [-530.578] (-527.213) (-527.817) * (-527.615) (-529.063) (-527.990) [-527.346] -- 0:00:27
529500 -- (-533.151) (-527.543) [-527.214] (-528.208) * (-530.642) (-529.095) [-526.974] (-527.310) -- 0:00:28
530000 -- (-529.252) [-527.466] (-530.174) (-528.606) * [-527.760] (-528.948) (-527.687) (-532.654) -- 0:00:28
Average standard deviation of split frequencies: 0.008050
530500 -- (-527.569) (-528.033) (-530.455) [-531.012] * (-530.126) (-528.323) (-527.323) [-532.747] -- 0:00:28
531000 -- (-529.994) (-528.704) [-529.952] (-530.878) * (-528.147) (-534.417) (-530.084) [-527.476] -- 0:00:28
531500 -- [-527.625] (-529.720) (-529.910) (-528.754) * (-527.807) (-528.736) (-529.620) [-526.970] -- 0:00:28
532000 -- [-527.793] (-528.871) (-529.404) (-527.765) * (-529.679) (-528.373) (-529.957) [-532.681] -- 0:00:28
532500 -- (-526.834) (-528.660) [-529.248] (-529.143) * (-528.500) (-528.825) [-526.897] (-530.061) -- 0:00:28
533000 -- (-529.885) [-527.039] (-527.538) (-527.777) * (-526.859) (-530.295) (-527.064) [-526.792] -- 0:00:28
533500 -- (-528.654) (-528.423) [-529.208] (-528.640) * (-526.743) (-530.443) (-527.127) [-529.102] -- 0:00:27
534000 -- (-531.288) (-529.725) (-529.646) [-528.558] * (-527.433) [-528.819] (-528.698) (-530.500) -- 0:00:27
534500 -- (-529.100) [-530.119] (-534.252) (-527.266) * (-527.124) (-528.461) (-529.488) [-528.794] -- 0:00:27
535000 -- (-533.107) (-531.877) [-526.991] (-526.982) * (-529.235) [-528.947] (-527.920) (-528.616) -- 0:00:27
Average standard deviation of split frequencies: 0.007311
535500 -- (-530.206) [-528.673] (-528.022) (-529.547) * (-530.634) (-528.565) (-528.131) [-530.886] -- 0:00:27
536000 -- (-529.795) [-528.413] (-528.212) (-527.814) * [-531.350] (-528.652) (-527.687) (-528.095) -- 0:00:27
536500 -- (-530.354) [-530.010] (-527.879) (-527.474) * (-529.070) [-527.777] (-527.847) (-527.542) -- 0:00:27
537000 -- [-530.270] (-530.881) (-529.158) (-527.041) * (-528.096) [-530.058] (-528.426) (-531.330) -- 0:00:27
537500 -- (-535.926) (-529.600) [-530.246] (-527.153) * (-528.514) (-528.588) (-528.555) [-529.689] -- 0:00:27
538000 -- [-530.799] (-529.821) (-528.631) (-531.433) * (-529.748) (-528.753) [-528.841] (-529.757) -- 0:00:27
538500 -- (-527.886) [-529.804] (-529.149) (-527.677) * (-529.860) (-528.104) [-529.972] (-527.435) -- 0:00:27
539000 -- (-531.555) (-530.220) (-528.782) [-527.735] * (-531.634) (-528.535) (-527.441) [-527.224] -- 0:00:27
539500 -- (-529.444) (-532.930) (-530.686) [-529.473] * (-529.503) (-529.115) [-530.719] (-530.406) -- 0:00:27
540000 -- (-530.213) (-532.672) (-530.569) [-533.817] * (-529.600) [-528.989] (-530.296) (-529.699) -- 0:00:27
Average standard deviation of split frequencies: 0.007556
540500 -- (-528.321) (-529.560) [-528.171] (-528.984) * (-531.473) (-530.447) (-527.004) [-528.276] -- 0:00:27
541000 -- (-529.102) (-528.093) [-528.583] (-529.553) * (-531.279) (-530.304) [-528.040] (-528.671) -- 0:00:27
541500 -- (-528.989) (-526.800) (-527.744) [-528.894] * (-528.532) (-527.587) [-531.036] (-526.850) -- 0:00:27
542000 -- [-533.724] (-532.228) (-528.235) (-528.921) * (-529.162) [-528.940] (-532.696) (-528.327) -- 0:00:27
542500 -- [-528.774] (-530.846) (-527.434) (-528.117) * [-527.799] (-528.439) (-528.918) (-536.924) -- 0:00:26
543000 -- (-530.208) [-531.833] (-528.314) (-528.064) * (-531.015) (-529.892) (-530.268) [-529.590] -- 0:00:26
543500 -- [-527.741] (-529.468) (-530.240) (-531.742) * [-526.680] (-530.204) (-530.043) (-529.016) -- 0:00:26
544000 -- (-527.739) (-529.741) [-528.853] (-533.712) * (-527.928) (-528.593) (-529.546) [-528.138] -- 0:00:26
544500 -- (-529.050) (-531.643) (-527.975) [-527.490] * (-532.576) (-527.389) (-529.727) [-528.454] -- 0:00:26
545000 -- (-527.821) [-533.234] (-527.494) (-532.917) * (-526.719) (-531.632) [-528.635] (-529.180) -- 0:00:26
Average standard deviation of split frequencies: 0.006907
545500 -- [-527.381] (-529.480) (-527.736) (-528.541) * [-526.823] (-533.960) (-529.021) (-528.524) -- 0:00:26
546000 -- (-532.721) (-531.116) (-528.367) [-528.363] * [-529.631] (-531.608) (-527.990) (-528.636) -- 0:00:26
546500 -- (-529.567) (-532.891) [-528.471] (-527.515) * (-529.031) [-528.421] (-529.395) (-531.374) -- 0:00:27
547000 -- (-535.231) (-528.635) (-532.188) [-527.465] * (-527.057) [-528.576] (-529.248) (-527.828) -- 0:00:27
547500 -- [-535.706] (-529.071) (-528.901) (-527.443) * [-526.831] (-528.928) (-527.535) (-529.743) -- 0:00:27
548000 -- (-532.087) (-529.241) [-529.124] (-531.211) * [-526.835] (-527.961) (-528.324) (-530.432) -- 0:00:27
548500 -- (-530.474) (-529.175) [-528.439] (-527.411) * [-526.869] (-528.432) (-528.039) (-527.341) -- 0:00:27
549000 -- [-530.435] (-530.334) (-531.774) (-526.617) * (-527.707) (-538.425) [-529.112] (-528.459) -- 0:00:27
549500 -- (-528.208) (-529.641) (-528.559) [-526.854] * (-527.674) (-529.545) [-532.038] (-527.992) -- 0:00:27
550000 -- (-531.584) [-530.502] (-529.265) (-531.536) * (-530.493) (-530.187) (-528.486) [-527.503] -- 0:00:27
Average standard deviation of split frequencies: 0.007201
550500 -- (-529.594) [-529.987] (-529.818) (-528.921) * (-531.297) (-527.425) [-527.813] (-529.413) -- 0:00:26
551000 -- (-530.820) (-530.600) [-530.660] (-531.235) * (-526.791) (-530.443) [-528.831] (-528.996) -- 0:00:26
551500 -- (-529.252) [-527.785] (-529.032) (-533.750) * (-528.048) [-528.672] (-530.387) (-526.924) -- 0:00:26
552000 -- [-527.338] (-527.740) (-527.970) (-527.673) * (-527.980) (-527.692) [-527.589] (-528.440) -- 0:00:26
552500 -- (-528.022) [-530.967] (-528.875) (-527.960) * (-527.014) [-530.086] (-527.350) (-529.051) -- 0:00:26
553000 -- [-528.050] (-535.225) (-528.619) (-529.756) * (-528.357) (-530.685) (-531.713) [-530.988] -- 0:00:26
553500 -- (-531.783) [-528.867] (-528.174) (-531.739) * (-527.406) (-527.718) [-529.028] (-533.572) -- 0:00:26
554000 -- [-528.002] (-527.598) (-530.526) (-529.108) * [-530.274] (-530.957) (-531.288) (-529.901) -- 0:00:26
554500 -- (-528.764) [-527.223] (-530.759) (-527.243) * (-528.616) (-528.159) (-529.340) [-528.705] -- 0:00:26
555000 -- (-527.565) [-527.948] (-528.027) (-529.207) * (-531.784) (-529.968) [-534.508] (-531.080) -- 0:00:26
Average standard deviation of split frequencies: 0.007687
555500 -- [-527.544] (-528.541) (-528.187) (-528.528) * (-532.114) (-531.535) (-529.308) [-528.295] -- 0:00:26
556000 -- (-528.322) (-531.128) [-534.792] (-530.228) * (-528.086) (-528.435) (-527.202) [-532.285] -- 0:00:26
556500 -- [-527.285] (-528.402) (-530.995) (-531.111) * (-528.106) (-527.431) [-527.249] (-527.229) -- 0:00:26
557000 -- (-527.815) (-530.773) [-530.967] (-529.830) * (-535.011) [-527.958] (-528.279) (-527.931) -- 0:00:26
557500 -- (-527.865) (-528.602) [-530.159] (-527.361) * (-533.981) [-527.605] (-532.575) (-531.899) -- 0:00:26
558000 -- (-530.982) [-528.818] (-531.081) (-530.885) * (-527.600) [-528.553] (-528.064) (-529.916) -- 0:00:26
558500 -- (-530.212) [-529.541] (-527.831) (-527.390) * (-528.311) [-533.408] (-528.873) (-529.368) -- 0:00:26
559000 -- (-528.714) (-529.749) (-528.034) [-526.729] * (-536.504) (-532.339) (-528.049) [-529.132] -- 0:00:26
559500 -- (-528.660) (-527.613) [-527.702] (-527.110) * (-529.800) [-532.092] (-528.109) (-532.586) -- 0:00:25
560000 -- [-528.831] (-528.592) (-529.637) (-531.027) * (-529.889) [-529.772] (-528.454) (-532.642) -- 0:00:25
Average standard deviation of split frequencies: 0.007567
560500 -- (-527.128) [-527.744] (-528.698) (-529.016) * (-531.217) [-529.072] (-529.048) (-533.517) -- 0:00:25
561000 -- (-526.687) (-529.219) (-528.716) [-528.594] * (-530.346) [-526.959] (-528.435) (-529.319) -- 0:00:25
561500 -- (-530.645) [-527.354] (-528.525) (-534.226) * (-531.577) [-527.595] (-527.835) (-529.457) -- 0:00:25
562000 -- (-530.912) (-529.358) [-528.128] (-531.199) * (-530.557) (-528.478) (-529.276) [-529.039] -- 0:00:25
562500 -- (-529.346) (-527.275) (-537.253) [-532.995] * (-528.659) (-527.424) [-527.681] (-528.210) -- 0:00:25
563000 -- (-529.292) (-527.676) [-531.569] (-532.475) * (-531.020) [-529.765] (-529.652) (-528.060) -- 0:00:26
563500 -- (-528.724) [-529.396] (-529.634) (-532.110) * (-527.473) (-529.540) (-529.622) [-527.972] -- 0:00:26
564000 -- [-528.455] (-527.748) (-532.326) (-530.001) * (-529.034) (-534.796) (-528.673) [-527.663] -- 0:00:26
564500 -- (-529.451) [-527.523] (-529.993) (-528.649) * (-530.148) (-529.037) [-527.213] (-528.964) -- 0:00:26
565000 -- (-529.113) [-531.682] (-529.876) (-528.132) * [-526.973] (-526.991) (-526.948) (-527.847) -- 0:00:26
Average standard deviation of split frequencies: 0.007588
565500 -- (-527.677) (-531.091) (-528.623) [-528.812] * (-528.563) (-527.160) [-527.464] (-528.710) -- 0:00:26
566000 -- (-527.935) (-532.230) (-528.343) [-528.084] * (-531.633) (-527.059) (-529.869) [-527.787] -- 0:00:26
566500 -- [-527.036] (-530.873) (-528.569) (-528.028) * (-528.405) (-526.932) [-528.347] (-527.982) -- 0:00:26
567000 -- (-529.370) (-528.726) [-529.512] (-529.676) * (-528.853) [-531.906] (-528.498) (-526.851) -- 0:00:25
567500 -- (-530.842) (-529.058) (-528.011) [-528.496] * [-529.538] (-529.530) (-527.527) (-528.935) -- 0:00:25
568000 -- [-527.322] (-527.905) (-527.363) (-530.071) * [-531.093] (-528.711) (-529.422) (-529.048) -- 0:00:25
568500 -- (-529.721) (-528.240) [-526.618] (-530.617) * (-529.694) [-529.209] (-534.079) (-528.653) -- 0:00:25
569000 -- [-528.962] (-532.042) (-528.006) (-528.368) * (-531.696) (-528.687) (-529.032) [-528.140] -- 0:00:25
569500 -- (-527.170) (-531.653) (-527.800) [-528.749] * [-529.926] (-530.115) (-528.106) (-527.511) -- 0:00:25
570000 -- (-527.336) [-529.522] (-527.449) (-528.025) * (-531.700) (-528.865) (-529.174) [-527.733] -- 0:00:25
Average standard deviation of split frequencies: 0.007796
570500 -- (-530.024) [-527.851] (-528.971) (-527.851) * (-528.193) [-527.205] (-527.948) (-527.834) -- 0:00:25
571000 -- [-527.652] (-529.532) (-527.123) (-529.542) * (-528.080) (-528.005) [-527.942] (-534.707) -- 0:00:25
571500 -- [-527.323] (-530.882) (-530.252) (-529.024) * (-530.664) (-529.128) (-527.587) [-531.125] -- 0:00:25
572000 -- [-527.241] (-528.603) (-527.723) (-528.146) * [-528.434] (-527.730) (-527.430) (-529.107) -- 0:00:25
572500 -- (-527.246) [-528.300] (-527.415) (-528.423) * (-530.116) [-529.000] (-530.708) (-527.774) -- 0:00:25
573000 -- (-527.469) (-528.528) (-528.341) [-530.289] * [-529.918] (-528.696) (-529.161) (-526.619) -- 0:00:25
573500 -- (-528.573) [-527.446] (-529.358) (-527.683) * [-529.034] (-531.095) (-528.972) (-530.194) -- 0:00:25
574000 -- (-528.908) [-528.623] (-528.096) (-529.937) * (-528.602) (-527.579) [-527.673] (-528.688) -- 0:00:25
574500 -- [-530.025] (-528.861) (-526.671) (-528.918) * (-527.048) (-527.505) (-531.995) [-530.495] -- 0:00:25
575000 -- [-528.260] (-528.564) (-527.228) (-530.301) * (-528.327) (-528.495) [-527.984] (-528.872) -- 0:00:25
Average standard deviation of split frequencies: 0.007315
575500 -- (-529.008) [-530.255] (-527.881) (-528.053) * (-529.740) [-528.407] (-528.302) (-527.027) -- 0:00:25
576000 -- (-527.565) (-529.265) [-530.594] (-527.290) * [-530.044] (-527.069) (-530.158) (-528.337) -- 0:00:25
576500 -- [-527.618] (-529.112) (-527.480) (-528.667) * (-529.565) [-527.068] (-527.583) (-528.785) -- 0:00:24
577000 -- (-528.291) (-528.269) [-528.142] (-530.052) * (-527.142) (-528.238) (-528.801) [-527.629] -- 0:00:24
577500 -- (-527.389) [-530.319] (-532.305) (-527.951) * (-530.391) (-530.456) (-530.567) [-527.649] -- 0:00:24
578000 -- [-528.735] (-529.733) (-534.709) (-527.804) * [-528.815] (-528.790) (-530.356) (-530.616) -- 0:00:24
578500 -- [-528.046] (-530.495) (-530.675) (-528.451) * (-531.744) (-528.542) (-533.167) [-531.024] -- 0:00:24
579000 -- (-529.582) (-530.793) (-528.540) [-527.617] * [-535.073] (-530.976) (-527.412) (-531.544) -- 0:00:24
579500 -- [-530.432] (-528.963) (-529.276) (-529.039) * (-530.094) (-526.716) [-527.798] (-527.289) -- 0:00:24
580000 -- [-527.036] (-528.082) (-528.769) (-526.809) * (-527.034) [-526.893] (-531.125) (-527.687) -- 0:00:25
Average standard deviation of split frequencies: 0.006711
580500 -- (-531.097) (-527.179) [-529.709] (-530.054) * (-527.476) [-526.983] (-527.682) (-529.114) -- 0:00:25
581000 -- (-526.874) [-529.217] (-529.463) (-530.639) * (-527.778) [-531.520] (-527.506) (-530.940) -- 0:00:25
581500 -- (-529.495) (-533.875) (-528.721) [-529.220] * [-528.128] (-530.651) (-528.853) (-528.076) -- 0:00:25
582000 -- (-527.082) (-530.534) [-528.499] (-530.707) * (-529.863) [-530.092] (-527.018) (-530.395) -- 0:00:25
582500 -- (-529.780) (-529.579) (-529.910) [-528.296] * (-528.183) (-531.207) (-529.519) [-526.948] -- 0:00:25
583000 -- (-526.749) (-529.511) [-527.320] (-531.718) * (-528.393) (-529.779) [-528.006] (-528.764) -- 0:00:25
583500 -- (-529.357) [-530.717] (-529.064) (-529.380) * (-527.401) (-534.519) (-526.836) [-527.913] -- 0:00:24
584000 -- (-529.154) (-528.127) [-530.280] (-530.515) * (-527.339) (-527.304) [-527.947] (-528.199) -- 0:00:24
584500 -- (-527.368) (-527.798) [-528.296] (-527.074) * (-527.277) (-530.144) [-527.474] (-527.459) -- 0:00:24
585000 -- (-531.639) (-526.801) [-527.513] (-528.959) * (-527.702) [-528.494] (-529.519) (-530.120) -- 0:00:24
Average standard deviation of split frequencies: 0.005962
585500 -- (-530.447) [-530.449] (-528.759) (-527.087) * [-532.322] (-527.492) (-529.269) (-529.932) -- 0:00:24
586000 -- (-531.345) [-528.108] (-529.990) (-527.865) * (-528.550) (-527.507) (-528.142) [-528.320] -- 0:00:24
586500 -- (-528.175) (-531.614) (-531.610) [-529.394] * (-531.947) [-527.976] (-527.416) (-527.189) -- 0:00:24
587000 -- [-527.834] (-531.327) (-531.386) (-528.115) * (-529.217) [-527.285] (-529.460) (-527.909) -- 0:00:24
587500 -- (-528.343) (-530.216) [-530.997] (-530.066) * [-527.853] (-532.474) (-526.816) (-529.064) -- 0:00:24
588000 -- (-531.593) [-531.802] (-527.840) (-529.280) * (-530.124) [-532.400] (-528.661) (-530.066) -- 0:00:24
588500 -- (-528.877) (-530.467) (-527.972) [-528.462] * [-528.291] (-529.976) (-530.875) (-532.134) -- 0:00:24
589000 -- (-531.382) [-527.203] (-528.323) (-527.622) * (-530.429) [-531.976] (-532.233) (-529.694) -- 0:00:24
589500 -- (-528.020) [-528.276] (-531.472) (-527.767) * (-529.051) [-529.967] (-530.678) (-529.773) -- 0:00:24
590000 -- (-529.539) [-527.906] (-532.774) (-528.319) * (-532.676) (-534.936) [-527.790] (-528.400) -- 0:00:24
Average standard deviation of split frequencies: 0.005164
590500 -- [-527.972] (-529.272) (-529.397) (-527.166) * (-528.433) [-530.537] (-528.186) (-527.810) -- 0:00:24
591000 -- (-528.882) [-529.997] (-527.417) (-531.613) * [-529.762] (-529.796) (-528.735) (-530.901) -- 0:00:24
591500 -- [-527.401] (-529.156) (-530.482) (-531.402) * (-527.873) [-528.981] (-529.781) (-529.107) -- 0:00:24
592000 -- (-526.983) (-531.308) [-527.267] (-530.974) * [-528.854] (-527.055) (-528.811) (-529.000) -- 0:00:24
592500 -- [-527.258] (-528.551) (-528.636) (-530.129) * (-529.995) [-530.844] (-527.299) (-529.000) -- 0:00:24
593000 -- (-527.884) [-528.906] (-527.759) (-526.972) * (-532.186) (-527.706) (-528.827) [-528.152] -- 0:00:24
593500 -- (-529.124) (-528.586) [-529.333] (-527.887) * (-531.972) (-530.556) (-530.930) [-527.296] -- 0:00:23
594000 -- (-530.994) [-528.797] (-529.047) (-528.889) * [-528.150] (-528.114) (-529.785) (-528.090) -- 0:00:23
594500 -- (-531.718) (-527.066) (-529.045) [-527.948] * (-530.504) [-528.080] (-535.557) (-528.466) -- 0:00:23
595000 -- (-532.575) (-531.802) (-530.832) [-527.625] * (-529.103) [-527.066] (-531.776) (-528.769) -- 0:00:23
Average standard deviation of split frequencies: 0.005118
595500 -- (-528.421) (-532.574) (-529.073) [-527.316] * (-531.842) (-527.841) [-529.785] (-532.243) -- 0:00:24
596000 -- (-531.922) (-530.499) [-528.040] (-529.281) * (-530.523) [-528.179] (-529.524) (-526.872) -- 0:00:24
596500 -- (-532.581) (-529.917) (-531.452) [-529.319] * (-530.040) [-528.904] (-529.165) (-527.338) -- 0:00:24
597000 -- (-529.301) (-528.854) (-530.157) [-527.870] * [-528.468] (-529.759) (-529.962) (-529.036) -- 0:00:24
597500 -- (-529.438) [-527.687] (-529.487) (-529.377) * [-528.174] (-529.513) (-532.446) (-528.860) -- 0:00:24
598000 -- (-527.835) (-529.538) [-527.806] (-531.668) * [-532.169] (-528.185) (-528.847) (-527.245) -- 0:00:24
598500 -- (-527.236) (-528.299) [-528.507] (-527.298) * [-531.050] (-527.675) (-528.347) (-527.416) -- 0:00:24
599000 -- (-526.981) (-530.189) [-531.272] (-527.428) * (-528.878) (-529.597) [-527.155] (-529.460) -- 0:00:24
599500 -- [-528.793] (-527.116) (-528.453) (-531.442) * (-527.224) [-531.095] (-528.188) (-527.974) -- 0:00:24
600000 -- [-527.621] (-528.409) (-529.955) (-533.419) * (-527.755) [-528.704] (-528.527) (-528.223) -- 0:00:24
Average standard deviation of split frequencies: 0.004801
600500 -- [-531.048] (-531.215) (-527.000) (-530.586) * [-530.878] (-528.926) (-531.942) (-528.915) -- 0:00:23
601000 -- (-531.823) (-529.461) [-528.061] (-531.823) * (-528.769) [-531.217] (-527.680) (-534.404) -- 0:00:23
601500 -- (-534.369) [-527.950] (-532.217) (-534.752) * (-529.745) (-529.554) (-529.406) [-528.320] -- 0:00:23
602000 -- (-529.800) (-531.261) [-527.133] (-530.955) * (-527.949) (-531.013) [-527.750] (-527.911) -- 0:00:23
