--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 08:44:25 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1506/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1402.30 -1405.75 2 -1402.26 -1405.19 -------------------------------------- TOTAL -1402.28 -1405.51 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.888920 0.088882 0.354249 1.444268 0.849925 1443.34 1472.17 1.000 r(A<->C){all} 0.165280 0.020034 0.000043 0.444490 0.126385 219.66 226.12 1.003 r(A<->G){all} 0.170404 0.020937 0.000016 0.459428 0.132482 163.92 219.12 1.000 r(A<->T){all} 0.158926 0.018329 0.000186 0.436666 0.121455 147.44 180.06 1.002 r(C<->G){all} 0.183281 0.021618 0.000066 0.476269 0.145225 197.41 221.28 1.005 r(C<->T){all} 0.156803 0.018551 0.000010 0.440722 0.118362 196.79 199.80 1.003 r(G<->T){all} 0.165306 0.018622 0.000116 0.441913 0.132096 169.33 237.49 1.000 pi(A){all} 0.214751 0.000158 0.190110 0.238381 0.214340 1022.73 1200.53 1.000 pi(C){all} 0.360880 0.000233 0.331977 0.392046 0.360725 878.07 982.44 1.000 pi(G){all} 0.267373 0.000189 0.241124 0.294506 0.267190 966.37 1231.92 1.000 pi(T){all} 0.156996 0.000133 0.134111 0.178420 0.156739 1128.22 1181.36 1.000 alpha{1,2} 0.424729 0.213631 0.000225 1.366127 0.263298 1305.41 1397.54 1.000 alpha{3} 0.474269 0.249006 0.000438 1.511573 0.313063 1221.45 1262.40 1.000 pinvar{all} 0.998630 0.000003 0.995710 1.000000 0.999097 1056.49 1125.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1357.573515 Model 2: PositiveSelection -1357.573515 Model 0: one-ratio -1357.573667 Model 7: beta -1357.573571 Model 8: beta&w>1 -1357.573515 Model 0 vs 1 3.0399999968722113E-4 Model 2 vs 1 0.0 Model 8 vs 7 1.1199999971722718E-4
>C1 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C2 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C3 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C4 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C5 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C6 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=348 C1 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C2 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C3 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C4 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C5 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C6 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ ************************************************** C1 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C2 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C3 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C4 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C5 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C6 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA ************************************************** C1 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C2 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C3 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C4 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C5 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C6 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG ************************************************** C1 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C2 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C3 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C4 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C5 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C6 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT ************************************************** C1 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C2 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C3 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C4 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C5 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C6 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP ************************************************** C1 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C2 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C3 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C4 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C5 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C6 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP ************************************************** C1 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C2 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C3 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C4 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C5 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C6 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP ************************************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 348 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 348 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10440] Library Relaxation: Multi_proc [96] Relaxation Summary: [10440]--->[10440] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.919 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C2 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C3 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C4 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C5 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ C6 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ ************************************************** C1 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C2 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C3 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C4 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C5 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA C6 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA ************************************************** C1 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C2 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C3 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C4 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C5 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG C6 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG ************************************************** C1 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C2 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C3 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C4 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C5 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT C6 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT ************************************************** C1 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C2 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C3 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C4 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C5 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP C6 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP ************************************************** C1 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C2 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C3 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C4 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C5 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP C6 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP ************************************************** C1 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C2 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C3 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C4 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C5 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP C6 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP ************************************************ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT C2 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT C3 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT C4 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT C5 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT C6 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT ************************************************** C1 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG C2 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG C3 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG C4 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG C5 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG C6 GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG ************************************************** C1 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA C2 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA C3 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA C4 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA C5 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA C6 CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA ************************************************** C1 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA C2 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA C3 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA C4 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA C5 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA C6 CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA ************************************************** C1 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT C2 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT C3 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT C4 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT C5 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT C6 AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT ************************************************** C1 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC C2 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC C3 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC C4 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC C5 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC C6 CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ************************************************** C1 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC C2 