602500 -- [-528.102] (-528.293) (-528.381) (-527.811) * (-527.400) (-537.284) [-527.463] (-528.961) -- 0:00:23
603000 -- [-528.400] (-528.122) (-529.299) (-530.004) * [-529.482] (-529.305) (-529.705) (-530.438) -- 0:00:23
603500 -- (-532.145) (-528.164) (-526.997) [-528.851] * [-530.584] (-528.461) (-529.879) (-528.062) -- 0:00:23
604000 -- [-533.437] (-527.807) (-527.782) (-532.552) * [-527.284] (-528.904) (-528.359) (-528.032) -- 0:00:23
604500 -- (-542.031) [-527.397] (-526.941) (-527.474) * (-527.753) (-530.059) [-529.076] (-530.637) -- 0:00:23
605000 -- (-537.142) [-531.047] (-528.967) (-530.375) * (-528.422) [-528.832] (-530.524) (-528.159) -- 0:00:23
Average standard deviation of split frequencies: 0.004393
605500 -- (-534.263) (-532.909) (-527.350) [-527.908] * [-530.214] (-531.478) (-530.031) (-528.760) -- 0:00:23
606000 -- (-529.237) (-527.813) [-528.992] (-529.644) * (-529.132) (-528.407) (-528.176) [-528.525] -- 0:00:23
606500 -- [-529.871] (-529.088) (-530.925) (-530.057) * [-529.160] (-528.100) (-529.556) (-528.310) -- 0:00:23
607000 -- [-529.040] (-527.267) (-530.483) (-529.984) * (-527.927) (-531.008) (-533.258) [-527.951] -- 0:00:23
607500 -- (-530.426) (-527.798) [-532.039] (-529.078) * (-530.185) (-531.507) [-530.623] (-526.793) -- 0:00:23
608000 -- (-535.383) [-526.787] (-529.309) (-532.013) * (-532.210) (-530.175) (-527.300) [-529.079] -- 0:00:23
608500 -- (-534.373) (-529.654) [-529.167] (-531.720) * [-531.124] (-528.390) (-527.225) (-529.776) -- 0:00:23
609000 -- [-529.599] (-529.789) (-528.286) (-528.320) * (-528.282) [-529.044] (-531.034) (-527.784) -- 0:00:23
609500 -- (-535.409) (-529.477) [-527.994] (-531.126) * [-528.060] (-529.996) (-528.442) (-527.264) -- 0:00:23
610000 -- (-529.078) (-528.451) [-527.888] (-528.117) * (-529.881) (-527.902) (-526.880) [-527.461] -- 0:00:23
Average standard deviation of split frequencies: 0.004289
610500 -- (-530.489) (-527.309) (-529.081) [-529.409] * [-527.868] (-529.778) (-527.658) (-528.661) -- 0:00:22
611000 -- [-527.409] (-527.567) (-529.579) (-528.592) * [-527.321] (-530.125) (-527.518) (-528.214) -- 0:00:22
611500 -- (-527.368) [-530.378] (-530.037) (-526.931) * (-527.829) (-530.086) (-528.567) [-531.612] -- 0:00:22
612000 -- [-531.425] (-528.481) (-529.248) (-528.523) * (-530.096) [-528.935] (-528.266) (-529.882) -- 0:00:23
612500 -- (-528.638) (-527.939) [-529.851] (-528.408) * [-528.861] (-529.030) (-526.906) (-527.995) -- 0:00:23
613000 -- [-529.030] (-527.711) (-527.208) (-527.146) * (-531.330) (-529.525) [-526.895] (-528.555) -- 0:00:23
613500 -- [-526.467] (-528.597) (-529.167) (-527.281) * (-529.097) (-526.971) [-527.647] (-531.068) -- 0:00:23
614000 -- (-526.468) (-533.549) (-532.119) [-529.403] * (-529.193) (-527.913) [-529.065] (-531.120) -- 0:00:23
614500 -- (-526.846) (-533.420) [-530.191] (-527.450) * (-531.473) (-527.770) (-531.587) [-527.732] -- 0:00:23
615000 -- (-527.664) (-529.203) (-532.049) [-528.155] * (-527.307) [-535.547] (-532.564) (-527.800) -- 0:00:23
Average standard deviation of split frequencies: 0.004209
615500 -- (-532.320) (-527.468) (-530.408) [-528.890] * (-527.490) (-528.908) [-529.283] (-530.708) -- 0:00:23
616000 -- (-532.645) (-529.797) (-527.112) [-530.093] * (-532.739) (-529.978) (-529.645) [-530.786] -- 0:00:23
616500 -- (-528.601) (-527.670) (-526.724) [-530.780] * (-530.838) [-528.954] (-528.627) (-529.118) -- 0:00:23
617000 -- (-529.051) (-527.606) [-529.227] (-533.050) * (-530.434) (-530.274) [-529.432] (-531.572) -- 0:00:22
617500 -- (-528.753) (-527.664) (-528.683) [-530.484] * [-528.223] (-529.404) (-529.235) (-534.334) -- 0:00:22
618000 -- [-527.855] (-530.952) (-527.863) (-526.820) * [-528.166] (-531.085) (-529.782) (-531.166) -- 0:00:22
618500 -- [-527.098] (-531.523) (-527.193) (-527.581) * (-527.626) [-528.976] (-528.705) (-527.765) -- 0:00:22
619000 -- (-530.326) (-533.199) (-526.641) [-527.228] * (-527.332) [-528.841] (-533.737) (-528.731) -- 0:00:22
619500 -- (-528.198) (-533.754) [-526.787] (-529.581) * (-528.004) (-535.525) [-532.666] (-532.084) -- 0:00:22
620000 -- (-529.369) [-530.227] (-527.627) (-527.737) * (-532.068) [-527.997] (-528.242) (-530.501) -- 0:00:22
Average standard deviation of split frequencies: 0.004101
620500 -- (-528.407) (-531.081) (-527.465) [-528.726] * (-529.305) [-528.463] (-529.636) (-531.539) -- 0:00:22
621000 -- (-532.425) [-527.482] (-528.326) (-533.341) * (-528.619) (-526.783) [-530.657] (-533.274) -- 0:00:22
621500 -- [-527.752] (-530.825) (-530.248) (-531.170) * (-529.508) (-526.644) [-529.374] (-531.365) -- 0:00:22
622000 -- (-531.472) (-530.301) [-530.074] (-531.502) * (-530.623) (-527.589) (-526.676) [-534.059] -- 0:00:22
622500 -- (-530.886) (-529.126) [-530.884] (-530.327) * [-528.252] (-531.958) (-527.183) (-530.756) -- 0:00:22
623000 -- (-527.605) [-527.922] (-526.824) (-528.666) * [-529.043] (-527.654) (-528.241) (-534.628) -- 0:00:22
623500 -- (-530.454) [-529.576] (-527.860) (-527.427) * (-527.605) (-528.405) [-530.143] (-532.603) -- 0:00:22
624000 -- (-533.323) (-527.098) (-527.428) [-529.130] * (-527.409) (-529.444) (-528.219) [-527.838] -- 0:00:22
624500 -- (-528.910) (-530.244) [-527.740] (-530.213) * (-530.496) (-527.744) (-531.454) [-534.614] -- 0:00:22
625000 -- [-530.126] (-528.224) (-527.479) (-529.782) * (-533.633) [-527.720] (-531.168) (-528.010) -- 0:00:22
Average standard deviation of split frequencies: 0.004385
625500 -- [-530.118] (-529.023) (-528.111) (-529.421) * (-528.840) (-528.925) (-533.838) [-528.886] -- 0:00:22
626000 -- [-526.921] (-530.418) (-526.575) (-528.166) * (-529.534) (-530.807) (-530.595) [-528.226] -- 0:00:22
626500 -- (-528.624) [-529.698] (-529.410) (-527.214) * (-528.379) [-527.889] (-528.545) (-535.354) -- 0:00:22
627000 -- (-528.786) (-529.821) (-526.848) [-527.250] * (-532.198) [-531.962] (-529.672) (-532.414) -- 0:00:22
627500 -- (-531.360) [-528.202] (-527.221) (-527.424) * (-533.266) [-528.273] (-529.639) (-529.402) -- 0:00:21
628000 -- (-530.120) (-529.972) [-527.989] (-531.935) * [-527.046] (-529.246) (-531.892) (-531.261) -- 0:00:21
628500 -- (-529.666) (-527.098) [-528.151] (-528.390) * (-526.609) [-529.462] (-529.217) (-530.330) -- 0:00:21
629000 -- (-530.303) [-526.782] (-527.826) (-528.665) * (-527.173) (-528.389) [-530.451] (-527.941) -- 0:00:22
629500 -- (-536.672) [-527.845] (-527.944) (-532.391) * (-534.276) (-528.185) (-530.758) [-526.949] -- 0:00:22
630000 -- (-532.384) (-529.023) [-529.192] (-529.404) * (-535.881) (-530.984) [-527.930] (-528.391) -- 0:00:22
Average standard deviation of split frequencies: 0.004345
630500 -- (-529.886) [-528.689] (-529.275) (-531.285) * [-532.142] (-530.148) (-527.959) (-527.144) -- 0:00:22
631000 -- (-529.116) (-531.046) (-528.721) [-535.115] * (-528.910) (-529.294) [-528.352] (-527.723) -- 0:00:22
631500 -- (-527.657) (-531.840) [-529.797] (-530.423) * (-528.523) (-529.935) [-527.844] (-531.053) -- 0:00:22
632000 -- [-528.275] (-531.792) (-529.396) (-532.242) * (-528.691) (-528.793) (-528.024) [-529.905] -- 0:00:22
632500 -- (-528.072) [-530.142] (-531.116) (-533.072) * (-529.282) [-530.852] (-528.215) (-528.824) -- 0:00:22
633000 -- (-527.425) [-528.987] (-528.632) (-529.543) * (-527.462) (-529.744) [-529.126] (-531.655) -- 0:00:22
633500 -- [-530.253] (-527.153) (-529.154) (-527.134) * (-527.780) (-529.158) [-530.767] (-527.683) -- 0:00:21
634000 -- [-531.173] (-528.303) (-529.822) (-527.106) * [-530.729] (-527.235) (-528.365) (-533.082) -- 0:00:21
634500 -- [-528.049] (-529.200) (-528.654) (-530.937) * (-528.597) [-528.559] (-526.565) (-528.553) -- 0:00:21
635000 -- (-531.774) (-527.949) (-531.202) [-529.600] * [-526.760] (-526.662) (-527.887) (-527.997) -- 0:00:21
Average standard deviation of split frequencies: 0.004355
635500 -- [-533.278] (-529.615) (-530.555) (-529.536) * (-530.407) [-527.412] (-527.025) (-528.546) -- 0:00:21
636000 -- (-531.097) [-531.602] (-528.561) (-527.927) * (-531.581) [-528.155] (-526.982) (-529.123) -- 0:00:21
636500 -- [-527.956] (-529.466) (-529.490) (-528.579) * (-527.997) [-527.977] (-527.388) (-528.190) -- 0:00:21
637000 -- (-530.105) [-527.177] (-530.523) (-528.083) * [-530.566] (-529.399) (-527.874) (-528.683) -- 0:00:21
637500 -- [-529.008] (-528.532) (-528.976) (-529.162) * [-528.263] (-529.015) (-530.565) (-530.659) -- 0:00:21
638000 -- (-529.717) (-531.614) (-531.583) [-528.816] * [-527.018] (-532.527) (-528.031) (-528.931) -- 0:00:21
638500 -- (-529.397) (-529.787) [-526.745] (-529.612) * [-532.651] (-531.817) (-527.571) (-527.386) -- 0:00:21
639000 -- [-527.276] (-528.157) (-528.135) (-530.039) * (-528.001) (-531.246) (-530.341) [-527.754] -- 0:00:21
639500 -- [-533.988] (-527.617) (-527.765) (-534.051) * (-530.050) [-532.423] (-529.137) (-532.001) -- 0:00:21
640000 -- [-529.481] (-527.229) (-527.951) (-528.316) * (-529.262) (-527.324) [-527.557] (-528.339) -- 0:00:21
Average standard deviation of split frequencies: 0.004645
640500 -- (-528.060) (-527.173) [-527.827] (-534.322) * (-529.167) [-529.683] (-527.014) (-539.197) -- 0:00:21
641000 -- [-529.648] (-527.209) (-528.001) (-534.311) * (-528.269) (-528.665) [-528.124] (-528.098) -- 0:00:21
641500 -- (-527.336) (-533.382) (-528.773) [-531.091] * (-528.810) (-534.194) (-529.182) [-527.474] -- 0:00:21
642000 -- [-528.472] (-533.280) (-528.658) (-529.759) * (-531.122) (-526.959) (-532.841) [-527.760] -- 0:00:21
642500 -- (-528.423) [-533.498] (-529.698) (-528.575) * (-530.887) (-531.538) (-527.701) [-528.206] -- 0:00:21
643000 -- [-529.085] (-531.436) (-530.259) (-530.656) * (-531.191) (-529.558) (-529.114) [-528.249] -- 0:00:21
643500 -- [-528.063] (-529.141) (-529.678) (-531.545) * (-527.336) (-536.482) (-530.953) [-527.931] -- 0:00:21
644000 -- (-528.621) (-528.597) [-527.106] (-527.616) * (-533.278) (-539.514) (-530.602) [-527.644] -- 0:00:21
644500 -- [-527.885] (-528.428) (-528.344) (-530.547) * [-533.123] (-530.496) (-531.468) (-527.176) -- 0:00:20
645000 -- (-529.933) (-527.661) (-526.946) [-527.057] * (-532.460) [-529.532] (-530.424) (-530.614) -- 0:00:20
Average standard deviation of split frequencies: 0.004979
645500 -- (-528.005) (-527.678) (-528.928) [-528.596] * [-533.233] (-527.860) (-528.921) (-528.018) -- 0:00:21
646000 -- (-528.550) [-528.914] (-530.457) (-527.406) * (-532.813) (-528.675) [-527.139] (-530.371) -- 0:00:21
646500 -- (-530.121) (-528.758) [-528.045] (-529.640) * (-537.292) (-531.524) [-529.551] (-529.563) -- 0:00:21
647000 -- (-530.009) (-528.152) (-531.052) [-528.145] * (-528.590) [-530.491] (-530.901) (-530.543) -- 0:00:21
647500 -- [-528.605] (-529.066) (-527.525) (-529.524) * (-529.963) [-529.365] (-532.341) (-527.192) -- 0:00:21
648000 -- [-528.817] (-528.956) (-530.005) (-527.494) * [-531.082] (-529.769) (-529.184) (-527.049) -- 0:00:21
648500 -- (-528.951) [-530.041] (-529.433) (-527.040) * (-527.047) [-528.243] (-531.853) (-529.758) -- 0:00:21
649000 -- (-529.234) [-532.592] (-528.148) (-533.279) * (-528.349) (-529.903) [-528.370] (-529.374) -- 0:00:21
649500 -- [-528.909] (-532.753) (-529.514) (-531.734) * (-530.737) [-527.116] (-527.437) (-526.943) -- 0:00:21
650000 -- (-528.187) (-529.011) [-535.476] (-531.382) * (-527.656) (-531.125) [-527.132] (-529.762) -- 0:00:21
Average standard deviation of split frequencies: 0.004517
650500 -- (-538.524) [-528.066] (-533.861) (-530.207) * (-530.334) (-528.492) (-527.544) [-528.905] -- 0:00:20
651000 -- (-530.762) (-527.492) [-527.981] (-529.955) * [-528.690] (-530.726) (-534.033) (-528.812) -- 0:00:20
651500 -- (-530.706) [-531.755] (-529.564) (-529.587) * (-532.228) (-528.704) [-527.345] (-528.426) -- 0:00:20
652000 -- [-530.590] (-532.261) (-530.059) (-529.398) * (-529.281) (-527.691) (-529.114) [-528.823] -- 0:00:20
652500 -- (-528.583) [-532.000] (-533.277) (-527.123) * (-527.871) (-527.513) (-528.755) [-527.052] -- 0:00:20
653000 -- (-528.995) [-529.118] (-531.075) (-529.029) * [-530.168] (-527.502) (-529.554) (-528.160) -- 0:00:20
653500 -- (-529.390) (-533.263) (-528.888) [-528.978] * (-528.020) [-527.058] (-527.247) (-527.193) -- 0:00:20
654000 -- (-531.315) (-532.959) (-529.038) [-529.890] * (-527.848) (-527.652) (-528.613) [-530.673] -- 0:00:20
654500 -- (-528.409) (-533.315) [-529.353] (-531.383) * (-528.960) (-526.710) [-529.371] (-527.555) -- 0:00:20
655000 -- (-530.414) (-535.965) (-532.354) [-530.031] * (-531.627) (-527.440) (-527.195) [-527.437] -- 0:00:20
Average standard deviation of split frequencies: 0.004581
655500 -- [-528.239] (-531.723) (-532.260) (-527.691) * (-528.697) (-528.243) (-530.129) [-528.430] -- 0:00:20
656000 -- (-527.127) (-537.246) [-526.651] (-528.846) * (-528.218) (-527.961) (-535.527) [-528.061] -- 0:00:20
656500 -- [-531.541] (-530.860) (-531.371) (-529.082) * (-531.241) (-528.119) [-528.529] (-529.311) -- 0:00:20
657000 -- (-528.600) [-529.864] (-528.232) (-532.812) * [-527.937] (-530.998) (-527.629) (-529.787) -- 0:00:20
657500 -- (-528.399) (-530.604) (-528.395) [-527.849] * (-527.399) (-531.444) [-529.634] (-529.753) -- 0:00:20
658000 -- [-530.113] (-526.597) (-529.045) (-528.898) * [-527.581] (-527.758) (-527.635) (-532.186) -- 0:00:20
658500 -- (-533.082) (-528.961) [-531.319] (-528.023) * (-527.417) (-529.074) (-528.439) [-528.249] -- 0:00:20
659000 -- (-528.128) [-529.039] (-528.532) (-529.468) * [-528.287] (-530.419) (-528.039) (-535.783) -- 0:00:20
659500 -- [-528.720] (-527.249) (-528.538) (-527.805) * [-530.240] (-530.731) (-527.085) (-530.579) -- 0:00:20
660000 -- (-530.230) (-527.390) (-529.665) [-528.382] * [-530.079] (-534.167) (-529.783) (-531.475) -- 0:00:20
Average standard deviation of split frequencies: 0.005173
660500 -- (-528.481) (-527.672) (-531.568) [-528.810] * [-527.614] (-528.183) (-529.273) (-530.182) -- 0:00:20
661000 -- (-528.729) [-530.905] (-529.226) (-533.468) * (-527.576) (-527.638) (-528.615) [-529.261] -- 0:00:20
661500 -- [-528.282] (-531.040) (-527.579) (-533.373) * [-528.708] (-530.355) (-531.297) (-530.945) -- 0:00:19
662000 -- (-532.024) (-531.229) (-531.782) [-528.451] * (-528.197) (-527.472) (-531.679) [-528.272] -- 0:00:19
662500 -- (-528.954) (-529.007) [-529.987] (-529.051) * (-527.423) [-528.278] (-528.064) (-529.038) -- 0:00:20
663000 -- (-530.269) [-527.007] (-533.423) (-533.301) * [-530.682] (-530.068) (-527.505) (-530.061) -- 0:00:20
663500 -- (-529.260) (-527.435) [-530.384] (-533.547) * (-529.295) (-528.759) [-527.374] (-528.104) -- 0:00:20
664000 -- [-528.076] (-527.666) (-529.215) (-528.487) * (-528.819) (-527.808) (-532.567) [-530.051] -- 0:00:20
664500 -- (-531.714) (-528.615) [-530.887] (-532.917) * (-530.378) [-529.480] (-527.859) (-528.479) -- 0:00:20
665000 -- (-530.719) [-528.768] (-532.172) (-531.294) * (-528.710) [-527.916] (-527.334) (-528.769) -- 0:00:20
Average standard deviation of split frequencies: 0.005087
665500 -- (-528.486) (-533.055) [-528.561] (-526.938) * (-528.859) [-528.901] (-527.334) (-530.757) -- 0:00:20
666000 -- (-530.388) (-531.090) (-528.481) [-529.540] * (-527.364) [-532.110] (-527.772) (-528.588) -- 0:00:20
666500 -- (-528.075) [-529.708] (-527.027) (-526.852) * (-533.450) [-528.584] (-528.527) (-528.386) -- 0:00:20
667000 -- (-527.421) [-526.912] (-532.520) (-529.710) * (-529.532) (-529.481) [-530.395] (-530.359) -- 0:00:19
667500 -- (-530.190) (-528.769) [-531.087] (-527.228) * [-529.020] (-530.213) (-529.476) (-526.673) -- 0:00:19
668000 -- (-529.351) [-528.444] (-530.064) (-528.676) * (-528.604) (-531.908) (-529.899) [-528.238] -- 0:00:19
668500 -- (-528.823) (-528.416) (-528.666) [-530.031] * (-531.603) (-531.337) [-533.565] (-530.949) -- 0:00:19
669000 -- (-527.262) (-528.599) [-530.560] (-529.243) * (-528.590) (-528.412) (-540.880) [-528.058] -- 0:00:19
669500 -- [-526.884] (-530.050) (-529.988) (-529.366) * (-528.914) (-533.075) (-536.309) [-528.219] -- 0:00:19
670000 -- (-526.808) [-530.607] (-534.575) (-529.380) * (-527.757) (-528.882) [-530.322] (-528.377) -- 0:00:19
Average standard deviation of split frequencies: 0.005375
670500 -- [-528.932] (-530.516) (-530.655) (-532.846) * [-530.020] (-528.524) (-528.357) (-529.648) -- 0:00:19
671000 -- (-528.953) (-531.658) (-529.339) [-527.155] * (-529.993) (-529.778) (-527.342) [-528.073] -- 0:00:19
671500 -- (-531.828) (-530.483) (-529.292) [-527.287] * (-537.351) (-530.102) (-527.898) [-528.108] -- 0:00:19
672000 -- (-531.769) (-529.696) (-529.458) [-527.712] * [-533.471] (-529.633) (-530.737) (-527.750) -- 0:00:19
672500 -- [-530.449] (-531.018) (-536.252) (-528.662) * [-527.409] (-529.279) (-530.238) (-528.672) -- 0:00:19
673000 -- (-528.379) [-527.437] (-532.674) (-530.519) * (-532.310) (-528.497) (-528.943) [-527.377] -- 0:00:19
673500 -- (-528.645) [-531.380] (-528.372) (-530.377) * [-527.011] (-528.963) (-530.470) (-528.563) -- 0:00:19
674000 -- (-527.337) (-535.306) (-534.952) [-530.381] * (-533.318) (-533.108) (-528.009) [-531.280] -- 0:00:19
674500 -- (-530.938) [-530.935] (-532.117) (-529.165) * (-531.239) (-533.597) (-528.209) [-528.447] -- 0:00:19
675000 -- (-529.398) [-527.720] (-532.413) (-529.697) * (-528.195) (-534.034) (-527.847) [-528.586] -- 0:00:19
Average standard deviation of split frequencies: 0.005186
675500 -- (-532.219) [-527.347] (-528.160) (-528.124) * (-531.778) [-532.125] (-530.487) (-527.165) -- 0:00:19
676000 -- [-528.488] (-527.671) (-528.491) (-528.656) * (-531.612) (-527.961) [-527.416] (-528.097) -- 0:00:19
676500 -- (-526.940) (-532.635) [-529.373] (-527.519) * (-532.236) (-528.163) (-527.672) [-528.104] -- 0:00:19
677000 -- (-528.178) [-528.534] (-528.827) (-530.208) * (-527.110) (-531.551) [-527.689] (-527.764) -- 0:00:19
677500 -- (-528.656) (-535.731) (-528.407) [-528.114] * [-527.445] (-530.092) (-528.071) (-528.086) -- 0:00:19
678000 -- (-528.039) (-531.870) [-528.334] (-531.649) * (-532.335) [-528.644] (-527.756) (-528.112) -- 0:00:18
678500 -- (-528.824) (-529.593) [-528.184] (-529.189) * (-530.642) (-528.124) (-527.136) [-528.638] -- 0:00:18
679000 -- (-529.862) (-529.069) (-528.664) [-532.949] * (-527.374) [-529.082] (-527.806) (-530.987) -- 0:00:19
679500 -- (-529.444) [-530.450] (-528.667) (-533.643) * (-528.788) (-529.837) (-527.345) [-527.662] -- 0:00:19
680000 -- [-527.393] (-528.941) (-529.611) (-533.146) * [-528.753] (-535.422) (-530.190) (-530.717) -- 0:00:19
Average standard deviation of split frequencies: 0.005627
680500 -- (-528.799) [-527.393] (-528.680) (-527.499) * [-528.789] (-529.083) (-530.479) (-530.185) -- 0:00:19
681000 -- (-532.260) [-527.600] (-528.924) (-532.237) * (-531.741) [-527.696] (-529.939) (-529.423) -- 0:00:19
681500 -- (-527.667) [-529.015] (-528.371) (-527.764) * (-532.499) [-530.259] (-530.636) (-526.992) -- 0:00:19
682000 -- [-526.775] (-527.875) (-529.151) (-529.859) * (-530.003) [-530.427] (-529.211) (-533.089) -- 0:00:19
682500 -- (-531.613) [-527.630] (-529.637) (-527.634) * (-533.563) (-531.971) [-528.635] (-529.525) -- 0:00:19
683000 -- (-527.909) (-528.536) (-528.836) [-527.956] * (-531.827) [-529.571] (-526.879) (-530.662) -- 0:00:19
683500 -- [-531.220] (-527.977) (-529.752) (-529.849) * (-537.124) (-528.551) (-526.869) [-529.089] -- 0:00:18
684000 -- (-533.896) [-527.531] (-529.809) (-527.721) * (-530.947) [-528.387] (-533.682) (-531.048) -- 0:00:18
684500 -- (-529.746) (-534.706) (-529.023) [-527.864] * (-529.131) [-529.275] (-527.983) (-528.126) -- 0:00:18
685000 -- [-530.473] (-533.444) (-529.168) (-527.619) * (-527.595) (-527.337) (-528.507) [-526.936] -- 0:00:18
Average standard deviation of split frequencies: 0.005841
685500 -- (-529.373) (-529.086) [-530.732] (-529.002) * (-528.031) (-527.491) [-528.884] (-530.036) -- 0:00:18
686000 -- (-528.326) [-527.742] (-526.695) (-528.989) * (-531.497) (-530.304) [-528.390] (-530.945) -- 0:00:18
686500 -- (-527.970) (-529.048) [-527.938] (-528.598) * (-531.456) (-530.686) [-529.213] (-531.931) -- 0:00:18
687000 -- (-529.398) (-528.288) (-530.268) [-530.538] * (-531.915) (-528.435) (-527.132) [-530.429] -- 0:00:18
687500 -- [-528.690] (-528.935) (-532.536) (-528.382) * [-530.141] (-529.722) (-526.966) (-530.128) -- 0:00:18
688000 -- (-529.920) (-529.098) [-530.969] (-534.342) * [-530.765] (-529.106) (-526.877) (-527.898) -- 0:00:18
688500 -- (-531.037) (-530.308) [-528.828] (-529.277) * (-529.742) [-529.718] (-528.631) (-529.620) -- 0:00:18
689000 -- [-529.559] (-529.402) (-527.903) (-527.460) * (-526.745) (-529.301) [-527.110] (-527.998) -- 0:00:18
689500 -- (-529.059) (-529.348) [-528.492] (-527.876) * (-529.773) (-527.918) [-527.134] (-527.341) -- 0:00:18
690000 -- [-527.938] (-529.472) (-528.658) (-529.762) * [-528.122] (-533.250) (-530.596) (-528.084) -- 0:00:18
Average standard deviation of split frequencies: 0.006484
690500 -- (-532.023) (-531.111) (-531.499) [-529.192] * (-531.854) [-528.065] (-528.298) (-527.686) -- 0:00:18
691000 -- (-528.485) (-528.478) [-529.510] (-530.204) * (-531.575) (-531.667) [-530.182] (-527.935) -- 0:00:18
691500 -- (-528.458) [-527.540] (-527.736) (-532.393) * (-528.849) (-528.484) (-529.824) [-527.997] -- 0:00:18
692000 -- [-530.319] (-533.956) (-529.638) (-528.236) * (-527.542) (-529.622) [-529.797] (-527.193) -- 0:00:18
692500 -- (-529.662) (-527.762) [-530.058] (-528.812) * (-527.485) (-529.409) [-528.067] (-527.758) -- 0:00:18
693000 -- (-529.003) [-526.872] (-527.967) (-528.336) * (-526.904) (-531.708) [-530.161] (-528.618) -- 0:00:18
693500 -- (-529.215) [-528.927] (-528.810) (-526.916) * (-528.994) [-534.051] (-530.849) (-530.845) -- 0:00:18
694000 -- [-527.995] (-529.679) (-528.298) (-533.282) * (-527.910) (-528.460) [-529.291] (-527.241) -- 0:00:18
694500 -- (-528.985) [-529.771] (-529.883) (-528.529) * [-527.989] (-530.887) (-529.653) (-528.582) -- 0:00:18
695000 -- (-527.581) [-527.596] (-528.662) (-529.514) * (-529.349) [-528.114] (-528.353) (-528.744) -- 0:00:18
Average standard deviation of split frequencies: 0.006999
695500 -- (-528.991) (-531.935) [-529.215] (-529.471) * [-527.759] (-527.161) (-527.265) (-528.758) -- 0:00:18
696000 -- (-530.368) [-528.500] (-530.159) (-530.111) * (-528.244) (-529.455) (-527.213) [-527.822] -- 0:00:18
696500 -- (-531.969) (-530.399) [-528.177] (-529.413) * [-529.917] (-530.767) (-527.263) (-527.676) -- 0:00:18
697000 -- (-532.924) (-528.297) (-528.226) [-528.864] * (-528.245) [-529.471] (-527.145) (-527.472) -- 0:00:18
697500 -- (-530.474) (-527.857) (-527.420) [-527.122] * (-530.448) (-530.742) [-528.392] (-529.666) -- 0:00:18
698000 -- (-530.552) (-528.116) (-528.949) [-529.507] * (-530.011) (-527.703) (-529.508) [-531.084] -- 0:00:18
698500 -- (-527.668) [-526.957] (-528.081) (-530.817) * (-527.911) (-531.768) [-530.574] (-528.847) -- 0:00:18
699000 -- [-527.954] (-527.684) (-528.619) (-527.233) * [-528.263] (-529.576) (-528.600) (-528.234) -- 0:00:18
699500 -- [-528.315] (-534.722) (-530.463) (-527.824) * (-528.374) (-533.600) [-530.708] (-530.086) -- 0:00:18
700000 -- (-530.026) (-534.396) (-529.753) [-527.523] * (-528.769) (-531.223) [-531.938] (-528.002) -- 0:00:18
Average standard deviation of split frequencies: 0.007042
700500 -- (-527.301) (-531.224) [-529.126] (-526.982) * (-529.421) (-530.190) [-531.875] (-530.228) -- 0:00:17
701000 -- [-529.239] (-529.230) (-528.166) (-527.658) * (-531.218) (-526.805) (-529.209) [-528.166] -- 0:00:17
701500 -- [-533.126] (-530.170) (-528.576) (-528.825) * (-533.343) (-527.049) [-529.836] (-526.908) -- 0:00:17
702000 -- (-529.304) (-531.362) (-528.398) [-529.858] * (-528.239) [-529.721] (-530.538) (-527.397) -- 0:00:17
702500 -- [-528.594] (-539.122) (-530.215) (-529.116) * (-526.989) [-528.208] (-529.636) (-526.867) -- 0:00:17
703000 -- (-527.799) (-534.284) [-530.063] (-528.645) * (-527.826) (-529.209) (-536.601) [-526.777] -- 0:00:17
703500 -- [-526.620] (-528.507) (-530.510) (-527.679) * (-526.889) (-531.506) (-528.857) [-528.116] -- 0:00:17
704000 -- (-527.143) [-527.391] (-532.705) (-528.769) * (-528.494) (-531.231) [-528.255] (-531.773) -- 0:00:17
704500 -- [-527.297] (-527.386) (-529.755) (-527.415) * (-531.384) (-529.715) (-530.699) [-530.110] -- 0:00:17
705000 -- [-527.048] (-528.749) (-532.055) (-527.554) * (-528.269) (-529.634) [-527.254] (-530.084) -- 0:00:17
Average standard deviation of split frequencies: 0.006811
705500 -- [-528.427] (-529.123) (-531.016) (-528.707) * (-527.534) [-527.666] (-529.931) (-527.223) -- 0:00:17
706000 -- (-529.599) [-533.154] (-528.094) (-529.163) * [-529.174] (-530.980) (-528.660) (-528.493) -- 0:00:17
706500 -- (-529.884) (-528.938) (-528.556) [-529.031] * (-530.480) (-529.772) (-527.620) [-527.355] -- 0:00:17
707000 -- (-527.734) (-528.169) [-528.318] (-528.039) * [-530.250] (-528.012) (-531.779) (-527.432) -- 0:00:17
707500 -- (-527.899) (-530.194) (-527.219) [-532.464] * [-528.085] (-527.335) (-530.807) (-528.320) -- 0:00:17
708000 -- (-530.787) (-531.960) (-529.089) [-529.144] * (-527.810) [-528.330] (-529.192) (-529.471) -- 0:00:17
708500 -- (-528.331) (-528.870) [-528.995] (-527.399) * [-527.932] (-526.739) (-531.691) (-528.645) -- 0:00:17
709000 -- [-528.994] (-527.919) (-527.015) (-527.454) * (-529.836) (-527.330) (-528.186) [-527.649] -- 0:00:17
709500 -- (-527.926) [-526.701] (-528.487) (-528.946) * (-529.344) (-528.372) (-527.029) [-528.085] -- 0:00:17
710000 -- [-528.121] (-528.848) (-530.109) (-528.363) * (-527.733) (-527.017) [-530.222] (-528.019) -- 0:00:17
Average standard deviation of split frequencies: 0.006675
710500 -- [-528.151] (-527.064) (-530.454) (-527.443) * (-539.869) (-529.326) (-529.796) [-528.806] -- 0:00:17
711000 -- (-528.421) (-527.094) (-530.026) [-527.489] * (-527.895) [-530.447] (-531.978) (-529.068) -- 0:00:17
711500 -- (-530.636) (-531.160) [-527.763] (-528.250) * (-531.620) [-527.428] (-532.858) (-532.176) -- 0:00:17
712000 -- (-529.252) [-529.632] (-528.330) (-530.077) * [-529.231] (-530.042) (-531.347) (-530.368) -- 0:00:17
712500 -- (-526.621) (-528.308) [-529.361] (-527.532) * [-529.324] (-529.850) (-529.516) (-533.260) -- 0:00:17
713000 -- (-527.618) (-527.574) [-527.522] (-527.628) * (-530.767) [-527.134] (-529.700) (-529.961) -- 0:00:17
713500 -- (-528.673) (-527.350) (-528.889) [-528.573] * [-530.505] (-527.082) (-528.552) (-528.852) -- 0:00:17
714000 -- (-526.840) (-526.762) (-529.041) [-528.570] * (-531.908) [-530.856] (-528.784) (-530.412) -- 0:00:17
714500 -- (-529.920) [-529.262] (-528.726) (-530.034) * (-528.409) (-529.010) (-529.707) [-529.383] -- 0:00:17
715000 -- (-527.430) [-530.080] (-529.372) (-527.461) * (-529.183) [-529.282] (-527.547) (-531.866) -- 0:00:17
Average standard deviation of split frequencies: 0.006321
715500 -- (-527.373) (-530.935) (-527.552) [-527.378] * (-530.421) (-527.476) [-527.802] (-534.975) -- 0:00:17
716000 -- (-530.014) [-529.424] (-526.783) (-528.576) * (-529.811) (-527.107) (-528.587) [-528.306] -- 0:00:17
716500 -- [-526.688] (-530.855) (-528.093) (-534.892) * [-527.265] (-533.321) (-528.225) (-528.160) -- 0:00:17
717000 -- (-527.620) [-529.259] (-528.961) (-532.146) * (-527.242) (-531.772) [-526.752] (-531.597) -- 0:00:16
717500 -- (-527.047) (-532.245) [-529.342] (-528.814) * (-529.771) (-528.207) (-530.114) [-530.546] -- 0:00:16
718000 -- (-527.224) (-532.885) (-530.010) [-527.532] * (-527.921) (-528.398) [-528.511] (-531.061) -- 0:00:16
718500 -- [-530.925] (-528.722) (-530.887) (-532.239) * (-528.205) (-529.227) (-527.412) [-531.594] -- 0:00:16
719000 -- (-528.125) (-530.159) (-530.804) [-530.382] * [-527.669] (-528.031) (-528.931) (-537.071) -- 0:00:16
719500 -- [-527.356] (-529.108) (-533.823) (-529.912) * (-530.210) [-529.554] (-528.243) (-530.078) -- 0:00:16
720000 -- [-530.509] (-529.215) (-531.488) (-527.468) * (-528.026) (-531.677) [-528.235] (-532.691) -- 0:00:16
Average standard deviation of split frequencies: 0.005969
720500 -- (-531.647) (-531.553) (-529.155) [-527.787] * (-528.584) (-533.627) [-532.393] (-529.315) -- 0:00:16
721000 -- (-529.492) (-527.754) [-528.282] (-533.109) * (-530.369) [-528.108] (-530.004) (-528.697) -- 0:00:16
721500 -- [-527.684] (-528.686) (-528.479) (-530.291) * (-532.857) [-527.650] (-527.703) (-533.927) -- 0:00:16
722000 -- [-527.600] (-526.992) (-529.495) (-531.642) * (-526.583) (-529.683) [-528.568] (-531.060) -- 0:00:16
722500 -- (-529.515) [-527.170] (-527.945) (-529.948) * (-529.188) (-527.800) [-527.781] (-527.588) -- 0:00:16
723000 -- (-528.955) (-527.396) (-527.288) [-529.059] * (-528.266) [-528.954] (-529.831) (-529.109) -- 0:00:16
723500 -- [-530.113] (-527.967) (-528.073) (-528.180) * (-527.606) [-529.508] (-532.245) (-529.030) -- 0:00:16
724000 -- [-528.100] (-529.160) (-530.472) (-527.155) * [-526.751] (-530.948) (-533.958) (-527.014) -- 0:00:16
724500 -- (-532.962) (-530.989) (-529.405) [-528.498] * (-528.223) (-529.470) (-533.124) [-527.218] -- 0:00:16
725000 -- (-529.813) (-531.640) [-530.398] (-531.141) * (-528.731) [-528.998] (-529.998) (-528.910) -- 0:00:16
Average standard deviation of split frequencies: 0.005966
725500 -- (-528.478) (-529.761) (-528.697) [-531.813] * (-533.091) (-535.008) [-528.639] (-527.440) -- 0:00:16
726000 -- [-531.273] (-527.890) (-530.367) (-532.880) * [-529.954] (-535.412) (-527.798) (-529.346) -- 0:00:16
726500 -- [-528.325] (-530.178) (-535.668) (-529.549) * (-531.582) (-527.771) (-534.722) [-528.478] -- 0:00:16
727000 -- [-527.403] (-530.687) (-534.468) (-530.795) * [-531.030] (-528.109) (-527.978) (-530.490) -- 0:00:16
727500 -- (-530.446) (-528.559) [-530.705] (-527.745) * [-527.470] (-530.647) (-526.864) (-528.146) -- 0:00:16
728000 -- [-528.813] (-527.861) (-534.291) (-530.733) * (-527.771) [-528.959] (-528.460) (-527.346) -- 0:00:16
728500 -- (-529.184) (-527.368) [-533.304] (-528.684) * (-529.522) [-527.671] (-527.860) (-529.807) -- 0:00:16
729000 -- [-530.171] (-530.102) (-530.271) (-530.120) * [-531.409] (-529.695) (-527.960) (-528.494) -- 0:00:16
729500 -- (-527.726) (-532.619) [-531.840] (-531.269) * (-527.644) (-531.049) [-528.376] (-527.523) -- 0:00:16
730000 -- (-532.596) [-530.326] (-529.432) (-533.626) * (-533.815) (-527.954) [-528.167] (-528.767) -- 0:00:16
Average standard deviation of split frequencies: 0.006169
730500 -- [-529.086] (-529.202) (-529.181) (-534.845) * (-530.264) (-530.842) [-526.843] (-529.448) -- 0:00:16
731000 -- [-530.834] (-529.345) (-527.642) (-527.712) * (-530.078) (-531.624) [-528.120] (-529.998) -- 0:00:16
731500 -- [-529.238] (-527.342) (-529.518) (-528.651) * (-527.613) (-531.917) (-526.966) [-529.396] -- 0:00:16
732000 -- (-528.200) [-527.688] (-528.631) (-529.457) * [-528.112] (-529.369) (-526.777) (-528.112) -- 0:00:16
732500 -- (-528.739) (-528.879) [-528.532] (-527.980) * (-528.112) [-530.320] (-529.035) (-530.703) -- 0:00:16
733000 -- (-530.616) (-527.125) (-527.732) [-527.680] * [-528.662] (-529.916) (-528.407) (-526.948) -- 0:00:16
733500 -- (-530.654) (-526.989) [-528.271] (-528.048) * (-528.338) (-527.701) (-530.745) [-527.083] -- 0:00:15
734000 -- (-527.244) (-530.331) (-531.919) [-528.061] * [-529.554] (-527.411) (-530.992) (-527.069) -- 0:00:15
734500 -- (-529.712) (-530.128) (-527.080) [-532.534] * (-528.081) (-529.717) [-528.809] (-528.397) -- 0:00:15
735000 -- (-529.527) [-528.000] (-528.283) (-529.844) * [-531.432] (-530.975) (-529.245) (-531.493) -- 0:00:15
Average standard deviation of split frequencies: 0.007088
735500 -- [-527.905] (-530.297) (-528.969) (-529.229) * [-528.570] (-531.335) (-529.258) (-529.923) -- 0:00:15
736000 -- [-527.677] (-528.761) (-528.503) (-526.886) * [-527.929] (-535.023) (-531.336) (-530.464) -- 0:00:15
736500 -- (-527.068) [-528.745] (-526.786) (-527.440) * (-527.676) (-532.585) [-535.695] (-529.906) -- 0:00:15
737000 -- [-526.812] (-529.563) (-527.293) (-530.966) * [-528.921] (-528.458) (-532.959) (-529.061) -- 0:00:15
737500 -- (-526.690) [-527.792] (-528.558) (-529.623) * (-530.802) (-528.036) (-527.122) [-529.419] -- 0:00:15
738000 -- (-532.089) [-527.420] (-529.442) (-528.113) * (-530.042) [-527.755] (-531.385) (-531.272) -- 0:00:15
738500 -- (-529.111) [-526.728] (-530.040) (-529.065) * (-532.589) [-528.379] (-527.918) (-529.166) -- 0:00:15
739000 -- (-527.614) (-530.616) [-528.618] (-533.268) * (-528.071) (-532.617) (-530.616) [-529.262] -- 0:00:15
739500 -- (-527.925) (-529.669) (-529.442) [-531.803] * [-527.968] (-530.374) (-531.434) (-529.230) -- 0:00:15
740000 -- (-531.072) (-528.064) [-528.629] (-527.105) * (-529.485) (-529.402) [-529.421] (-529.049) -- 0:00:15
Average standard deviation of split frequencies: 0.006882
740500 -- (-534.001) [-528.342] (-527.464) (-527.594) * (-528.814) (-530.956) (-530.955) [-528.738] -- 0:00:15
741000 -- (-536.311) (-528.122) (-529.174) [-527.979] * (-530.681) [-528.647] (-528.863) (-529.025) -- 0:00:15
741500 -- (-528.356) (-529.410) [-528.422] (-535.948) * (-528.676) [-527.538] (-528.069) (-527.658) -- 0:00:15
742000 -- [-526.868] (-533.482) (-530.558) (-528.463) * (-533.412) (-528.561) [-527.071] (-531.434) -- 0:00:15
742500 -- [-528.538] (-528.432) (-531.568) (-527.312) * (-534.729) [-528.695] (-529.200) (-532.018) -- 0:00:15
743000 -- (-528.395) (-529.226) (-529.462) [-527.752] * (-531.826) [-526.995] (-528.508) (-528.624) -- 0:00:15
743500 -- (-527.190) (-531.141) (-527.713) [-528.084] * (-530.618) [-530.633] (-527.928) (-529.064) -- 0:00:15
744000 -- (-528.655) [-531.612] (-527.872) (-528.974) * (-528.993) [-527.630] (-526.930) (-528.417) -- 0:00:15
744500 -- (-528.304) (-527.687) (-533.301) [-530.346] * (-530.650) (-528.430) [-527.668] (-527.004) -- 0:00:15
745000 -- (-527.367) [-527.774] (-529.309) (-528.253) * (-529.709) (-527.243) (-528.326) [-527.023] -- 0:00:15
Average standard deviation of split frequencies: 0.006872
745500 -- (-529.095) [-527.339] (-528.338) (-527.150) * (-529.234) (-529.937) (-526.648) [-528.924] -- 0:00:15
746000 -- (-533.382) (-529.863) [-526.785] (-528.265) * (-529.413) [-530.225] (-528.738) (-530.385) -- 0:00:15
746500 -- (-528.207) (-531.298) [-528.312] (-529.180) * [-529.196] (-527.191) (-532.514) (-530.082) -- 0:00:15
747000 -- (-527.782) [-529.439] (-530.220) (-529.115) * (-527.319) (-528.029) [-528.330] (-530.017) -- 0:00:15
747500 -- (-529.531) (-529.469) [-529.021] (-530.937) * (-531.807) (-527.336) (-528.694) [-527.758] -- 0:00:15
748000 -- (-528.355) (-530.012) (-529.143) [-529.702] * (-528.922) (-529.351) (-529.637) [-529.134] -- 0:00:15
748500 -- [-528.503] (-529.158) (-527.252) (-529.042) * (-529.122) [-532.493] (-528.018) (-527.066) -- 0:00:15
749000 -- (-529.292) (-528.557) (-531.732) [-526.619] * (-530.061) (-529.184) (-533.023) [-527.534] -- 0:00:15
749500 -- (-527.016) (-530.393) (-530.114) [-530.025] * [-526.996] (-527.011) (-527.499) (-528.661) -- 0:00:15
750000 -- (-527.888) (-531.278) (-527.649) [-530.478] * (-527.176) [-527.693] (-528.505) (-528.422) -- 0:00:15
Average standard deviation of split frequencies: 0.006594
750500 -- [-530.005] (-529.113) (-531.420) (-529.555) * (-529.485) [-528.327] (-528.015) (-527.517) -- 0:00:14
751000 -- [-532.808] (-528.028) (-531.621) (-527.621) * (-529.134) [-530.401] (-533.168) (-529.290) -- 0:00:14
751500 -- (-530.087) (-530.493) (-526.702) [-527.176] * (-529.594) [-529.178] (-530.990) (-528.125) -- 0:00:14
752000 -- (-528.564) [-529.424] (-528.260) (-532.916) * (-531.259) (-527.823) (-527.844) [-528.859] -- 0:00:14
752500 -- [-530.760] (-529.197) (-527.546) (-533.266) * [-531.652] (-529.590) (-528.479) (-528.598) -- 0:00:14
753000 -- (-529.760) (-529.754) [-533.691] (-527.228) * (-532.209) (-531.236) [-531.588] (-527.582) -- 0:00:14
753500 -- (-532.690) (-531.955) [-526.966] (-532.664) * (-526.760) [-527.973] (-529.598) (-531.319) -- 0:00:14
754000 -- (-528.929) [-527.062] (-526.969) (-529.104) * (-527.442) (-527.850) [-527.570] (-529.245) -- 0:00:14
754500 -- (-530.751) (-527.548) [-527.760] (-528.096) * (-527.001) [-533.568] (-526.954) (-529.890) -- 0:00:14
755000 -- (-527.155) (-526.835) [-528.072] (-530.007) * (-532.228) [-531.282] (-529.531) (-529.775) -- 0:00:14
Average standard deviation of split frequencies: 0.006859
755500 -- [-528.759] (-530.181) (-528.652) (-531.769) * (-529.256) (-530.625) [-529.509] (-528.192) -- 0:00:14
756000 -- (-526.940) [-529.392] (-528.927) (-530.926) * [-531.561] (-530.721) (-528.136) (-528.329) -- 0:00:14
756500 -- [-526.951] (-528.431) (-527.916) (-528.300) * (-528.359) [-529.651] (-529.149) (-535.130) -- 0:00:14
757000 -- (-527.446) [-531.169] (-530.635) (-530.542) * (-527.076) [-528.226] (-530.228) (-531.813) -- 0:00:14
757500 -- (-526.998) (-530.010) [-529.178] (-528.603) * (-526.913) (-532.085) (-530.369) [-528.226] -- 0:00:14
758000 -- (-530.289) [-529.956] (-530.287) (-529.305) * [-530.044] (-532.784) (-531.980) (-530.593) -- 0:00:14
758500 -- (-528.564) (-528.033) [-530.510] (-528.963) * (-527.536) [-528.472] (-529.830) (-530.802) -- 0:00:14
759000 -- (-526.897) [-527.252] (-528.798) (-529.681) * [-527.930] (-529.750) (-528.788) (-530.117) -- 0:00:14
759500 -- (-532.086) [-528.479] (-531.554) (-529.614) * (-526.893) (-528.921) [-527.591] (-528.849) -- 0:00:14
760000 -- (-528.955) (-528.871) [-529.010] (-529.939) * [-527.367] (-528.633) (-528.265) (-528.853) -- 0:00:14
Average standard deviation of split frequencies: 0.006856
760500 -- [-529.559] (-528.665) (-529.885) (-527.958) * [-527.457] (-530.821) (-529.930) (-528.182) -- 0:00:14
761000 -- [-530.179] (-528.448) (-529.914) (-531.404) * [-528.216] (-529.272) (-528.567) (-530.057) -- 0:00:14
761500 -- (-530.241) [-526.952] (-528.475) (-528.311) * (-527.877) (-531.750) [-527.560] (-528.697) -- 0:00:14
762000 -- [-527.957] (-530.065) (-531.729) (-530.796) * (-528.990) (-529.186) [-527.225] (-531.160) -- 0:00:14
762500 -- (-527.895) (-527.145) (-529.217) [-531.315] * [-527.978] (-528.432) (-530.625) (-530.234) -- 0:00:14
763000 -- (-528.799) [-530.038] (-531.212) (-530.876) * (-529.335) (-529.450) [-530.868] (-531.122) -- 0:00:14
763500 -- (-527.565) [-527.800] (-528.997) (-530.468) * (-529.028) [-527.427] (-531.444) (-526.948) -- 0:00:14
764000 -- (-527.252) (-527.657) [-527.912] (-532.604) * [-528.795] (-530.208) (-527.933) (-528.390) -- 0:00:14
764500 -- (-531.333) [-530.034] (-530.588) (-531.834) * [-529.112] (-530.963) (-531.097) (-526.875) -- 0:00:14
765000 -- (-530.647) (-530.489) (-532.150) [-530.756] * [-527.038] (-529.308) (-532.894) (-529.912) -- 0:00:14
Average standard deviation of split frequencies: 0.006539
765500 -- (-528.308) (-530.648) [-528.125] (-529.101) * [-528.626] (-527.858) (-529.652) (-528.534) -- 0:00:14
766000 -- (-527.225) [-528.456] (-528.787) (-529.482) * (-531.459) (-528.711) [-528.027] (-530.527) -- 0:00:14
766500 -- [-527.044] (-530.068) (-530.966) (-527.113) * (-530.402) (-528.399) [-528.771] (-529.997) -- 0:00:14
767000 -- [-528.113] (-529.340) (-528.019) (-531.500) * (-538.855) (-528.477) [-528.003] (-527.597) -- 0:00:13
767500 -- (-532.387) (-527.226) [-530.279] (-530.214) * (-528.587) [-530.277] (-527.301) (-530.020) -- 0:00:13
768000 -- (-530.969) (-530.908) (-531.918) [-529.220] * (-529.595) (-527.956) (-528.608) [-527.363] -- 0:00:13
768500 -- [-527.859] (-529.018) (-527.995) (-530.688) * (-527.649) (-532.063) [-529.007] (-529.444) -- 0:00:13
769000 -- (-529.559) (-527.669) [-530.589] (-531.754) * [-529.156] (-530.846) (-529.418) (-530.921) -- 0:00:13
769500 -- (-528.780) [-527.985] (-531.060) (-528.435) * (-527.495) (-529.668) (-529.905) [-527.515] -- 0:00:13
770000 -- (-527.444) (-529.772) [-530.552] (-531.482) * (-531.705) (-529.938) [-529.669] (-530.091) -- 0:00:13
Average standard deviation of split frequencies: 0.007187
770500 -- (-527.606) [-527.562] (-530.269) (-530.914) * (-528.963) (-528.366) [-528.061] (-528.526) -- 0:00:13
771000 -- (-529.564) (-527.819) [-526.733] (-530.059) * (-530.444) (-528.738) [-531.180] (-529.444) -- 0:00:13
771500 -- [-528.313] (-531.491) (-527.307) (-528.651) * (-533.452) [-526.661] (-527.476) (-528.006) -- 0:00:13
772000 -- [-528.490] (-528.430) (-531.005) (-529.881) * (-532.297) [-528.479] (-530.064) (-527.505) -- 0:00:13
772500 -- (-530.141) (-527.081) [-528.471] (-527.708) * [-528.748] (-529.228) (-527.021) (-527.255) -- 0:00:13
773000 -- [-527.367] (-534.043) (-530.743) (-528.396) * (-530.125) (-528.292) [-531.601] (-527.856) -- 0:00:13
773500 -- [-530.503] (-527.321) (-530.665) (-528.473) * (-529.871) (-530.535) [-529.265] (-528.404) -- 0:00:13
774000 -- [-531.205] (-528.240) (-530.012) (-527.488) * (-529.665) [-528.515] (-530.299) (-530.046) -- 0:00:13
774500 -- (-527.924) [-528.529] (-529.348) (-527.425) * [-528.480] (-529.269) (-526.856) (-529.217) -- 0:00:13
775000 -- (-529.539) (-528.725) (-528.023) [-527.417] * (-530.063) (-531.222) [-528.003] (-527.798) -- 0:00:13
Average standard deviation of split frequencies: 0.007290
775500 -- (-529.758) [-528.636] (-527.066) (-527.180) * [-528.363] (-530.113) (-530.979) (-528.034) -- 0:00:13
776000 -- (-529.286) (-527.615) [-529.342] (-527.168) * (-528.640) (-528.342) (-527.833) [-528.224] -- 0:00:13
776500 -- (-528.920) (-528.802) [-528.537] (-526.895) * (-528.016) [-529.361] (-527.781) (-527.728) -- 0:00:13
777000 -- (-530.847) [-528.264] (-527.525) (-529.195) * (-528.180) (-528.750) [-528.075] (-530.788) -- 0:00:13
777500 -- [-529.393] (-529.495) (-528.639) (-531.623) * (-530.363) (-530.157) [-528.852] (-528.833) -- 0:00:13
778000 -- (-530.395) [-530.052] (-533.156) (-529.087) * (-529.162) (-530.176) [-529.252] (-529.860) -- 0:00:13
778500 -- [-528.144] (-530.513) (-531.500) (-527.275) * (-530.682) (-529.968) [-527.076] (-530.842) -- 0:00:13
779000 -- (-532.188) [-528.937] (-529.163) (-527.778) * [-528.240] (-528.633) (-527.344) (-528.797) -- 0:00:13
779500 -- [-529.007] (-527.653) (-528.000) (-527.776) * (-529.515) (-536.356) [-530.113] (-528.817) -- 0:00:13
780000 -- [-531.906] (-529.342) (-529.971) (-527.990) * [-530.222] (-532.529) (-535.064) (-528.452) -- 0:00:13
Average standard deviation of split frequencies: 0.007548
780500 -- [-528.090] (-530.302) (-529.965) (-529.124) * [-527.758] (-529.287) (-527.320) (-527.816) -- 0:00:13
781000 -- (-531.310) (-531.077) (-529.151) [-526.762] * (-528.524) (-527.860) (-527.357) [-528.340] -- 0:00:13
781500 -- (-527.118) (-527.658) (-528.103) [-527.397] * (-527.470) [-527.180] (-527.491) (-529.086) -- 0:00:13
782000 -- [-528.180] (-527.642) (-527.616) (-527.947) * (-527.190) (-527.984) [-526.815] (-530.945) -- 0:00:13
782500 -- (-527.583) [-528.312] (-526.593) (-528.535) * (-528.323) (-527.567) [-527.559] (-527.618) -- 0:00:13
783000 -- (-528.132) (-528.343) (-527.426) [-529.218] * (-528.627) (-528.589) [-527.831] (-527.599) -- 0:00:13
783500 -- (-528.318) (-528.685) (-526.992) [-529.822] * [-528.239] (-528.140) (-526.919) (-527.430) -- 0:00:12
784000 -- (-528.449) (-532.160) [-526.512] (-526.660) * (-531.023) [-526.651] (-527.091) (-527.353) -- 0:00:12
784500 -- (-531.894) (-528.329) [-527.229] (-528.081) * [-528.624] (-529.961) (-527.745) (-531.164) -- 0:00:12
785000 -- (-530.977) (-528.183) (-527.177) [-527.806] * (-529.316) (-528.073) [-527.745] (-527.577) -- 0:00:12
Average standard deviation of split frequencies: 0.007422
785500 -- [-528.542] (-529.570) (-527.867) (-528.972) * (-531.166) (-528.734) (-530.981) [-529.450] -- 0:00:12
786000 -- (-527.777) [-529.537] (-530.078) (-527.317) * [-530.724] (-527.716) (-530.016) (-528.821) -- 0:00:12
786500 -- (-528.860) [-528.168] (-531.931) (-529.698) * (-529.710) [-528.284] (-528.559) (-527.843) -- 0:00:12
787000 -- (-531.620) [-528.442] (-527.886) (-528.129) * (-528.627) (-529.791) (-528.863) [-528.373] -- 0:00:12
787500 -- (-533.844) (-535.828) (-528.033) [-530.279] * (-529.215) (-530.711) [-529.726] (-527.009) -- 0:00:12
788000 -- (-530.237) (-531.084) [-530.253] (-529.817) * [-528.985] (-528.555) (-528.724) (-529.182) -- 0:00:12
788500 -- (-527.449) [-528.267] (-527.802) (-528.395) * [-532.119] (-529.497) (-530.881) (-529.648) -- 0:00:12
789000 -- (-527.222) (-528.314) (-528.143) [-530.840] * (-529.729) (-529.915) (-530.276) [-530.455] -- 0:00:12
789500 -- (-533.196) [-527.986] (-528.151) (-534.001) * (-529.827) (-530.346) (-528.488) [-530.763] -- 0:00:12
790000 -- [-529.612] (-527.548) (-530.015) (-527.737) * (-527.881) [-532.710] (-531.060) (-529.809) -- 0:00:12
Average standard deviation of split frequencies: 0.007825
790500 -- (-530.299) (-529.579) (-528.006) [-527.398] * [-529.615] (-532.140) (-529.733) (-531.256) -- 0:00:12
791000 -- (-528.927) (-527.669) [-531.613] (-528.320) * (-526.824) [-528.519] (-528.621) (-528.052) -- 0:00:12
791500 -- (-527.873) [-527.617] (-529.948) (-531.879) * (-526.902) (-533.484) (-533.167) [-528.986] -- 0:00:12
792000 -- (-532.178) (-529.624) [-529.780] (-528.052) * (-529.873) (-532.164) [-529.158] (-527.332) -- 0:00:12
792500 -- (-530.399) (-531.452) [-527.297] (-528.646) * [-528.030] (-528.704) (-531.808) (-529.017) -- 0:00:12
793000 -- (-528.063) (-528.482) (-533.317) [-528.061] * [-526.851] (-531.580) (-527.930) (-528.290) -- 0:00:12
793500 -- (-529.391) (-529.457) (-528.534) [-529.153] * (-527.208) (-527.729) (-527.422) [-529.666] -- 0:00:12
794000 -- (-530.411) [-527.777] (-532.768) (-532.184) * (-531.535) (-530.169) (-529.004) [-529.173] -- 0:00:12
794500 -- (-530.192) (-528.721) (-530.432) [-532.174] * [-528.427] (-529.795) (-528.785) (-528.727) -- 0:00:12
795000 -- (-528.298) [-530.216] (-533.048) (-529.790) * (-529.335) (-529.048) (-529.533) [-529.186] -- 0:00:12
Average standard deviation of split frequencies: 0.007514
795500 -- (-528.481) [-530.472] (-531.102) (-530.008) * (-527.321) (-533.756) [-530.838] (-527.502) -- 0:00:12
796000 -- [-527.704] (-530.211) (-530.477) (-530.546) * (-527.305) [-529.072] (-530.945) (-529.566) -- 0:00:12
796500 -- (-527.503) (-531.057) (-530.264) [-528.363] * (-528.059) (-528.773) [-530.655] (-527.821) -- 0:00:12
797000 -- (-530.502) (-528.175) [-529.815] (-537.944) * [-527.669] (-527.584) (-529.067) (-528.539) -- 0:00:12
797500 -- (-528.213) (-527.380) (-532.249) [-530.277] * [-528.476] (-528.296) (-533.252) (-530.243) -- 0:00:12
798000 -- (-530.108) (-528.965) [-528.422] (-527.869) * (-528.926) (-529.684) (-526.822) [-528.943] -- 0:00:12
798500 -- [-527.291] (-528.962) (-533.806) (-527.723) * [-528.080] (-528.223) (-527.647) (-528.087) -- 0:00:12
799000 -- (-530.159) (-531.647) [-531.782] (-532.042) * [-527.553] (-531.334) (-528.438) (-527.867) -- 0:00:12
799500 -- (-531.410) [-527.628] (-528.527) (-529.421) * (-531.257) [-526.715] (-531.388) (-527.854) -- 0:00:12
800000 -- (-530.743) [-530.598] (-529.671) (-531.991) * (-529.917) (-528.723) (-530.800) [-527.942] -- 0:00:12
Average standard deviation of split frequencies: 0.007544
800500 -- (-527.563) (-527.520) [-527.651] (-529.337) * (-528.942) (-530.247) [-528.094] (-528.631) -- 0:00:11
801000 -- [-527.565] (-527.774) (-528.391) (-530.081) * (-529.544) (-529.541) (-529.846) [-529.416] -- 0:00:11
801500 -- (-528.824) (-531.014) [-528.064] (-527.215) * (-530.850) (-527.584) (-529.446) [-528.889] -- 0:00:11
802000 -- [-529.811] (-530.692) (-530.951) (-527.966) * (-528.607) (-527.501) [-529.483] (-527.953) -- 0:00:11
802500 -- (-528.565) (-528.247) (-529.267) [-528.010] * (-529.914) [-529.662] (-527.536) (-528.581) -- 0:00:11
803000 -- (-527.507) (-529.520) (-532.728) [-527.955] * [-526.908] (-528.859) (-529.554) (-532.547) -- 0:00:11
803500 -- [-527.917] (-527.641) (-533.677) (-527.440) * (-530.534) (-527.190) [-528.127] (-539.228) -- 0:00:11
804000 -- (-530.300) [-528.322] (-528.178) (-529.704) * (-527.939) [-528.221] (-528.990) (-535.047) -- 0:00:11
804500 -- (-533.861) (-528.199) [-528.574] (-531.129) * (-527.730) (-531.806) [-528.676] (-529.254) -- 0:00:11
805000 -- (-530.020) (-527.164) [-527.091] (-530.426) * (-528.196) (-529.047) (-529.912) [-528.257] -- 0:00:11
Average standard deviation of split frequencies: 0.008115
805500 -- (-527.646) (-527.402) (-527.841) [-527.809] * [-528.731] (-529.496) (-529.476) (-527.464) -- 0:00:11
806000 -- [-527.618] (-526.846) (-529.721) (-530.085) * [-527.371] (-528.496) (-527.718) (-528.144) -- 0:00:11
806500 -- (-527.197) [-531.898] (-528.059) (-530.062) * (-528.683) [-529.037] (-527.830) (-526.594) -- 0:00:11
807000 -- (-529.873) (-527.937) (-530.277) [-530.525] * [-528.866] (-532.737) (-527.962) (-533.051) -- 0:00:11
807500 -- [-531.390] (-528.255) (-531.246) (-531.354) * (-527.720) (-528.836) [-529.243] (-529.871) -- 0:00:11
808000 -- (-531.446) (-528.724) (-527.533) [-530.584] * (-529.930) [-528.328] (-530.266) (-530.098) -- 0:00:11
808500 -- (-528.811) (-528.031) [-527.763] (-529.462) * [-528.673] (-534.289) (-527.923) (-528.993) -- 0:00:11
809000 -- (-527.279) (-527.368) [-528.810] (-527.612) * [-527.585] (-529.712) (-531.475) (-533.043) -- 0:00:11
809500 -- (-531.562) [-527.774] (-530.328) (-527.582) * (-532.307) (-531.387) (-529.607) [-528.029] -- 0:00:11
810000 -- (-533.377) (-532.201) [-530.216] (-528.548) * (-527.186) (-531.171) (-527.357) [-529.482] -- 0:00:11
Average standard deviation of split frequencies: 0.008323
810500 -- (-532.451) (-528.919) [-527.237] (-527.289) * (-526.892) (-534.749) [-527.688] (-532.179) -- 0:00:11
811000 -- (-530.215) (-527.655) (-528.113) [-530.441] * (-527.212) [-531.496] (-527.845) (-531.777) -- 0:00:11
811500 -- (-528.905) [-527.627] (-530.829) (-529.245) * (-528.908) [-526.663] (-526.712) (-528.428) -- 0:00:11
812000 -- [-527.788] (-529.287) (-530.154) (-530.853) * (-532.779) (-527.594) [-528.568] (-532.449) -- 0:00:11
812500 -- (-527.630) (-526.725) (-527.768) [-530.468] * (-527.609) (-530.501) (-527.914) [-529.696] -- 0:00:11
813000 -- [-528.189] (-527.420) (-529.786) (-529.113) * (-528.489) (-527.726) [-528.652] (-529.941) -- 0:00:11
813500 -- (-528.162) (-527.683) (-527.521) [-528.273] * (-529.604) (-527.794) [-529.550] (-531.856) -- 0:00:11
814000 -- [-528.171] (-528.061) (-528.216) (-528.044) * (-528.797) (-528.606) [-532.056] (-530.937) -- 0:00:11
814500 -- [-527.178] (-529.592) (-528.071) (-529.511) * [-527.735] (-530.861) (-527.747) (-529.399) -- 0:00:11
815000 -- (-528.187) [-527.559] (-531.822) (-529.404) * (-528.755) (-531.857) (-527.393) [-528.222] -- 0:00:11
Average standard deviation of split frequencies: 0.008196
815500 -- (-530.239) (-528.379) [-528.789] (-530.697) * [-528.026] (-527.887) (-529.313) (-528.365) -- 0:00:11
816000 -- (-531.092) (-532.298) (-531.837) [-528.387] * (-529.654) [-529.266] (-527.195) (-528.424) -- 0:00:11
816500 -- (-529.185) [-532.357] (-530.130) (-529.996) * (-528.772) (-531.577) (-527.126) [-530.376] -- 0:00:11
817000 -- (-528.459) (-532.794) (-531.947) [-528.411] * (-527.504) (-532.485) [-529.765] (-529.065) -- 0:00:10
817500 -- [-528.966] (-530.732) (-528.155) (-527.601) * [-527.959] (-532.172) (-528.017) (-527.387) -- 0:00:10
818000 -- (-528.667) [-530.897] (-528.581) (-527.156) * (-527.358) [-529.850] (-528.017) (-529.514) -- 0:00:10
818500 -- (-529.839) (-529.597) [-528.700] (-528.949) * (-526.967) (-531.173) [-528.945] (-529.511) -- 0:00:10
819000 -- [-528.507] (-530.252) (-530.492) (-527.983) * [-529.431] (-528.804) (-527.358) (-529.176) -- 0:00:10
819500 -- (-530.475) [-527.325] (-532.351) (-527.516) * (-527.859) (-529.085) [-528.771] (-532.809) -- 0:00:10
820000 -- (-529.223) (-528.620) [-528.273] (-530.234) * (-528.500) [-531.355] (-529.599) (-530.029) -- 0:00:10
Average standard deviation of split frequencies: 0.008652
820500 -- [-528.443] (-528.315) (-529.344) (-531.310) * (-527.113) (-527.777) [-528.962] (-534.761) -- 0:00:10
821000 -- (-529.653) (-529.813) (-528.241) [-531.131] * (-529.465) [-528.241] (-528.319) (-531.979) -- 0:00:10
821500 -- (-528.321) (-526.830) [-527.703] (-534.235) * (-528.559) (-527.287) [-529.822] (-530.676) -- 0:00:10
822000 -- (-531.841) [-527.741] (-527.707) (-531.493) * (-527.348) (-527.995) [-531.055] (-530.043) -- 0:00:10
822500 -- (-530.137) (-528.138) [-529.142] (-532.757) * [-526.653] (-528.643) (-535.896) (-529.955) -- 0:00:10
823000 -- [-528.619] (-528.883) (-528.410) (-528.799) * (-529.627) (-530.087) (-527.029) [-528.988] -- 0:00:10
823500 -- (-528.420) (-527.781) [-529.913] (-527.326) * (-526.581) (-532.835) [-528.935] (-533.067) -- 0:00:10
824000 -- [-527.807] (-528.301) (-528.608) (-527.911) * (-529.744) (-527.303) [-529.405] (-528.140) -- 0:00:10
824500 -- (-528.170) (-532.781) [-531.181] (-528.059) * (-529.992) [-527.865] (-530.851) (-527.946) -- 0:00:10
825000 -- [-527.952] (-528.597) (-527.195) (-532.249) * [-528.897] (-527.369) (-530.782) (-529.358) -- 0:00:10
Average standard deviation of split frequencies: 0.008632
825500 -- (-527.847) [-526.777] (-527.567) (-530.068) * (-529.318) (-528.025) (-530.246) [-527.756] -- 0:00:10
826000 -- [-527.262] (-529.932) (-527.841) (-528.809) * (-528.379) (-532.057) (-527.884) [-528.244] -- 0:00:10
826500 -- (-528.750) (-530.584) (-529.301) [-527.796] * (-527.519) (-534.241) [-532.130] (-532.662) -- 0:00:10
827000 -- (-528.434) [-527.025] (-527.957) (-533.637) * [-527.231] (-529.578) (-530.174) (-526.841) -- 0:00:10
827500 -- (-527.906) [-530.404] (-527.957) (-528.521) * (-532.156) (-528.524) (-530.324) [-526.999] -- 0:00:10
828000 -- (-532.888) [-530.231] (-527.700) (-529.512) * (-531.245) [-530.317] (-531.267) (-528.746) -- 0:00:10
828500 -- (-527.956) (-528.738) [-528.882] (-528.322) * (-531.149) [-528.051] (-529.425) (-530.421) -- 0:00:10
829000 -- (-528.125) [-527.422] (-530.945) (-533.715) * (-533.097) [-527.639] (-528.646) (-528.743) -- 0:00:10
829500 -- (-527.167) [-527.245] (-528.420) (-528.109) * [-528.450] (-528.045) (-528.663) (-529.336) -- 0:00:10
830000 -- (-529.431) [-527.552] (-528.610) (-529.046) * (-531.205) [-529.343] (-529.584) (-529.162) -- 0:00:10
Average standard deviation of split frequencies: 0.009151
830500 -- (-533.977) (-527.778) (-531.923) [-529.741] * (-527.634) [-527.006] (-528.683) (-527.724) -- 0:00:10
831000 -- (-531.058) (-529.752) (-528.547) [-529.865] * (-528.080) (-529.359) (-528.491) [-528.737] -- 0:00:10
831500 -- (-530.124) (-529.918) [-527.508] (-529.070) * (-528.052) (-528.063) [-527.937] (-528.191) -- 0:00:10
832000 -- (-528.612) (-528.304) (-529.898) [-527.529] * (-530.237) (-531.134) [-527.947] (-528.092) -- 0:00:10
832500 -- (-527.780) (-528.577) (-528.262) [-527.548] * (-527.228) (-530.327) (-527.668) [-528.096] -- 0:00:10
833000 -- (-528.471) (-528.517) [-528.948] (-527.153) * [-528.453] (-529.527) (-528.955) (-531.950) -- 0:00:10
833500 -- (-530.447) [-527.573] (-530.309) (-530.563) * [-527.549] (-531.332) (-529.505) (-528.922) -- 0:00:09
834000 -- (-528.630) (-527.356) [-529.524] (-529.414) * (-529.690) (-529.655) (-528.126) [-528.822] -- 0:00:09
834500 -- (-528.319) (-527.590) [-528.252] (-529.616) * (-531.273) (-530.842) (-527.614) [-531.936] -- 0:00:09
835000 -- (-527.052) (-530.055) (-527.770) [-528.323] * (-532.956) (-533.916) [-527.500] (-531.323) -- 0:00:09
Average standard deviation of split frequencies: 0.008634
835500 -- [-530.170] (-531.216) (-528.191) (-527.008) * (-530.575) (-532.455) (-528.024) [-528.255] -- 0:00:09
836000 -- [-529.079] (-530.364) (-528.085) (-528.174) * [-527.441] (-527.960) (-530.447) (-529.748) -- 0:00:09
836500 -- [-531.733] (-529.028) (-529.735) (-527.514) * (-531.236) [-528.759] (-530.054) (-528.227) -- 0:00:09
837000 -- [-530.793] (-528.769) (-529.509) (-526.723) * (-529.016) (-527.827) [-530.364] (-528.425) -- 0:00:09
837500 -- (-528.704) (-528.396) (-527.728) [-529.310] * [-529.779] (-527.431) (-532.420) (-527.861) -- 0:00:09
838000 -- (-528.379) [-529.393] (-530.926) (-529.582) * (-528.850) [-531.128] (-529.129) (-529.486) -- 0:00:09
838500 -- (-528.121) [-527.282] (-528.471) (-529.424) * [-529.401] (-527.912) (-527.214) (-529.620) -- 0:00:09
839000 -- (-529.100) (-532.281) (-527.189) [-528.157] * (-530.124) (-530.092) [-527.416] (-533.142) -- 0:00:09
839500 -- (-528.644) (-528.150) (-526.751) [-528.739] * [-528.368] (-527.166) (-527.715) (-529.198) -- 0:00:09
840000 -- (-527.988) (-529.819) (-527.374) [-528.701] * [-532.100] (-529.086) (-528.973) (-531.633) -- 0:00:09
Average standard deviation of split frequencies: 0.008446
840500 -- (-528.787) [-528.135] (-532.677) (-529.267) * (-528.395) (-534.202) (-530.540) [-528.550] -- 0:00:09
841000 -- [-527.577] (-528.624) (-531.613) (-532.561) * (-530.866) [-531.382] (-528.359) (-527.799) -- 0:00:09
841500 -- (-527.043) (-530.152) [-528.889] (-532.362) * [-527.689] (-527.456) (-528.557) (-527.062) -- 0:00:09
842000 -- (-527.642) (-530.728) [-528.879] (-528.201) * (-532.968) (-529.740) [-527.213] (-534.140) -- 0:00:09
842500 -- (-528.689) (-534.563) (-527.633) [-527.470] * [-527.121] (-529.060) (-527.330) (-530.127) -- 0:00:09
843000 -- (-529.266) (-530.256) [-528.645] (-527.162) * (-527.762) [-529.359] (-530.156) (-528.406) -- 0:00:09
843500 -- (-529.968) (-531.557) (-527.559) [-528.389] * (-529.263) (-531.442) [-530.148] (-528.482) -- 0:00:09
844000 -- [-530.655] (-529.017) (-530.533) (-528.525) * [-528.763] (-528.448) (-528.519) (-527.674) -- 0:00:09
844500 -- (-529.515) [-527.829] (-529.475) (-529.078) * (-529.235) (-526.569) [-529.772] (-528.050) -- 0:00:09
845000 -- [-527.277] (-527.582) (-526.895) (-527.594) * (-534.033) [-528.248] (-529.331) (-527.895) -- 0:00:09
Average standard deviation of split frequencies: 0.008741
845500 -- (-530.254) [-526.937] (-531.183) (-527.994) * (-531.042) (-535.177) [-529.293] (-527.326) -- 0:00:09
846000 -- [-527.764] (-528.383) (-530.033) (-533.124) * (-527.518) (-527.811) (-532.100) [-528.089] -- 0:00:09
846500 -- (-528.179) [-528.249] (-529.311) (-527.409) * (-532.177) (-527.810) [-528.948] (-530.541) -- 0:00:09
847000 -- (-528.556) (-527.844) [-527.927] (-527.325) * (-530.884) (-527.871) [-528.361] (-528.394) -- 0:00:09
847500 -- (-530.512) [-528.478] (-527.368) (-532.918) * (-528.849) (-529.256) (-527.781) [-528.827] -- 0:00:09
848000 -- (-533.992) [-530.161] (-530.511) (-529.422) * (-531.127) (-527.178) (-526.967) [-529.785] -- 0:00:09
848500 -- (-527.675) (-529.779) [-529.694] (-527.402) * (-528.711) (-533.057) (-527.032) [-527.263] -- 0:00:09
849000 -- [-531.940] (-526.594) (-534.135) (-528.224) * (-528.142) [-529.537] (-527.010) (-527.344) -- 0:00:09
849500 -- (-529.006) (-526.547) (-528.533) [-527.754] * (-529.672) [-528.068] (-528.094) (-528.137) -- 0:00:09
850000 -- (-532.234) (-527.535) [-527.258] (-527.347) * (-530.951) (-529.667) (-527.741) [-527.876] -- 0:00:09
Average standard deviation of split frequencies: 0.008936
850500 -- (-527.626) [-527.789] (-527.850) (-529.117) * (-534.801) (-531.781) (-528.208) [-531.820] -- 0:00:08
851000 -- [-527.347] (-528.638) (-527.832) (-528.266) * (-527.669) (-537.076) (-531.537) [-527.832] -- 0:00:08
851500 -- [-530.026] (-528.425) (-528.874) (-527.957) * (-527.655) [-527.993] (-527.823) (-528.085) -- 0:00:08
852000 -- (-526.929) [-527.434] (-527.885) (-528.931) * [-529.558] (-527.410) (-535.504) (-528.171) -- 0:00:08
852500 -- (-529.052) (-527.289) [-528.603] (-528.519) * (-527.134) (-528.555) (-534.428) [-529.775] -- 0:00:08
853000 -- (-527.943) [-527.794] (-530.169) (-528.636) * (-528.530) (-527.986) [-531.249] (-530.784) -- 0:00:08
853500 -- (-528.309) [-527.239] (-531.900) (-527.748) * (-530.998) (-528.510) (-528.866) [-532.068] -- 0:00:08
854000 -- (-532.050) [-533.509] (-530.156) (-529.577) * (-527.644) [-528.061] (-531.039) (-531.355) -- 0:00:08
854500 -- (-528.702) [-527.138] (-530.600) (-527.210) * [-528.699] (-529.011) (-530.550) (-528.607) -- 0:00:08
855000 -- (-527.888) (-529.217) [-531.210] (-527.178) * (-528.412) (-528.828) [-526.925] (-528.820) -- 0:00:08
Average standard deviation of split frequencies: 0.009259
855500 -- (-528.845) (-528.902) (-529.028) [-530.843] * (-530.286) (-531.844) [-526.682] (-531.241) -- 0:00:08
856000 -- (-527.131) (-527.811) (-530.228) [-527.765] * (-528.468) [-527.281] (-527.065) (-528.100) -- 0:00:08
856500 -- [-529.144] (-531.478) (-527.845) (-530.849) * (-529.659) (-531.828) (-528.673) [-527.523] -- 0:00:08
857000 -- (-528.380) (-529.132) [-529.100] (-528.953) * (-529.696) (-528.595) [-530.422] (-528.435) -- 0:00:08
857500 -- [-526.678] (-532.974) (-531.832) (-527.733) * (-531.332) (-531.504) (-528.457) [-527.087] -- 0:00:08
858000 -- [-527.141] (-531.315) (-528.461) (-530.019) * (-528.745) [-527.528] (-530.136) (-527.243) -- 0:00:08
858500 -- (-527.642) (-530.549) (-528.329) [-528.079] * (-528.254) (-529.140) (-530.822) [-530.130] -- 0:00:08
859000 -- (-527.577) (-526.986) [-528.253] (-529.697) * (-528.143) (-537.270) (-529.281) [-531.855] -- 0:00:08
859500 -- (-528.718) (-530.081) (-531.889) [-529.046] * [-528.735] (-528.787) (-527.791) (-530.756) -- 0:00:08
860000 -- (-527.994) (-529.943) [-530.331] (-528.356) * [-528.954] (-531.267) (-528.786) (-529.178) -- 0:00:08
Average standard deviation of split frequencies: 0.009380
860500 -- (-527.560) [-527.937] (-531.028) (-527.197) * (-527.283) (-529.168) (-533.507) [-530.214] -- 0:00:08
861000 -- (-526.784) (-529.778) [-528.255] (-528.392) * (-528.022) (-526.942) (-533.773) [-530.370] -- 0:00:08
861500 -- [-527.212] (-533.255) (-527.572) (-529.597) * (-528.904) [-526.715] (-527.477) (-528.610) -- 0:00:08
862000 -- (-528.902) (-530.776) (-527.303) [-529.464] * (-530.358) (-534.292) (-528.584) [-530.008] -- 0:00:08
862500 -- (-528.756) (-528.612) [-529.917] (-528.261) * [-528.589] (-530.534) (-532.011) (-528.199) -- 0:00:08
863000 -- [-530.729] (-527.445) (-533.346) (-529.266) * (-530.155) (-531.448) [-529.491] (-529.586) -- 0:00:08
863500 -- (-528.823) (-529.848) (-533.766) [-527.966] * (-528.043) (-528.445) (-527.441) [-531.448] -- 0:00:08
864000 -- (-529.124) [-527.487] (-530.388) (-538.742) * [-528.061] (-529.331) (-529.306) (-531.232) -- 0:00:08
864500 -- (-528.530) (-527.585) (-528.836) [-527.307] * (-532.230) [-530.468] (-526.953) (-526.833) -- 0:00:08
865000 -- (-530.720) [-526.839] (-530.306) (-527.770) * (-529.307) (-526.838) [-528.335] (-527.101) -- 0:00:08
Average standard deviation of split frequencies: 0.008914
865500 -- (-528.088) [-528.296] (-529.353) (-528.388) * [-530.438] (-529.407) (-528.063) (-530.964) -- 0:00:08
866000 -- (-530.685) (-530.583) (-531.148) [-527.271] * (-533.155) (-527.618) [-526.966] (-528.049) -- 0:00:08
866500 -- [-527.971] (-527.966) (-532.201) (-527.429) * (-528.315) (-527.483) (-531.589) [-526.918] -- 0:00:08
867000 -- [-530.565] (-528.571) (-530.402) (-529.000) * (-529.852) [-526.736] (-531.412) (-531.511) -- 0:00:07
867500 -- (-535.490) [-527.882] (-529.013) (-528.697) * (-531.137) [-526.682] (-528.978) (-529.030) -- 0:00:07
868000 -- (-531.051) [-529.466] (-530.745) (-528.763) * [-532.534] (-526.684) (-530.063) (-527.935) -- 0:00:07
868500 -- (-532.280) (-528.167) [-531.963] (-527.738) * (-531.168) (-527.919) (-529.341) [-526.991] -- 0:00:07
869000 -- (-532.096) (-528.518) [-527.870] (-528.248) * [-526.905] (-529.938) (-530.725) (-530.089) -- 0:00:07
869500 -- (-529.216) [-528.646] (-529.279) (-528.912) * (-527.466) [-531.041] (-529.701) (-530.985) -- 0:00:07
870000 -- [-531.919] (-526.852) (-529.340) (-527.913) * [-528.975] (-530.793) (-533.468) (-530.013) -- 0:00:07
Average standard deviation of split frequencies: 0.008528
870500 -- [-532.513] (-526.658) (-530.218) (-528.167) * (-528.665) (-528.437) (-528.025) [-530.914] -- 0:00:07
871000 -- [-533.374] (-529.609) (-529.569) (-527.623) * (-532.976) [-527.665] (-535.362) (-529.259) -- 0:00:07
871500 -- [-533.830] (-527.655) (-532.511) (-527.730) * [-531.053] (-528.720) (-528.319) (-531.347) -- 0:00:07
872000 -- (-529.663) [-529.604] (-531.636) (-527.659) * (-527.715) (-527.298) [-526.446] (-526.838) -- 0:00:07
872500 -- (-528.378) [-527.079] (-528.463) (-528.216) * (-526.761) (-527.680) (-528.231) [-529.055] -- 0:00:07
873000 -- (-529.973) (-526.899) (-529.304) [-527.839] * (-529.446) (-531.576) [-529.014] (-531.826) -- 0:00:07
873500 -- (-528.800) [-528.012] (-527.729) (-528.565) * (-531.890) (-527.671) (-528.255) [-527.499] -- 0:00:07
874000 -- (-530.554) (-532.042) (-530.088) [-528.790] * [-528.955] (-532.251) (-526.983) (-529.154) -- 0:00:07
874500 -- (-528.252) [-529.508] (-528.863) (-529.570) * (-530.117) (-534.513) [-527.751] (-531.455) -- 0:00:07
875000 -- (-530.534) (-530.582) [-527.257] (-531.961) * [-527.757] (-530.502) (-527.117) (-532.119) -- 0:00:07
Average standard deviation of split frequencies: 0.008711
875500 -- (-531.225) (-527.428) [-527.605] (-529.435) * (-527.965) [-527.844] (-528.170) (-532.858) -- 0:00:07
876000 -- (-527.609) (-528.449) [-529.700] (-527.187) * [-529.085] (-529.817) (-529.368) (-528.498) -- 0:00:07
876500 -- [-527.823] (-531.925) (-530.249) (-527.807) * (-527.848) (-527.963) [-530.205] (-527.584) -- 0:00:07
877000 -- (-527.347) [-529.376] (-529.338) (-528.414) * (-531.041) (-527.525) [-528.286] (-528.101) -- 0:00:07
877500 -- (-527.939) (-530.222) (-530.613) [-531.129] * [-530.004] (-526.844) (-528.728) (-528.486) -- 0:00:07
878000 -- [-527.539] (-529.143) (-528.263) (-531.456) * (-527.277) (-526.939) (-531.179) [-528.939] -- 0:00:07
878500 -- (-526.727) (-529.394) (-527.259) [-528.765] * (-526.916) (-527.581) [-527.052] (-526.838) -- 0:00:07
879000 -- (-528.000) [-527.108] (-527.266) (-531.464) * (-528.655) (-527.783) (-530.585) [-528.167] -- 0:00:07
879500 -- [-527.760] (-527.864) (-527.422) (-526.868) * [-527.693] (-528.493) (-530.228) (-527.775) -- 0:00:07
880000 -- (-528.722) (-528.913) [-528.899] (-530.790) * (-529.129) (-527.836) [-527.815] (-528.063) -- 0:00:07
Average standard deviation of split frequencies: 0.008933
880500 -- (-527.101) (-527.621) (-527.299) [-528.140] * (-528.620) (-529.943) (-527.585) [-527.810] -- 0:00:07
881000 -- (-528.376) (-528.961) [-528.830] (-532.741) * (-529.004) (-529.906) [-527.411] (-526.462) -- 0:00:07
881500 -- (-527.872) (-529.774) (-528.949) [-529.211] * (-527.956) (-532.457) (-527.757) [-527.055] -- 0:00:07
882000 -- [-527.064] (-530.849) (-528.701) (-529.846) * (-527.486) (-531.093) [-528.435] (-534.902) -- 0:00:07
882500 -- (-527.653) [-527.469] (-529.352) (-527.756) * (-529.605) [-528.051] (-529.828) (-533.218) -- 0:00:07
883000 -- (-527.678) [-527.924] (-528.017) (-528.611) * [-528.204] (-528.749) (-530.924) (-532.118) -- 0:00:07
883500 -- (-528.810) (-528.362) (-529.433) [-530.258] * (-529.066) [-529.247] (-533.130) (-531.031) -- 0:00:06
884000 -- (-527.310) (-527.639) [-528.316] (-532.023) * (-528.552) (-532.930) (-527.725) [-528.382] -- 0:00:06
884500 -- (-532.151) (-530.223) (-529.689) [-532.912] * [-529.844] (-529.335) (-530.274) (-527.285) -- 0:00:06
885000 -- [-528.131] (-527.226) (-531.301) (-528.681) * (-530.613) [-528.788] (-533.382) (-527.900) -- 0:00:06
Average standard deviation of split frequencies: 0.009411
885500 -- (-528.466) (-530.246) (-535.940) [-528.648] * [-529.476] (-530.283) (-528.940) (-528.940) -- 0:00:06
886000 -- (-532.315) [-530.094] (-528.019) (-528.982) * (-528.029) (-529.651) (-528.189) [-529.872] -- 0:00:06
886500 -- [-528.726] (-528.651) (-527.871) (-526.685) * (-530.132) (-530.603) [-529.158] (-529.734) -- 0:00:06
887000 -- [-528.184] (-529.818) (-527.871) (-528.038) * (-529.351) (-529.113) [-530.816] (-531.083) -- 0:00:06
887500 -- [-528.231] (-528.369) (-527.946) (-527.285) * (-532.585) [-531.011] (-528.799) (-528.485) -- 0:00:06
888000 -- (-531.370) (-527.880) (-528.142) [-527.819] * (-530.264) (-532.964) (-527.656) [-528.565] -- 0:00:06
888500 -- (-529.486) (-529.702) (-527.247) [-530.907] * [-528.780] (-529.308) (-532.818) (-529.783) -- 0:00:06
889000 -- (-527.371) [-528.623] (-530.510) (-528.713) * (-531.612) (-530.764) (-528.317) [-527.235] -- 0:00:06
889500 -- (-528.929) (-528.311) [-529.849] (-527.800) * (-530.646) [-530.745] (-528.782) (-527.507) -- 0:00:06
890000 -- (-528.650) (-528.295) (-531.485) [-528.770] * (-528.193) (-530.102) (-527.856) [-528.672] -- 0:00:06
Average standard deviation of split frequencies: 0.009395
890500 -- (-529.554) [-527.966] (-531.943) (-529.543) * (-528.007) [-528.543] (-528.024) (-528.970) -- 0:00:06
891000 -- [-528.493] (-526.923) (-529.474) (-531.021) * (-528.246) (-528.138) (-529.539) [-526.951] -- 0:00:06
891500 -- (-533.621) (-529.036) (-528.595) [-527.877] * (-535.032) (-526.961) (-529.797) [-531.025] -- 0:00:06
892000 -- (-530.149) [-531.374] (-534.278) (-529.431) * (-533.691) (-527.823) [-526.679] (-531.127) -- 0:00:06
892500 -- (-527.933) [-527.922] (-532.167) (-529.683) * (-528.947) (-529.101) [-528.920] (-529.568) -- 0:00:06
893000 -- [-527.784] (-528.588) (-527.632) (-529.709) * (-529.396) (-531.066) [-528.853] (-527.357) -- 0:00:06
893500 -- (-530.252) (-530.096) [-527.586] (-528.052) * (-529.371) [-532.549] (-531.978) (-528.622) -- 0:00:06
894000 -- (-529.239) (-532.293) [-528.694] (-527.275) * [-530.479] (-531.686) (-531.378) (-530.469) -- 0:00:06
894500 -- [-528.491] (-529.112) (-527.619) (-530.239) * [-527.530] (-528.184) (-529.025) (-529.044) -- 0:00:06
895000 -- [-533.247] (-529.265) (-527.068) (-528.258) * (-527.799) [-528.004] (-528.993) (-529.371) -- 0:00:06
Average standard deviation of split frequencies: 0.009437
895500 -- (-533.461) (-528.359) [-528.372] (-527.324) * (-527.884) [-528.029] (-529.149) (-529.971) -- 0:00:06
896000 -- (-528.872) (-529.547) (-533.513) [-527.541] * (-528.176) [-528.414] (-528.460) (-527.396) -- 0:00:06
896500 -- [-527.228] (-528.985) (-529.133) (-527.907) * [-529.508] (-529.365) (-526.907) (-529.926) -- 0:00:06
897000 -- [-527.202] (-527.172) (-529.565) (-529.243) * [-528.192] (-527.378) (-527.865) (-527.588) -- 0:00:06
897500 -- (-528.202) (-531.299) (-529.871) [-531.131] * (-526.794) (-528.319) (-528.578) [-527.615] -- 0:00:06
898000 -- (-528.626) (-530.620) [-534.491] (-527.837) * [-531.259] (-529.444) (-532.088) (-529.139) -- 0:00:06
898500 -- (-528.858) (-532.013) [-527.913] (-527.894) * (-532.253) (-526.829) [-529.870] (-527.983) -- 0:00:06
899000 -- (-532.543) (-528.108) [-528.143] (-528.062) * [-527.938] (-529.344) (-528.881) (-527.784) -- 0:00:06
899500 -- [-527.834] (-528.062) (-528.318) (-527.724) * (-528.377) (-528.898) (-529.524) [-527.306] -- 0:00:06
900000 -- [-529.188] (-528.876) (-532.058) (-528.138) * (-531.299) (-529.605) (-530.537) [-527.009] -- 0:00:06
Average standard deviation of split frequencies: 0.009127
900500 -- (-529.375) [-528.041] (-531.998) (-526.654) * (-534.269) (-527.849) (-530.094) [-527.546] -- 0:00:05
901000 -- (-527.213) (-530.476) (-533.957) [-528.282] * (-528.348) (-530.463) [-528.053] (-528.971) -- 0:00:05
901500 -- (-527.577) (-528.841) [-531.166] (-532.688) * (-530.120) (-528.115) [-527.353] (-531.825) -- 0:00:05
902000 -- (-529.670) [-528.239] (-527.319) (-527.167) * (-530.849) (-528.574) (-527.914) [-530.770] -- 0:00:05
902500 -- [-530.456] (-530.479) (-529.289) (-527.661) * (-530.997) (-528.475) [-528.855] (-529.510) -- 0:00:05
903000 -- [-529.065] (-530.234) (-530.556) (-528.309) * (-529.525) [-530.442] (-529.361) (-528.120) -- 0:00:05
903500 -- (-527.505) (-527.744) (-529.677) [-527.700] * (-528.389) (-533.738) (-534.934) [-527.226] -- 0:00:05
904000 -- (-528.001) (-531.952) (-527.395) [-527.463] * (-529.593) (-529.565) (-534.579) [-527.385] -- 0:00:05
904500 -- (-528.368) (-532.093) [-527.079] (-527.765) * (-531.569) (-528.310) [-531.233] (-527.455) -- 0:00:05
905000 -- [-528.904] (-527.250) (-531.857) (-527.318) * (-529.988) [-530.127] (-528.186) (-529.699) -- 0:00:05
Average standard deviation of split frequencies: 0.008975
905500 -- (-528.741) [-529.345] (-529.245) (-527.841) * (-528.505) (-531.442) (-528.393) [-527.112] -- 0:00:05
906000 -- (-527.153) [-527.750] (-529.650) (-528.658) * (-527.929) (-532.803) (-526.844) [-530.324] -- 0:00:05
906500 -- (-529.784) (-528.174) [-530.698] (-528.917) * (-531.103) (-530.931) (-528.865) [-529.531] -- 0:00:05
907000 -- (-530.566) (-527.923) (-533.844) [-528.079] * [-529.488] (-527.677) (-526.610) (-529.707) -- 0:00:05
907500 -- (-532.881) (-527.326) (-530.735) [-528.560] * [-527.239] (-529.007) (-527.863) (-529.214) -- 0:00:05
908000 -- [-528.257] (-529.133) (-531.954) (-528.213) * [-526.966] (-530.191) (-528.796) (-527.042) -- 0:00:05
908500 -- (-526.834) (-528.158) [-531.800] (-529.940) * (-527.600) (-527.561) [-528.173] (-529.828) -- 0:00:05
909000 -- (-531.672) (-527.816) (-527.676) [-533.270] * (-527.247) [-528.417] (-531.017) (-531.120) -- 0:00:05
909500 -- (-527.043) (-528.652) (-527.669) [-528.352] * (-526.954) (-526.637) [-533.264] (-531.605) -- 0:00:05
910000 -- (-527.279) [-527.442] (-528.550) (-527.484) * (-527.976) (-529.074) [-528.995] (-528.803) -- 0:00:05
Average standard deviation of split frequencies: 0.009026
910500 -- (-527.116) (-528.535) (-529.224) [-531.201] * (-529.221) (-530.212) (-532.982) [-529.546] -- 0:00:05
911000 -- [-527.280] (-529.494) (-527.470) (-528.821) * (-529.950) [-529.425] (-529.775) (-529.069) -- 0:00:05
911500 -- (-529.272) (-531.013) (-527.350) [-527.746] * (-530.482) [-528.505] (-529.699) (-528.143) -- 0:00:05
912000 -- (-529.088) (-529.768) (-526.914) [-529.786] * (-528.607) (-528.942) [-527.930] (-529.608) -- 0:00:05
912500 -- [-531.482] (-533.367) (-528.558) (-527.698) * (-526.798) (-528.178) [-527.967] (-528.027) -- 0:00:05
913000 -- (-529.111) (-528.625) [-527.444] (-530.066) * (-532.323) (-528.376) (-530.207) [-529.773] -- 0:00:05
913500 -- (-533.458) [-528.604] (-527.452) (-531.746) * (-530.744) (-531.588) [-526.872] (-530.495) -- 0:00:05
914000 -- [-531.611] (-528.871) (-527.618) (-527.383) * (-531.564) (-526.764) [-527.890] (-527.996) -- 0:00:05
914500 -- (-531.239) (-529.092) (-529.091) [-530.113] * (-530.282) (-528.512) (-532.527) [-534.494] -- 0:00:05
915000 -- (-530.747) (-527.860) (-532.018) [-529.895] * (-530.607) [-529.768] (-530.184) (-530.758) -- 0:00:05
Average standard deviation of split frequencies: 0.009038
915500 -- (-528.623) (-530.128) (-528.184) [-530.723] * [-530.557] (-529.820) (-529.470) (-529.034) -- 0:00:05
916000 -- [-529.659] (-528.001) (-531.336) (-527.676) * (-532.244) (-528.204) [-529.188] (-527.803) -- 0:00:05
916500 -- (-527.709) (-528.937) [-527.787] (-527.935) * [-530.084] (-530.187) (-527.703) (-530.310) -- 0:00:05
917000 -- (-528.638) (-527.669) [-529.856] (-531.340) * (-530.426) [-530.946] (-530.240) (-531.689) -- 0:00:04
917500 -- (-527.320) (-530.068) (-527.113) [-528.460] * (-527.555) (-527.478) [-527.352] (-527.343) -- 0:00:04
918000 -- (-527.905) (-527.319) (-528.689) [-528.611] * (-527.721) (-529.810) (-527.269) [-529.179] -- 0:00:04
918500 -- (-527.975) (-527.952) [-529.039] (-530.236) * (-530.566) (-531.297) (-528.933) [-527.606] -- 0:00:04
919000 -- (-527.105) [-529.108] (-529.420) (-535.750) * (-529.339) (-528.545) [-529.570] (-527.256) -- 0:00:04
919500 -- (-527.965) (-527.729) [-528.067] (-531.845) * (-530.586) [-529.123] (-531.660) (-528.017) -- 0:00:04
920000 -- (-529.346) (-528.388) [-527.256] (-531.249) * (-530.881) (-529.726) [-528.402] (-529.523) -- 0:00:04
Average standard deviation of split frequencies: 0.009408
920500 -- (-529.452) [-529.632] (-526.555) (-527.934) * (-528.052) [-529.572] (-528.470) (-527.021) -- 0:00:04
921000 -- (-530.471) [-527.687] (-527.128) (-527.818) * [-528.012] (-528.890) (-528.751) (-528.624) -- 0:00:04
921500 -- (-529.707) [-527.723] (-527.643) (-527.941) * (-528.220) (-528.666) (-531.048) [-527.914] -- 0:00:04
922000 -- (-530.544) [-527.342] (-530.592) (-529.742) * [-527.649] (-528.639) (-529.327) (-532.362) -- 0:00:04
922500 -- [-529.116] (-528.895) (-527.563) (-530.609) * (-527.397) (-530.641) (-528.930) [-528.432] -- 0:00:04
923000 -- (-532.508) (-529.056) (-528.750) [-527.243] * (-528.787) (-532.654) [-528.768] (-529.774) -- 0:00:04
923500 -- [-529.798] (-527.440) (-528.626) (-530.658) * (-527.815) (-529.689) [-532.233] (-527.124) -- 0:00:04
924000 -- [-528.955] (-526.771) (-528.010) (-530.454) * (-527.763) [-528.328] (-529.765) (-529.036) -- 0:00:04
924500 -- (-528.741) (-527.691) (-528.031) [-528.960] * (-527.260) (-528.785) (-530.832) [-528.841] -- 0:00:04
925000 -- (-529.398) (-529.177) [-529.735] (-530.662) * [-527.868] (-532.064) (-531.792) (-530.566) -- 0:00:04
Average standard deviation of split frequencies: 0.009354
925500 -- [-527.175] (-528.013) (-529.853) (-531.540) * [-528.616] (-530.508) (-529.649) (-530.244) -- 0:00:04
926000 -- (-529.489) (-533.274) (-531.322) [-528.910] * (-529.098) (-529.647) (-528.659) [-530.189] -- 0:00:04
926500 -- (-528.711) (-533.391) [-527.977] (-534.715) * (-527.199) (-527.627) (-528.189) [-532.082] -- 0:00:04
927000 -- (-528.748) (-528.977) (-527.335) [-529.288] * (-531.964) (-530.660) (-527.680) [-529.725] -- 0:00:04
927500 -- (-529.082) [-528.084] (-529.425) (-529.801) * (-530.099) [-528.359] (-530.052) (-527.328) -- 0:00:04
928000 -- [-529.638] (-530.376) (-528.957) (-529.605) * [-530.264] (-528.942) (-527.859) (-527.570) -- 0:00:04
928500 -- [-528.133] (-529.304) (-530.652) (-530.384) * (-528.288) (-528.121) (-530.400) [-528.609] -- 0:00:04
929000 -- (-527.972) (-531.561) (-528.220) [-528.386] * (-527.497) (-527.870) (-529.261) [-531.739] -- 0:00:04
929500 -- [-527.936] (-531.124) (-528.237) (-527.120) * (-527.169) [-527.376] (-527.169) (-528.954) -- 0:00:04
930000 -- (-530.972) (-532.088) (-532.742) [-528.826] * (-531.772) (-531.403) [-527.491] (-528.792) -- 0:00:04
Average standard deviation of split frequencies: 0.009339
930500 -- (-529.753) (-532.076) (-532.937) [-529.035] * (-533.053) (-530.460) [-529.684] (-528.248) -- 0:00:04
931000 -- (-531.400) (-528.218) (-535.567) [-531.481] * (-527.953) (-531.042) (-527.732) [-531.028] -- 0:00:04
931500 -- (-530.442) [-528.358] (-528.248) (-527.273) * [-526.598] (-530.889) (-527.406) (-530.626) -- 0:00:04
932000 -- (-529.888) (-530.012) [-529.190] (-533.129) * (-528.434) (-529.179) [-527.423] (-528.447) -- 0:00:04
932500 -- (-529.692) [-533.545] (-530.186) (-526.767) * (-532.035) [-527.243] (-529.322) (-530.747) -- 0:00:04
933000 -- [-527.889] (-529.876) (-528.405) (-526.701) * [-529.549] (-530.229) (-527.512) (-532.811) -- 0:00:04
933500 -- (-530.460) (-527.857) [-528.872] (-526.727) * (-527.936) [-527.823] (-528.998) (-530.774) -- 0:00:03
934000 -- (-529.867) [-527.533] (-533.415) (-527.075) * (-527.596) (-530.779) (-527.507) [-530.043] -- 0:00:03
934500 -- (-527.225) [-529.276] (-529.287) (-528.769) * (-528.508) (-527.919) (-527.330) [-531.104] -- 0:00:03
935000 -- (-531.019) [-526.446] (-532.985) (-529.199) * [-526.773] (-528.101) (-527.066) (-527.390) -- 0:00:03
Average standard deviation of split frequencies: 0.009412
935500 -- (-528.978) [-526.686] (-528.353) (-527.513) * (-527.184) (-527.609) [-529.126] (-526.913) -- 0:00:03
936000 -- (-529.320) (-526.922) (-528.000) [-526.741] * [-527.274] (-528.035) (-531.434) (-531.274) -- 0:00:03
936500 -- (-527.690) (-526.635) [-528.391] (-529.145) * (-529.160) [-530.590] (-534.402) (-530.356) -- 0:00:03
937000 -- (-530.054) [-530.923] (-528.739) (-527.092) * [-527.812] (-528.917) (-529.181) (-531.796) -- 0:00:03
937500 -- (-530.844) (-532.135) (-532.237) [-527.161] * (-527.368) (-527.815) [-528.002] (-528.756) -- 0:00:03
938000 -- (-531.174) [-527.952] (-530.125) (-528.103) * (-528.860) (-527.783) (-534.554) [-529.635] -- 0:00:03
938500 -- [-529.474] (-528.768) (-531.756) (-529.632) * (-528.572) [-527.224] (-529.098) (-528.648) -- 0:00:03
939000 -- (-529.528) (-528.195) [-528.667] (-527.938) * (-529.014) (-527.131) (-529.198) [-528.442] -- 0:00:03
939500 -- (-529.638) [-528.775] (-531.742) (-528.332) * [-528.427] (-527.254) (-531.775) (-529.857) -- 0:00:03
940000 -- (-529.557) (-529.394) (-528.751) [-528.185] * (-528.931) (-529.017) (-531.174) [-527.252] -- 0:00:03
Average standard deviation of split frequencies: 0.009616
940500 -- (-528.591) (-531.197) [-529.564] (-527.427) * [-530.245] (-528.575) (-532.080) (-527.369) -- 0:00:03
941000 -- (-527.077) (-531.967) [-530.132] (-529.528) * (-528.792) [-528.022] (-528.263) (-529.823) -- 0:00:03
941500 -- [-528.528] (-535.225) (-531.201) (-531.521) * (-527.432) [-531.032] (-528.999) (-528.739) -- 0:00:03
942000 -- (-529.230) [-529.659] (-526.895) (-527.567) * (-527.588) (-529.145) (-531.379) [-527.803] -- 0:00:03
942500 -- [-528.831] (-528.252) (-526.895) (-529.712) * (-527.466) [-529.106] (-533.594) (-526.987) -- 0:00:03
943000 -- (-527.499) [-527.643] (-529.991) (-529.586) * (-528.065) (-534.610) (-529.615) [-532.276] -- 0:00:03
943500 -- (-527.725) (-529.739) [-528.447] (-529.537) * [-527.641] (-529.880) (-528.014) (-533.543) -- 0:00:03
944000 -- (-528.944) (-530.384) [-528.484] (-527.683) * (-527.624) (-526.965) [-529.250] (-527.476) -- 0:00:03
944500 -- (-527.235) (-527.840) [-529.840] (-526.698) * (-528.093) (-528.937) (-527.984) [-529.647] -- 0:00:03
945000 -- (-533.943) (-528.373) [-529.499] (-528.846) * (-529.672) (-527.419) [-529.577] (-528.588) -- 0:00:03
Average standard deviation of split frequencies: 0.009655
945500 -- (-531.316) (-528.393) (-530.723) [-529.206] * [-528.789] (-527.395) (-528.642) (-527.556) -- 0:00:03
946000 -- (-528.419) (-528.804) [-528.627] (-530.500) * (-527.564) [-527.627] (-530.060) (-527.066) -- 0:00:03
946500 -- (-528.864) (-529.136) [-528.864] (-529.513) * (-527.206) (-528.908) (-528.864) [-531.007] -- 0:00:03
947000 -- (-526.936) [-527.992] (-529.756) (-528.668) * (-527.638) (-527.338) (-530.442) [-531.986] -- 0:00:03
947500 -- (-526.530) [-529.336] (-528.794) (-527.556) * (-528.506) [-526.717] (-527.242) (-530.293) -- 0:00:03
948000 -- (-526.915) [-531.137] (-527.852) (-530.602) * (-530.550) (-528.317) (-527.098) [-526.922] -- 0:00:03
948500 -- (-528.289) (-527.405) [-530.599] (-529.072) * [-527.289] (-527.551) (-527.767) (-527.597) -- 0:00:03
949000 -- (-528.633) (-530.485) (-530.021) [-532.243] * [-528.836] (-526.951) (-527.426) (-529.147) -- 0:00:03
949500 -- (-528.584) (-527.753) (-531.457) [-529.224] * (-532.728) (-527.129) [-527.430] (-528.933) -- 0:00:03
950000 -- (-528.224) (-529.300) (-529.310) [-527.579] * (-532.696) (-527.108) (-526.809) [-528.578] -- 0:00:03
Average standard deviation of split frequencies: 0.009700
950500 -- [-526.893] (-530.131) (-527.930) (-527.816) * (-529.983) (-527.311) (-530.654) [-529.634] -- 0:00:02
951000 -- (-527.089) [-529.010] (-528.030) (-529.397) * (-529.370) (-527.254) [-530.310] (-529.858) -- 0:00:02
951500 -- [-527.105] (-530.724) (-529.965) (-530.581) * (-527.012) [-530.161] (-530.636) (-526.507) -- 0:00:02
952000 -- (-529.495) (-528.527) [-531.763] (-529.290) * (-527.923) (-528.482) (-527.390) [-527.933] -- 0:00:02
952500 -- [-529.393] (-534.197) (-529.539) (-529.316) * (-527.448) [-527.774] (-527.774) (-527.924) -- 0:00:02
953000 -- (-528.207) (-534.957) [-528.766] (-529.763) * (-527.446) [-527.680] (-529.173) (-527.150) -- 0:00:02
953500 -- [-528.302] (-527.780) (-528.442) (-530.060) * [-526.915] (-528.483) (-528.598) (-530.448) -- 0:00:02
954000 -- (-528.437) [-527.808] (-527.576) (-528.549) * (-531.215) [-528.717] (-530.357) (-530.523) -- 0:00:02
954500 -- (-531.665) (-529.558) [-528.396] (-528.360) * [-530.823] (-528.907) (-531.216) (-530.168) -- 0:00:02
955000 -- (-531.138) (-530.654) (-527.230) [-527.241] * (-529.841) (-535.398) [-530.211] (-530.388) -- 0:00:02
Average standard deviation of split frequencies: 0.010016
955500 -- (-528.227) (-528.262) (-528.199) [-528.550] * (-529.973) (-535.959) [-529.330] (-528.551) -- 0:00:02
956000 -- (-527.102) (-529.522) (-528.685) [-531.573] * (-529.640) (-531.734) [-531.059] (-527.719) -- 0:00:02
956500 -- [-527.089] (-528.328) (-529.712) (-528.441) * (-528.961) (-533.843) (-529.790) [-527.718] -- 0:00:02
957000 -- (-532.714) (-531.797) [-528.829] (-529.786) * [-531.301] (-532.094) (-527.677) (-526.824) -- 0:00:02
957500 -- [-527.340] (-529.378) (-528.834) (-528.911) * [-527.835] (-528.326) (-527.977) (-527.236) -- 0:00:02
958000 -- (-528.999) [-529.038] (-531.141) (-528.278) * [-528.311] (-528.523) (-535.354) (-526.855) -- 0:00:02
958500 -- (-526.927) (-529.044) [-533.021] (-531.147) * [-527.707] (-530.149) (-528.774) (-528.608) -- 0:00:02
959000 -- [-527.957] (-528.101) (-530.677) (-530.047) * [-526.612] (-528.053) (-532.816) (-529.192) -- 0:00:02
959500 -- (-529.084) (-532.326) (-528.186) [-531.439] * (-527.865) (-529.753) [-527.445] (-530.901) -- 0:00:02
960000 -- (-527.411) (-531.876) (-526.839) [-527.188] * [-528.642] (-529.415) (-526.996) (-529.546) -- 0:00:02
Average standard deviation of split frequencies: 0.009814
960500 -- (-526.975) [-528.487] (-526.880) (-529.747) * [-528.505] (-528.139) (-527.903) (-527.115) -- 0:00:02
961000 -- (-531.497) [-528.419] (-528.350) (-530.771) * (-527.959) (-536.404) [-527.903] (-531.191) -- 0:00:02
961500 -- (-531.536) (-526.856) [-528.635] (-528.461) * (-532.383) (-530.914) [-528.319] (-528.650) -- 0:00:02
962000 -- (-528.392) (-529.027) [-533.867] (-527.299) * [-527.617] (-529.383) (-528.150) (-527.754) -- 0:00:02
962500 -- (-530.849) [-529.084] (-529.464) (-527.635) * (-530.958) (-526.845) (-526.983) [-527.331] -- 0:00:02
963000 -- (-528.693) (-530.317) [-528.192] (-527.903) * (-533.286) [-528.723] (-527.112) (-529.384) -- 0:00:02
963500 -- (-527.214) (-529.075) (-529.256) [-529.282] * [-530.127] (-532.942) (-530.136) (-528.399) -- 0:00:02
964000 -- (-528.243) (-529.426) [-527.720] (-532.362) * (-530.047) (-530.538) [-528.961] (-529.337) -- 0:00:02
964500 -- (-529.679) (-528.181) (-528.902) [-531.416] * [-527.282] (-533.101) (-530.421) (-531.991) -- 0:00:02
965000 -- (-527.015) [-528.448] (-529.254) (-528.491) * (-529.079) (-529.979) (-527.870) [-527.571] -- 0:00:02
Average standard deviation of split frequencies: 0.009760
965500 -- [-528.159] (-526.743) (-528.172) (-530.015) * [-531.185] (-529.173) (-528.433) (-528.558) -- 0:00:02
966000 -- (-529.540) [-528.496] (-528.997) (-528.969) * (-528.282) (-529.720) [-529.544] (-530.049) -- 0:00:02
966500 -- (-530.427) (-531.140) (-537.732) [-527.368] * (-529.635) [-529.644] (-533.778) (-527.323) -- 0:00:02
967000 -- (-529.134) (-530.289) [-528.310] (-528.186) * [-529.488] (-531.069) (-530.399) (-530.861) -- 0:00:01
967500 -- [-529.990] (-530.448) (-528.605) (-529.173) * (-533.540) (-531.258) (-529.353) [-526.884] -- 0:00:01
968000 -- (-528.374) (-529.754) (-529.205) [-530.735] * (-528.179) (-531.969) (-527.099) [-526.884] -- 0:00:01
968500 -- (-531.286) (-527.787) (-530.285) [-526.771] * [-530.102] (-530.994) (-526.687) (-528.553) -- 0:00:01
969000 -- [-528.071] (-529.664) (-530.683) (-533.812) * [-526.846] (-531.035) (-527.047) (-531.838) -- 0:00:01
969500 -- (-526.994) (-528.462) [-528.892] (-532.565) * (-529.129) [-529.361] (-527.059) (-529.974) -- 0:00:01
970000 -- (-527.296) (-527.848) (-528.436) [-528.932] * [-527.111] (-529.993) (-530.555) (-530.571) -- 0:00:01
Average standard deviation of split frequencies: 0.010077
970500 -- (-527.344) (-531.265) (-529.688) [-529.359] * (-528.661) [-528.200] (-527.869) (-530.535) -- 0:00:01
971000 -- (-531.110) [-527.372] (-537.222) (-530.471) * (-531.976) [-527.912] (-528.381) (-529.660) -- 0:00:01
971500 -- [-527.802] (-530.159) (-531.445) (-530.661) * (-530.309) [-529.274] (-528.740) (-528.333) -- 0:00:01
972000 -- [-528.104] (-526.743) (-529.300) (-530.086) * (-530.875) [-528.386] (-527.587) (-530.791) -- 0:00:01
972500 -- (-529.490) (-532.455) (-529.112) [-530.297] * (-529.155) [-530.598] (-532.130) (-529.882) -- 0:00:01
973000 -- (-531.681) [-528.595] (-528.514) (-532.996) * (-531.651) (-532.141) (-529.699) [-534.076] -- 0:00:01
973500 -- (-527.876) (-527.966) (-529.065) [-528.757] * (-528.676) (-532.281) (-528.089) [-527.716] -- 0:00:01
974000 -- (-528.318) [-528.839] (-528.391) (-530.075) * (-532.406) [-527.885] (-527.750) (-528.567) -- 0:00:01
974500 -- (-528.630) [-529.879] (-532.609) (-529.996) * [-528.677] (-529.090) (-526.799) (-528.376) -- 0:00:01
975000 -- (-528.338) [-529.051] (-528.465) (-530.571) * (-529.076) (-531.340) [-528.238] (-530.426) -- 0:00:01
Average standard deviation of split frequencies: 0.010203
975500 -- (-531.948) (-529.803) [-528.290] (-531.956) * (-531.269) [-527.983] (-529.053) (-528.398) -- 0:00:01
976000 -- (-526.869) [-528.688] (-527.035) (-527.616) * (-530.050) [-527.497] (-530.410) (-529.297) -- 0:00:01
976500 -- (-530.739) (-530.344) [-527.144] (-530.089) * (-530.004) [-528.124] (-527.226) (-526.931) -- 0:00:01
977000 -- [-527.208] (-531.042) (-531.896) (-528.498) * [-526.894] (-531.687) (-528.285) (-527.481) -- 0:00:01
977500 -- [-527.409] (-529.471) (-528.411) (-530.355) * (-527.519) (-529.744) [-529.237] (-529.264) -- 0:00:01
978000 -- (-531.436) (-528.523) [-532.292] (-528.581) * (-529.457) (-526.979) [-528.964] (-527.489) -- 0:00:01
978500 -- (-535.720) [-529.001] (-531.141) (-529.078) * (-531.184) (-526.764) (-527.557) [-526.983] -- 0:00:01
979000 -- (-532.468) (-527.012) (-531.050) [-528.211] * (-527.218) [-529.211] (-528.659) (-527.231) -- 0:00:01
979500 -- (-531.217) (-527.312) (-528.305) [-527.628] * (-527.233) (-528.277) (-528.608) [-527.161] -- 0:00:01
980000 -- (-529.190) (-529.552) (-528.312) [-530.082] * (-527.048) [-528.511] (-528.605) (-529.982) -- 0:00:01
Average standard deviation of split frequencies: 0.010365
980500 -- (-528.279) [-532.171] (-530.195) (-528.232) * (-527.172) (-528.439) [-528.830] (-529.382) -- 0:00:01
981000 -- (-529.689) (-532.613) (-529.984) [-527.323] * (-527.302) (-530.000) (-526.915) [-529.668] -- 0:00:01
981500 -- (-529.254) [-531.385] (-529.361) (-526.927) * (-527.766) [-526.774] (-529.502) (-532.165) -- 0:00:01
982000 -- (-526.559) (-529.565) [-527.702] (-529.916) * (-529.948) (-530.963) (-529.995) [-530.869] -- 0:00:01
982500 -- (-528.790) (-530.665) [-528.898] (-530.697) * (-528.576) [-531.479] (-528.502) (-528.595) -- 0:00:01
983000 -- (-528.637) (-526.988) [-527.099] (-534.401) * [-527.248] (-532.723) (-529.393) (-527.484) -- 0:00:01
983500 -- [-528.364] (-527.349) (-527.574) (-529.236) * [-526.603] (-527.386) (-530.057) (-530.254) -- 0:00:00
984000 -- [-527.764] (-527.891) (-527.438) (-531.207) * (-529.046) (-530.197) (-528.463) [-530.381] -- 0:00:00
984500 -- (-528.857) (-528.451) [-528.305] (-527.660) * [-528.818] (-531.276) (-530.336) (-530.320) -- 0:00:00
985000 -- [-527.271] (-527.525) (-528.865) (-527.957) * [-527.484] (-529.150) (-531.036) (-530.806) -- 0:00:00
Average standard deviation of split frequencies: 0.009980
985500 -- (-527.965) (-530.120) (-527.357) [-528.455] * (-528.527) [-529.208] (-532.073) (-531.011) -- 0:00:00
986000 -- [-528.067] (-528.009) (-529.552) (-528.572) * (-528.709) (-529.379) (-527.366) [-530.185] -- 0:00:00
986500 -- (-529.361) [-530.130] (-528.338) (-529.825) * (-529.421) (-528.845) [-527.745] (-528.747) -- 0:00:00
987000 -- [-528.640] (-529.338) (-529.932) (-527.318) * (-529.983) [-528.568] (-529.142) (-532.566) -- 0:00:00
987500 -- (-531.374) [-527.456] (-528.104) (-531.242) * [-530.244] (-528.666) (-529.432) (-528.496) -- 0:00:00
988000 -- [-530.669] (-528.017) (-527.971) (-532.636) * (-527.626) (-528.112) [-529.670] (-530.703) -- 0:00:00
988500 -- (-529.766) [-528.099] (-526.842) (-529.802) * (-527.240) [-529.559] (-528.763) (-530.695) -- 0:00:00
989000 -- [-532.126] (-527.124) (-529.276) (-527.580) * (-528.120) [-527.834] (-530.146) (-528.949) -- 0:00:00
989500 -- (-529.471) [-530.302] (-530.316) (-527.961) * [-534.490] (-527.968) (-528.634) (-527.198) -- 0:00:00
990000 -- (-530.092) (-532.461) (-530.567) [-527.988] * (-530.833) (-529.177) (-526.877) [-530.347] -- 0:00:00
Average standard deviation of split frequencies: 0.009636
990500 -- (-530.184) (-530.561) [-529.564] (-528.159) * (-529.505) (-531.999) [-526.655] (-532.059) -- 0:00:00
991000 -- (-527.924) [-527.455] (-528.009) (-527.835) * [-528.183] (-528.777) (-526.605) (-533.834) -- 0:00:00
991500 -- (-527.221) (-529.316) (-531.327) [-527.929] * (-530.099) [-530.815] (-530.621) (-529.658) -- 0:00:00
992000 -- (-528.505) (-528.230) (-531.979) [-526.865] * (-530.364) [-530.409] (-532.371) (-529.863) -- 0:00:00
992500 -- (-527.352) (-527.119) [-531.283] (-527.581) * [-530.184] (-531.113) (-532.610) (-530.336) -- 0:00:00
993000 -- (-527.352) [-526.637] (-527.301) (-528.085) * (-527.379) (-528.089) (-529.848) [-527.665] -- 0:00:00
993500 -- (-526.875) (-528.179) (-528.807) [-527.693] * (-532.138) (-529.722) [-529.965] (-530.339) -- 0:00:00
994000 -- [-526.949] (-528.405) (-526.717) (-526.856) * [-529.430] (-533.564) (-526.541) (-528.382) -- 0:00:00
994500 -- (-528.351) (-529.610) [-529.232] (-529.027) * (-530.064) (-527.954) (-528.150) [-531.423] -- 0:00:00
995000 -- (-529.586) (-529.874) [-528.469] (-528.409) * [-528.296] (-531.087) (-526.681) (-527.758) -- 0:00:00
Average standard deviation of split frequencies: 0.009643
995500 -- (-530.397) (-530.382) [-527.079] (-527.838) * (-528.140) [-527.696] (-529.481) (-530.536) -- 0:00:00
996000 -- (-529.040) [-527.063] (-527.422) (-527.019) * (-530.470) (-528.325) [-527.343] (-529.188) -- 0:00:00
996500 -- (-528.625) [-527.699] (-530.746) (-526.894) * (-529.316) [-527.168] (-527.652) (-530.296) -- 0:00:00
997000 -- (-526.857) (-527.930) [-532.418] (-530.999) * (-529.440) (-529.273) [-527.140] (-529.971) -- 0:00:00
997500 -- (-526.916) (-528.469) [-528.696] (-531.325) * (-526.856) (-532.290) [-527.927] (-527.847) -- 0:00:00
998000 -- (-529.589) (-530.211) [-532.151] (-529.426) * (-530.460) [-526.935] (-527.674) (-531.088) -- 0:00:00
998500 -- [-527.031] (-530.935) (-528.757) (-530.456) * (-530.190) (-529.797) [-530.793] (-530.122) -- 0:00:00
999000 -- (-528.720) (-529.621) [-528.762] (-527.464) * (-530.131) (-531.637) [-527.610] (-530.851) -- 0:00:00
999500 -- (-527.427) [-528.603] (-529.045) (-527.441) * (-530.377) (-527.456) [-528.271] (-531.755) -- 0:00:00
1000000 -- (-528.738) (-528.464) (-528.949) [-527.424] * (-529.365) (-529.097) (-531.629) [-528.435] -- 0:00:00
Average standard deviation of split frequencies: 0.009863
Analysis completed in 60 seconds
Analysis used 58.66 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -526.42
Likelihood of best state for "cold" chain of run 2 was -526.43
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.7 % ( 30 %) Dirichlet(Pi{all})
35.7 % ( 27 %) Slider(Pi{all})
79.0 % ( 48 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
24.1 % ( 27 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 95 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.6 % ( 31 %) Dirichlet(Pi{all})
35.1 % ( 24 %) Slider(Pi{all})
78.4 % ( 54 %) Multiplier(Alpha{1,2})
78.1 % ( 55 %) Multiplier(Alpha{3})
25.6 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.5 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166383 0.82 0.67
3 | 166394 166830 0.84
4 | 167284 166669 166440
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166275 0.82 0.66
3 | 167237 166818 0.84
4 | 166823 166721 166126
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -528.26
| 1 2 2 |
| 2 1 1 2 |
|2 21 121 2 1 2 1 2 1 2 *11 2 1 |
| 2 2 2 * *2 11 2 2 1 21 1 2* 1|
| 22 12 1 12 1 1 1 1 2 * 1 1 22 2 |
| 1 1 2 12 2 2 22 1112 1 2|
| 1 2 1 2 1 * 1 2 * 1 2 2 1 |
|1 1 1 2 2 2 2 1 2 2 2 1 |
| 1 1 2 1 |
| 1 2 1 |
| 2 1 2 1 |
| 1 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -530.28
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.17 -530.97
2 -528.16 -535.17
--------------------------------------
TOTAL -528.16 -534.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891379 0.090049 0.335766 1.468647 0.855588 1501.00 1501.00 1.000
r(A<->C){all} 0.171798 0.021513 0.000123 0.474220 0.132412 203.75 215.39 1.000
r(A<->G){all} 0.162405 0.018600 0.000152 0.436624 0.126169 294.57 296.02 1.002
r(A<->T){all} 0.163950 0.018947 0.000062 0.440607 0.127735 206.49 243.98 1.000
r(C<->G){all} 0.163935 0.020031 0.000012 0.451965 0.124518 175.89 233.12 1.000
r(C<->T){all} 0.172531 0.020725 0.000036 0.459989 0.136821 59.27 196.52 1.000
r(G<->T){all} 0.165382 0.020739 0.000215 0.458477 0.127024 202.26 231.06 1.001
pi(A){all} 0.237040 0.000467 0.195635 0.279782 0.236671 1062.00 1177.18 1.000
pi(C){all} 0.288840 0.000540 0.244169 0.334342 0.288013 1175.04 1221.83 1.000
pi(G){all} 0.288633 0.000521 0.248184 0.336029 0.287691 1268.38 1384.69 1.000
pi(T){all} 0.185487 0.000389 0.150375 0.226425 0.185219 1199.17 1350.08 1.001
alpha{1,2} 0.429706 0.246545 0.000127 1.444819 0.243643 1289.27 1314.49 1.000
alpha{3} 0.464504 0.248288 0.000170 1.444966 0.292586 1173.64 1283.64 1.000
pinvar{all} 0.995799 0.000026 0.986436 0.999994 0.997452 1436.14 1458.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ...*.*
9 -- .*.***
10 -- .*..*.
11 -- ..*..*
12 -- ..*.*.
13 -- ..****
14 -- .**.**
15 -- .**...
16 -- .****.
17 -- ....**
18 -- .***.*
19 -- ...**.
20 -- ..**..
21 -- .*...*
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 468 0.155896 0.008480 0.149900 0.161892 2
8 459 0.152898 0.009893 0.145903 0.159893 2
9 452 0.150566 0.018844 0.137242 0.163891 2
10 449 0.149567 0.006124 0.145237 0.153897 2
11 435 0.144903 0.022141 0.129247 0.160560 2
12 435 0.144903 0.010835 0.137242 0.152565 2
13 435 0.144903 0.000471 0.144570 0.145237 2
14 432 0.143904 0.013191 0.134577 0.153231 2
15 431 0.143571 0.017430 0.131246 0.155896 2
16 425 0.141572 0.004240 0.138574 0.144570 2
17 423 0.140906 0.002355 0.139241 0.142572 2
18 403 0.134244 0.007066 0.129247 0.139241 2
19 402 0.133911 0.013191 0.124584 0.143238 2
20 401 0.133578 0.001413 0.132578 0.134577 2
21 376 0.125250 0.012248 0.116589 0.133911 2
22 289 0.096269 0.009893 0.089274 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097861 0.009610 0.000040 0.293327 0.068451 1.000 2
length{all}[2] 0.098840 0.009939 0.000006 0.296554 0.067746 1.000 2
length{all}[3] 0.097136 0.009378 0.000088 0.296074 0.067420 1.000 2
length{all}[4] 0.099452 0.011221 0.000022 0.307214 0.065421 1.000 2
length{all}[5] 0.101588 0.010861 0.000024 0.302128 0.069946 1.000 2
length{all}[6] 0.102402 0.009861 0.000015 0.304117 0.071283 1.000 2
length{all}[7] 0.092087 0.008701 0.000004 0.277000 0.063894 1.002 2
length{all}[8] 0.101189 0.008266 0.000035 0.287361 0.077871 0.998 2
length{all}[9] 0.095767 0.008611 0.000112 0.278918 0.067549 0.998 2
length{all}[10] 0.108257 0.011665 0.000811 0.333417 0.079094 1.000 2
length{all}[11] 0.098717 0.008782 0.000248 0.297707 0.071692 0.998 2
length{all}[12] 0.096981 0.010195 0.000032 0.288881 0.065110 0.998 2
length{all}[13] 0.092649 0.008636 0.000001 0.278017 0.060753 1.003 2
length{all}[14] 0.100233 0.009942 0.000071 0.284157 0.068381 1.003 2
length{all}[15] 0.094931 0.009104 0.000027 0.274496 0.066551 0.998 2
length{all}[16] 0.098083 0.008768 0.000305 0.293058 0.071219 1.001 2
length{all}[17] 0.095336 0.008660 0.000283 0.282445 0.065304 0.998 2
length{all}[18] 0.095313 0.008138 0.000144 0.272437 0.066384 0.998 2
length{all}[19] 0.098009 0.008825 0.000277 0.299545 0.066311 0.998 2
length{all}[20] 0.096974 0.008793 0.000012 0.289418 0.066871 1.004 2
length{all}[21] 0.103430 0.013602 0.000080 0.340873 0.066735 0.998 2
length{all}[22] 0.102238 0.011728 0.000492 0.321016 0.061545 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009863
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 384
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 128 / 128 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 128 / 128 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080001 0.106630 0.023919 0.055076 0.081150 0.055521 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -559.986611
Iterating by ming2
Initial: fx= 559.986611
x= 0.08000 0.10663 0.02392 0.05508 0.08115 0.05552 0.30000 1.30000
1 h-m-p 0.0000 0.0002 305.5063 +++ 542.187291 m 0.0002 14 | 1/8
2 h-m-p 0.0015 0.0149 35.2078 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 279.6233 +++ 522.642481 m 0.0002 46 | 2/8
4 h-m-p 0.0024 0.0292 26.1792 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 251.2317 ++ 522.417616 m 0.0000 78 | 3/8
6 h-m-p 0.0001 0.0573 20.1040 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 217.2699 +++ 513.111430 m 0.0002 109 | 4/8
8 h-m-p 0.0023 0.0976 15.1885 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 178.0125 ++ 512.818780 m 0.0000 141 | 5/8
10 h-m-p 0.0007 0.3414 10.0275 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 125.6193 +++ 509.565171 m 0.0002 173 | 6/8
12 h-m-p 0.8387 8.0000 0.0000 ++ 509.565171 m 8.0000 184 | 6/8
13 h-m-p 0.2292 8.0000 0.0002 +++ 509.565171 m 8.0000 198 | 6/8
14 h-m-p 0.0020 0.4668 0.6481 ------C 509.565171 0 0.0000 217 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 509.565171 m 8.0000 257 | 6/8
17 h-m-p 0.0160 8.0000 0.4702 +++++ 509.565149 m 8.0000 273 | 6/8
18 h-m-p 1.6000 8.0000 0.5537 ++ 509.565143 m 8.0000 286 | 6/8
19 h-m-p 1.2021 8.0000 3.6849 ++ 509.565131 m 8.0000 299 | 6/8
20 h-m-p 1.6000 8.0000 7.3563 ++ 509.565127 m 8.0000 310 | 6/8
21 h-m-p 1.6000 8.0000 17.0832 ++ 509.565124 m 8.0000 321 | 6/8
22 h-m-p 1.6000 8.0000 4.6616 ++ 509.565124 m 8.0000 332 | 6/8
23 h-m-p 0.8872 6.4659 42.0347 ----------C 509.565124 0 0.0000 353 | 6/8
24 h-m-p 1.6000 8.0000 0.0000 C 509.565124 0 0.4000 364 | 6/8
25 h-m-p 0.2434 8.0000 0.0000 --C 509.565124 0 0.0038 379
Out..
lnL = -509.565124
380 lfun, 380 eigenQcodon, 2280 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031331 0.086753 0.066595 0.076434 0.054316 0.046806 35.095662 0.621493 0.348331
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.677933
np = 9
lnL0 = -553.950133
Iterating by ming2
Initial: fx= 553.950133
x= 0.03133 0.08675 0.06660 0.07643 0.05432 0.04681 35.09566 0.62149 0.34833
1 h-m-p 0.0000 0.0003 289.9238 +++ 531.580165 m 0.0003 15 | 1/9
2 h-m-p 0.0002 0.0012 101.2360 ++ 521.391073 m 0.0012 27 | 2/9
3 h-m-p 0.0000 0.0001 1593.6218 ++ 517.091886 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0001 1393.0884 ++ 513.113636 m 0.0001 51 | 4/9
5 h-m-p 0.0014 0.0070 5.3472 -----------.. | 4/9
6 h-m-p 0.0000 0.0000 217.3262 ++ 512.535309 m 0.0000 84 | 5/9
7 h-m-p 0.0012 0.3595 1.7558 -----------.. | 5/9
8 h-m-p 0.0000 0.0001 177.5868 ++ 510.597089 m 0.0001 117 | 6/9
9 h-m-p 0.0026 0.2020 2.9565 ------------.. | 6/9
10 h-m-p 0.0000 0.0001 126.8532 ++ 509.565215 m 0.0001 151 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 509.565215 m 8.0000 163 | 6/9
12 h-m-p 0.0160 8.0000 0.1528 +++++ 509.565191 m 8.0000 180 | 6/9
13 h-m-p 0.2198 1.0991 1.3098 ++ 509.565175 m 1.0991 195 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 N 509.565175 0 1.6000 207 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 ------N 509.565175 0 0.0000 227
Out..
lnL = -509.565175
228 lfun, 684 eigenQcodon, 2736 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102519 0.029418 0.076959 0.030678 0.087834 0.043266 32.499657 0.975359 0.530159 0.198103 310.356599
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.011558
np = 11
lnL0 = -529.722297
Iterating by ming2
Initial: fx= 529.722297
x= 0.10252 0.02942 0.07696 0.03068 0.08783 0.04327 32.49966 0.97536 0.53016 0.19810 310.35660
1 h-m-p 0.0000 0.0013 53.4157 ++++ 524.574619 m 0.0013 18 | 1/11
2 h-m-p 0.0050 0.0629 12.3333 ++ 516.114919 m 0.0629 32 | 2/11
3 h-m-p 0.0000 0.0000 6345.7753 ++ 515.572838 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 6936.7114 ++ 515.373493 m 0.0000 60 | 4/11
5 h-m-p 0.0003 0.0018 451.5009 ++ 513.138515 m 0.0018 74 | 5/11
6 h-m-p 0.0002 0.0011 1719.6655 ++ 512.122199 m 0.0011 88 | 6/11
7 h-m-p 0.4058 2.0291 1.5212 ++ 509.565126 m 2.0291 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 509.565126 m 8.0000 116 | 7/11
9 h-m-p 0.1142 8.0000 0.0086 ++++ 509.565126 m 8.0000 136 | 7/11
10 h-m-p 0.0366 8.0000 1.8851 ++++ 509.565124 m 8.0000 156 | 7/11
11 h-m-p 1.6000 8.0000 0.1649 -----Y 509.565124 0 0.0004 175 | 7/11
12 h-m-p 1.6000 8.0000 0.0000 -C 509.565124 0 0.1000 194
Out..
lnL = -509.565124
195 lfun, 780 eigenQcodon, 3510 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -509.562170 S = -509.562146 -0.000009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:02
did 20 / 49 patterns 0:02
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.013272 0.101739 0.106839 0.075606 0.085303 0.039938 32.547567 0.312714 1.077458
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.211782
np = 9
lnL0 = -560.138264
Iterating by ming2
Initial: fx= 560.138264
x= 0.01327 0.10174 0.10684 0.07561 0.08530 0.03994 32.54757 0.31271 1.07746
1 h-m-p 0.0000 0.0001 274.8928 ++ 551.425063 m 0.0001 14 | 1/9
2 h-m-p 0.0015 0.0572 19.2079 +++ 549.501251 m 0.0572 27 | 1/9
3 h-m-p 0.0180 0.0901 1.2936 -YCYCC 549.481284 4 0.0005 46 | 1/9
4 h-m-p 0.0002 0.0037 3.6124 ----------.. | 1/9
5 h-m-p 0.0000 0.0005 273.6818 +++ 511.196238 m 0.0005 79 | 2/9
6 h-m-p 0.0000 0.0000 368463.4399 ++ 510.785655 m 0.0000 91 | 3/9
7 h-m-p 0.0003 0.0979 4.5053 ----------.. | 3/9
8 h-m-p 0.0000 0.0000 219.1760 ++ 509.958643 m 0.0000 123 | 4/9
9 h-m-p 0.0001 0.0003 31.4478 ++ 509.715808 m 0.0003 135 | 5/9
10 h-m-p 0.0000 0.0000 134.8382 ++ 509.565188 m 0.0000 147 | 6/9
11 h-m-p 1.6000 8.0000 0.0001 ----------N 509.565188 0 0.0000 169 | 6/9
12 h-m-p 0.0160 8.0000 0.0005 +++++ 509.565186 m 8.0000 187 | 6/9
13 h-m-p 0.0789 1.8425 0.0516 -------------Y 509.565186 0 0.0000 215 | 6/9
14 h-m-p 0.0056 2.7820 0.0115 +++++ 509.565176 m 2.7820 233 | 7/9
15 h-m-p 1.1759 8.0000 0.0213 ++ 509.565175 m 8.0000 248 | 7/9
16 h-m-p 1.6000 8.0000 0.0001 ++ 509.565175 m 8.0000 262 | 7/9
17 h-m-p 0.1030 8.0000 0.0099 ++++ 509.565175 m 8.0000 278 | 7/9
18 h-m-p 1.6000 8.0000 0.0232 ++ 509.565175 m 8.0000 292 | 7/9
19 h-m-p 1.6000 8.0000 0.0468 Y 509.565175 0 3.1970 306 | 7/9
20 h-m-p 1.6000 8.0000 0.0006 +C 509.565175 0 6.4000 321 | 7/9
21 h-m-p 0.7966 8.0000 0.0050 -C 509.565175 0 0.0498 336 | 7/9
22 h-m-p 0.9554 8.0000 0.0003 ------Y 509.565175 0 0.0001 356 | 7/9
23 h-m-p 1.6000 8.0000 0.0000 Y 509.565175 0 1.6000 370
Out..
lnL = -509.565175
371 lfun, 4081 eigenQcodon, 22260 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106098 0.014861 0.085705 0.048069 0.081897 0.054005 32.380133 0.900000 0.925749 1.723876 269.533060
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.024684
np = 11
lnL0 = -522.733095
Iterating by ming2
Initial: fx= 522.733095
x= 0.10610 0.01486 0.08570 0.04807 0.08190 0.05400 32.38013 0.90000 0.92575 1.72388 269.53306
1 h-m-p 0.0000 0.0011 94.8312 +++YYCYYCCCC 516.836945 8 0.0008 31 | 0/11
2 h-m-p 0.0001 0.0006 30.1970 ++ 516.361838 m 0.0006 45 | 1/11
3 h-m-p 0.0060 0.4134 2.5395 +++
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
+ 515.242045 m 0.4134 61
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.222648e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181405e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21880) = 1.181406e-160 2000 rounds
| 2/11
4 h-m-p 0.0001 0.0004 25.4383
QuantileBeta(0.15, 0.00500, 2.22033) = 1.180380e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22494) = 1.177313e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
+ 515.204862 m 0.0004 75
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.217358e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176293e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22647) = 1.176294e-160 2000 rounds
| 3/11
5 h-m-p 0.0001 0.0033 63.1482
QuantileBeta(0.15, 0.00500, 2.21834) = 1.181709e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19396) = 1.198255e-160 2000 rounds
+++ 513.443058 m 0.0033 90 | 4/11
6 h-m-p 0.0000 0.0001 1578.2224 ++ 513.038252 m 0.0001 104 | 5/11
7 h-m-p 0.0003 0.0017 21.8162 ++ 511.953349 m 0.0017 118 | 6/11
8 h-m-p 0.0197 8.0000 1.3396 -------------.. | 6/11
9 h-m-p 0.0000 0.0009 46.3121 ++++ 509.565141 m 0.0009 159 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 509.565141 m 8.0000 173 | 7/11
11 h-m-p 0.0160 8.0000 0.0060 +++++ 509.565127 m 8.0000 194 | 7/11
12 h-m-p 1.6000 8.0000 0.0021 ++ 509.565127 m 8.0000 212 | 7/11
13 h-m-p 0.6365 8.0000 0.0266 ++ 509.565125 m 8.0000 230 | 7/11
14 h-m-p 1.6000 8.0000 0.0164 ++ 509.565125 m 8.0000 248 | 7/11
15 h-m-p 0.9891 4.9453 0.1186 ++ 509.565124 m 4.9453 266 | 8/11
16 h-m-p 0.0212 8.0000 3.1103 +++++ 509.565124 m 8.0000 287 | 8/11
17 h-m-p 1.6000 8.0000 6.3424 ------------Y 509.565124 0 0.0000 313 | 8/11
18 h-m-p 1.6000 8.0000 0.0000 N 509.565124 0 0.8000 327 | 8/11
19 h-m-p 0.6500 8.0000 0.0000 Y 509.565124 0 0.6500 344
Out..
lnL = -509.565124
345 lfun, 4140 eigenQcodon, 22770 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -509.562180 S = -509.562147 -0.000015
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:14
did 20 / 49 patterns 0:14
did 30 / 49 patterns 0:15
did 40 / 49 patterns 0:15
did 49 / 49 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=128
NC_011896_1_WP_010908343_1_1529_MLBR_RS07250 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
NC_002677_1_NP_302022_1_894_ML1446 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV
**************************************************
NC_011896_1_WP_010908343_1_1529_MLBR_RS07250 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
NC_002677_1_NP_302022_1_894_ML1446 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105 KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI
**************************************************
NC_011896_1_WP_010908343_1_1529_MLBR_RS07250 QGRLFNFVSKLRGGMQNNVGLELRVSGS
NC_002677_1_NP_302022_1_894_ML1446 QGRLFNFVSKLRGGMQNNVGLELRVSGS
NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820 QGRLFNFVSKLRGGMQNNVGLELRVSGS
NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370 QGRLFNFVSKLRGGMQNNVGLELRVSGS
NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905 QGRLFNFVSKLRGGMQNNVGLELRVSGS
NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105 QGRLFNFVSKLRGGMQNNVGLELRVSGS
****************************
>NC_011896_1_WP_010908343_1_1529_MLBR_RS07250 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT >NC_002677_1_NP_302022_1_894_ML1446 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT >NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT >NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT >NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT >NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105 GTGACGCCCACATTTGCCGACTTAGCCAAGGCAAAGTACATCCTGTTGAC CACATTCACCAAGGATGGCCGACCCAAGCCGACTCCCATCTGGGCGGCCG CTGACGGCGACCGGCTGCTAGCTATATCCGCGGGAAAGGCGTGGAAGGTC AAGCGAATCCGCAATAACCCCCGGATTACGCTAGCCACTTGCAACGTACG TGGTTGCGCGACGAGCGCGGGTGTCCAGGGTAACGCCACCATCCTCGATA AGTTGCAAACGGGCAGCGTCTATGACGCAATCTGCAAGCAGTACGGCATC CAGGGCCGGCTGTTCAACTTCGTCAGCAAGTTGCGCGGAGGTATGCAAAA CAATGTCGGTCTTGAGCTCAGAGTGTCTGGAAGT
>NC_011896_1_WP_010908343_1_1529_MLBR_RS07250 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS >NC_002677_1_NP_302022_1_894_ML1446 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS >NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS >NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS >NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS >NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105 VTPTFADLAKAKYILLTTFTKDGRPKPTPIWAAADGDRLLAISAGKAWKV KRIRNNPRITLATCNVRGCATSAGVQGNATILDKLQTGSVYDAICKQYGI QGRLFNFVSKLRGGMQNNVGLELRVSGS
#NEXUS
[ID: 5079250553]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908343_1_1529_MLBR_RS07250
NC_002677_1_NP_302022_1_894_ML1446
NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820
NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370
NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905
NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908343_1_1529_MLBR_RS07250,
2 NC_002677_1_NP_302022_1_894_ML1446,
3 NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820,
4 NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370,
5 NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905,
6 NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06845089,2:0.06774621,3:0.0674204,4:0.06542091,5:0.06994626,6:0.07128342);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06845089,2:0.06774621,3:0.0674204,4:0.06542091,5:0.06994626,6:0.07128342);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.17 -530.97
2 -528.16 -535.17
--------------------------------------
TOTAL -528.16 -534.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1446/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891379 0.090049 0.335766 1.468647 0.855588 1501.00 1501.00 1.000
r(A<->C){all} 0.171798 0.021513 0.000123 0.474220 0.132412 203.75 215.39 1.000
r(A<->G){all} 0.162405 0.018600 0.000152 0.436624 0.126169 294.57 296.02 1.002
r(A<->T){all} 0.163950 0.018947 0.000062 0.440607 0.127735 206.49 243.98 1.000
r(C<->G){all} 0.163935 0.020031 0.000012 0.451965 0.124518 175.89 233.12 1.000
r(C<->T){all} 0.172531 0.020725 0.000036 0.459989 0.136821 59.27 196.52 1.000
r(G<->T){all} 0.165382 0.020739 0.000215 0.458477 0.127024 202.26 231.06 1.001
pi(A){all} 0.237040 0.000467 0.195635 0.279782 0.236671 1062.00 1177.18 1.000
pi(C){all} 0.288840 0.000540 0.244169 0.334342 0.288013 1175.04 1221.83 1.000
pi(G){all} 0.288633 0.000521 0.248184 0.336029 0.287691 1268.38 1384.69 1.000
pi(T){all} 0.185487 0.000389 0.150375 0.226425 0.185219 1199.17 1350.08 1.001
alpha{1,2} 0.429706 0.246545 0.000127 1.444819 0.243643 1289.27 1314.49 1.000
alpha{3} 0.464504 0.248288 0.000170 1.444966 0.292586 1173.64 1283.64 1.000
pinvar{all} 0.995799 0.000026 0.986436 0.999994 0.997452 1436.14 1458.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1446/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 128
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 4 4 4 4 4 4 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 4 4 4 4 4 4 | AAG 10 10 10 10 10 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 5 5 5 5 5 5
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 5 5 5 5 5 5 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908343_1_1529_MLBR_RS07250
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
#2: NC_002677_1_NP_302022_1_894_ML1446
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
#3: NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
#4: NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
#5: NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
#6: NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 12 | TGC 18
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 0 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 12 | CCC 24 | CAC 0 | CGC 12
CTA 12 | CCA 0 | Gln Q CAA 12 | CGA 12
CTG 18 | CCG 6 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 6
ATC 36 | ACC 18 | AAC 30 | AGC 18
ATA 6 | ACA 12 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 6 | ACG 24 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 30
GTC 30 | GCC 30 | GAC 24 | GGC 30
GTA 6 | GCA 12 | Glu E GAA 0 | GGA 18
GTG 12 | GCG 30 | GAG 6 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14062 C:0.20312 A:0.32812 G:0.32812
position 2: T:0.25781 C:0.25000 A:0.25000 G:0.24219
position 3: T:0.15625 C:0.41406 A:0.13281 G:0.29688
Average T:0.18490 C:0.28906 A:0.23698 G:0.28906
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -509.565124 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 35.095662 269.533060
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908343_1_1529_MLBR_RS07250: 0.000004, NC_002677_1_NP_302022_1_894_ML1446: 0.000004, NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820: 0.000004, NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370: 0.000004, NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905: 0.000004, NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 35.09566
omega (dN/dS) = 269.53306
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
7..2 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
7..3 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
7..4 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
7..5 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
7..6 0.000 287.3 96.7 269.5331 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -509.565175 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 32.499657 0.000010 0.035989
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908343_1_1529_MLBR_RS07250: 0.000004, NC_002677_1_NP_302022_1_894_ML1446: 0.000004, NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820: 0.000004, NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370: 0.000004, NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905: 0.000004, NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 32.49966
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.03599 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -509.565124 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 32.547567 0.004692 0.000002 0.000001 310.406676
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908343_1_1529_MLBR_RS07250: 0.000004, NC_002677_1_NP_302022_1_894_ML1446: 0.000004, NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820: 0.000004, NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370: 0.000004, NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905: 0.000004, NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 32.54757
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00469 0.00000 0.99531
w: 0.00000 1.00000 310.40668
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
7..2 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
7..3 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
7..4 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
7..5 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
7..6 0.000 287.4 96.6 308.9496 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908343_1_1529_MLBR_RS07250)
Pr(w>1) post mean +- SE for w
1 V 0.995** 308.950
2 T 0.995** 308.950
3 P 0.995** 308.950
4 T 0.995** 308.950
5 F 0.995** 308.950
6 A 0.995** 308.950
7 D 0.995** 308.950
8 L 0.995** 308.950
9 A 0.995** 308.950
10 K 0.995** 308.950
11 A 0.995** 308.950
12 K 0.995** 308.950
13 Y 0.995** 308.950
14 I 0.995** 308.950
15 L 0.995** 308.950
16 L 0.995** 308.950
17 T 0.995** 308.950
18 T 0.995** 308.950
19 F 0.995** 308.950
20 T 0.995** 308.950
21 K 0.995** 308.950
22 D 0.995** 308.950
23 G 0.995** 308.950
24 R 0.995** 308.950
25 P 0.995** 308.950
26 K 0.995** 308.950
27 P 0.995** 308.950
28 T 0.995** 308.950
29 P 0.995** 308.950
30 I 0.995** 308.950
31 W 0.995** 308.950
32 A 0.995** 308.950
33 A 0.995** 308.950
34 A 0.995** 308.950
35 D 0.995** 308.950
36 G 0.995** 308.950
37 D 0.995** 308.950
38 R 0.995** 308.950
39 L 0.995** 308.950
40 L 0.995** 308.950
41 A 0.995** 308.950
42 I 0.995** 308.950
43 S 0.995** 308.950
44 A 0.995** 308.950
45 G 0.995** 308.950
46 K 0.995** 308.950
47 A 0.995** 308.950
48 W 0.995** 308.950
49 K 0.995** 308.950
50 V 0.995** 308.950
51 K 0.995** 308.950
52 R 0.995** 308.950
53 I 0.995** 308.950
54 R 0.995** 308.950
55 N 0.995** 308.950
56 N 0.995** 308.950
57 P 0.995** 308.950
58 R 0.995** 308.950
59 I 0.995** 308.950
60 T 0.995** 308.950
61 L 0.995** 308.950
62 A 0.995** 308.950
63 T 0.995** 308.950
64 C 0.995** 308.950
65 N 0.995** 308.950
66 V 0.995** 308.950
67 R 0.995** 308.950
68 G 0.995** 308.950
69 C 0.995** 308.950
70 A 0.995** 308.950
71 T 0.995** 308.950
72 S 0.995** 308.950
73 A 0.995** 308.950
74 G 0.995** 308.950
75 V 0.995** 308.950
76 Q 0.995** 308.950
77 G 0.995** 308.950
78 N 0.995** 308.950
79 A 0.995** 308.950
80 T 0.995** 308.950
81 I 0.995** 308.950
82 L 0.995** 308.950
83 D 0.995** 308.950
84 K 0.995** 308.950
85 L 0.995** 308.950
86 Q 0.995** 308.950
87 T 0.995** 308.950
88 G 0.995** 308.950
89 S 0.995** 308.950
90 V 0.995** 308.950
91 Y 0.995** 308.950
92 D 0.995** 308.950
93 A 0.995** 308.950
94 I 0.995** 308.950
95 C 0.995** 308.950
96 K 0.995** 308.950
97 Q 0.995** 308.950
98 Y 0.995** 308.950
99 G 0.995** 308.950
100 I 0.995** 308.950
101 Q 0.995** 308.950
102 G 0.995** 308.950
103 R 0.995** 308.950
104 L 0.995** 308.950
105 F 0.995** 308.950
106 N 0.995** 308.950
107 F 0.995** 308.950
108 V 0.995** 308.950
109 S 0.995** 308.950
110 K 0.995** 308.950
111 L 0.995** 308.950
112 R 0.995** 308.950
113 G 0.995** 308.950
114 G 0.995** 308.950
115 M 0.995** 308.950
116 Q 0.995** 308.950
117 N 0.995** 308.950
118 N 0.995** 308.950
119 V 0.995** 308.950
120 G 0.995** 308.950
121 L 0.995** 308.950
122 E 0.995** 308.950
123 L 0.995** 308.950
124 R 0.995** 308.950
125 V 0.995** 308.950
126 S 0.995** 308.950
127 G 0.995** 308.950
128 S 0.995** 308.950
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908343_1_1529_MLBR_RS07250)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -509.565175 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 32.380133 0.661580 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908343_1_1529_MLBR_RS07250: 0.000004, NC_002677_1_NP_302022_1_894_ML1446: 0.000004, NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820: 0.000004, NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370: 0.000004, NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905: 0.000004, NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 32.38013
Parameters in M7 (beta):
p = 0.66158 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99993 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 287.4 96.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -509.565124 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 51.858016 0.000010 0.005000 1.941843 285.200628
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908343_1_1529_MLBR_RS07250: 0.000004, NC_002677_1_NP_302022_1_894_ML1446: 0.000004, NZ_LVXE01000004_1_WP_010908343_1_1736_A3216_RS02820: 0.000004, NZ_LYPH01000077_1_WP_010908343_1_2569_A8144_RS12370: 0.000004, NZ_CP029543_1_WP_010908343_1_1553_DIJ64_RS07905: 0.000004, NZ_AP014567_1_WP_010908343_1_1593_JK2ML_RS08105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 51.85802
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.94184
(p1 = 0.99999) w = 285.20063
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 285.20063
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
7..2 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
7..3 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
7..4 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
7..5 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
7..6 0.000 286.8 97.2 285.1978 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908343_1_1529_MLBR_RS07250)
Pr(w>1) post mean +- SE for w
1 V 1.000** 285.198
2 T 1.000** 285.198
3 P 1.000** 285.198
4 T 1.000** 285.198
5 F 1.000** 285.198
6 A 1.000** 285.198
7 D 1.000** 285.198
8 L 1.000** 285.198
9 A 1.000** 285.198
10 K 1.000** 285.198
11 A 1.000** 285.198
12 K 1.000** 285.198
13 Y 1.000** 285.198
14 I 1.000** 285.198
15 L 1.000** 285.198
16 L 1.000** 285.198
17 T 1.000** 285.198
18 T 1.000** 285.198
19 F 1.000** 285.198
20 T 1.000** 285.198
21 K 1.000** 285.198
22 D 1.000** 285.198
23 G 1.000** 285.198
24 R 1.000** 285.198
25 P 1.000** 285.198
26 K 1.000** 285.198
27 P 1.000** 285.198
28 T 1.000** 285.198
29 P 1.000** 285.198
30 I 1.000** 285.198
31 W 1.000** 285.198
32 A 1.000** 285.198
33 A 1.000** 285.198
34 A 1.000** 285.198
35 D 1.000** 285.198
36 G 1.000** 285.198
37 D 1.000** 285.198
38 R 1.000** 285.198
39 L 1.000** 285.198
40 L 1.000** 285.198
41 A 1.000** 285.198
42 I 1.000** 285.198
43 S 1.000** 285.198
44 A 1.000** 285.198
45 G 1.000** 285.198
46 K 1.000** 285.198
47 A 1.000** 285.198
48 W 1.000** 285.198
49 K 1.000** 285.198
50 V 1.000** 285.198
51 K 1.000** 285.198
52 R 1.000** 285.198
53 I 1.000** 285.198
54 R 1.000** 285.198
55 N 1.000** 285.198
56 N 1.000** 285.198
57 P 1.000** 285.198
58 R 1.000** 285.198
59 I 1.000** 285.198
60 T 1.000** 285.198
61 L 1.000** 285.198
62 A 1.000** 285.198
63 T 1.000** 285.198
64 C 1.000** 285.198
65 N 1.000** 285.198
66 V 1.000** 285.198
67 R 1.000** 285.198
68 G 1.000** 285.198
69 C 1.000** 285.198
70 A 1.000** 285.198
71 T 1.000** 285.198
72 S 1.000** 285.198
73 A 1.000** 285.198
74 G 1.000** 285.198
75 V 1.000** 285.198
76 Q 1.000** 285.198
77 G 1.000** 285.198
78 N 1.000** 285.198
79 A 1.000** 285.198
80 T 1.000** 285.198
81 I 1.000** 285.198
82 L 1.000** 285.198
83 D 1.000** 285.198
84 K 1.000** 285.198
85 L 1.000** 285.198
86 Q 1.000** 285.198
87 T 1.000** 285.198
88 G 1.000** 285.198
89 S 1.000** 285.198
90 V 1.000** 285.198
91 Y 1.000** 285.198
92 D 1.000** 285.198
93 A 1.000** 285.198
94 I 1.000** 285.198
95 C 1.000** 285.198
96 K 1.000** 285.198
97 Q 1.000** 285.198
98 Y 1.000** 285.198
99 G 1.000** 285.198
100 I 1.000** 285.198
101 Q 1.000** 285.198
102 G 1.000** 285.198
103 R 1.000** 285.198
104 L 1.000** 285.198
105 F 1.000** 285.198
106 N 1.000** 285.198
107 F 1.000** 285.198
108 V 1.000** 285.198
109 S 1.000** 285.198
110 K 1.000** 285.198
111 L 1.000** 285.198
112 R 1.000** 285.198
113 G 1.000** 285.198
114 G 1.000** 285.198
115 M 1.000** 285.198
116 Q 1.000** 285.198
117 N 1.000** 285.198
118 N 1.000** 285.198
119 V 1.000** 285.198
120 G 1.000** 285.198
121 L 1.000** 285.198
122 E 1.000** 285.198
123 L 1.000** 285.198
124 R 1.000** 285.198
125 V 1.000** 285.198
126 S 1.000** 285.198
127 G 1.000** 285.198
128 S 1.000** 285.198
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908343_1_1529_MLBR_RS07250)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -509.565175 Model 2: PositiveSelection -509.565124 Model 0: one-ratio -509.565124 Model 7: beta -509.565175 Model 8: beta&w>1 -509.565124 Model 0 vs 1 1.0199999996984843E-4 Model 2 vs 1 1.0199999996984843E-4 Model 8 vs 7 1.0199999996984843E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