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC C3 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC C4 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC C5 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC C6 ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC ************************************************** C1 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG C2 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG C3 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG C4 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG C5 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG C6 TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG ************************************************** C1 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT C2 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT C3 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT C4 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT C5 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT C6 GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT ************************************************** C1 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA C2 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA C3 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA C4 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA C5 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA C6 GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA ************************************************** C1 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA C2 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA C3 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA C4 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA C5 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA C6 CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ************************************************** C1 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT C2 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT C3 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT C4 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT C5 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT C6 ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT ************************************************** C1 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC C2 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC C3 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC C4 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC C5 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC C6 CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC ************************************************** C1 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA C2 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA C3 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA C4 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA C5 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA C6 GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA ************************************************** C1 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA C2 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA C3 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA C4 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA C5 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA C6 GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA ************************************************** C1 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG C2 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG C3 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG C4 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG C5 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG C6 CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG ************************************************** C1 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG C2 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG C3 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG C4 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG C5 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG C6 AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG ************************************************** C1 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA C2 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA C3 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA C4 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA C5 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA C6 TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA ************************************************** C1 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG C2 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG C3 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG C4 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG C5 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG C6 GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG ************************************************** C1 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA C2 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA C3 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA C4 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA C5 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA C6 CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA ************************************************** C1 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG C2 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG C3 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG C4 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG C5 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG C6 AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG ******************************************** >C1 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C2 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C3 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C4 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C5 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C6 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >C1 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C2 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C3 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C4 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C5 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >C6 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1044 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579855387 Setting output file names to "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 981715883 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5176003918 Seed = 91515367 Swapseed = 1579855387 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2336.521930 -- -24.965149 Chain 2 -- -2336.521930 -- -24.965149 Chain 3 -- -2336.522062 -- -24.965149 Chain 4 -- -2336.521930 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2336.521930 -- -24.965149 Chain 2 -- -2336.522062 -- -24.965149 Chain 3 -- -2336.522062 -- -24.965149 Chain 4 -- -2336.521705 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2336.522] (-2336.522) (-2336.522) (-2336.522) * [-2336.522] (-2336.522) (-2336.522) (-2336.522) 500 -- [-1418.044] (-1407.795) (-1443.473) (-1408.538) * (-1441.362) (-1411.864) [-1416.343] (-1413.601) -- 0:00:00 1000 -- (-1417.911) [-1415.042] (-1415.438) (-1412.107) * (-1408.681) (-1420.897) [-1409.490] (-1415.110) -- 0:00:00 1500 -- [-1409.567] (-1415.076) (-1411.087) (-1411.948) * (-1413.390) (-1407.234) (-1413.971) [-1412.254] -- 0:00:00 2000 -- (-1413.330) (-1422.578) [-1414.340] (-1411.654) * (-1418.659) (-1413.585) [-1409.382] (-1414.006) -- 0:00:00 2500 -- [-1410.130] (-1405.744) (-1405.100) (-1413.015) * [-1408.128] (-1408.115) (-1411.288) (-1418.830) -- 0:00:00 3000 -- (-1414.932) (-1414.293) (-1417.265) [-1408.812] * (-1414.534) [-1409.418] (-1414.485) (-1410.342) -- 0:00:00 3500 -- (-1405.364) (-1421.441) [-1412.164] (-1416.391) * (-1415.249) (-1410.564) [-1418.843] (-1420.998) -- 0:00:00 4000 -- [-1408.564] (-1415.724) (-1408.918) (-1414.769) * [-1408.721] (-1413.853) (-1411.805) (-1418.159) -- 0:00:00 4500 -- (-1413.413) (-1413.082) [-1407.136] (-1415.491) * [-1407.672] (-1412.622) (-1409.598) (-1412.105) -- 0:00:00 5000 -- (-1417.707) (-1411.149) (-1416.077) [-1408.512] * (-1415.500) (-1406.945) [-1413.149] (-1414.111) -- 0:00:00 Average standard deviation of split frequencies: 0.095647 5500 -- (-1416.737) [-1410.519] (-1421.069) (-1408.925) * (-1410.353) (-1419.341) (-1411.049) [-1411.575] -- 0:00:00 6000 -- (-1414.377) [-1417.023] (-1413.028) (-1406.505) * (-1413.024) (-1411.133) (-1410.887) [-1410.465] -- 0:00:00 6500 -- (-1414.819) (-1411.282) [-1414.101] (-1413.447) * (-1415.564) (-1413.363) (-1414.128) [-1418.307] -- 0:00:00 7000 -- (-1417.105) (-1415.755) (-1417.058) [-1418.252] * (-1416.512) (-1421.225) (-1406.598) [-1420.505] -- 0:00:00 7500 -- (-1413.324) [-1406.563] (-1410.893) (-1409.544) * (-1411.434) [-1412.785] (-1404.469) (-1414.997) -- 0:00:00 8000 -- (-1412.643) (-1410.503) (-1415.677) [-1409.935] * (-1420.310) (-1412.016) (-1410.509) [-1408.344] -- 0:00:00 8500 -- (-1414.531) (-1418.144) (-1409.498) [-1408.931] * [-1407.622] (-1414.857) (-1403.103) (-1409.814) -- 0:01:56 9000 -- (-1408.517) (-1424.181) [-1408.995] (-1417.396) * (-1412.420) (-1410.202) [-1401.114] (-1412.535) -- 0:01:50 9500 -- (-1417.341) (-1417.124) (-1405.403) [-1409.384] * (-1423.133) (-1414.368) (-1401.866) [-1407.337] -- 0:01:44 10000 -- (-1411.690) (-1409.851) (-1414.245) [-1411.012] * (-1408.306) (-1418.967) (-1403.133) [-1409.475] -- 0:01:39 Average standard deviation of split frequencies: 0.059662 10500 -- (-1413.662) (-1412.130) [-1412.626] (-1411.345) * (-1423.498) (-1408.237) (-1403.118) [-1411.055] -- 0:01:34 11000 -- (-1410.723) (-1408.556) (-1412.320) [-1415.838] * (-1414.104) (-1406.333) (-1405.000) [-1422.245] -- 0:01:29 11500 -- [-1411.641] (-1407.278) (-1417.119) (-1411.797) * (-1415.411) (-1403.173) (-1404.549) [-1405.415] -- 0:01:25 12000 -- (-1411.960) (-1412.262) (-1416.020) [-1408.666] * (-1411.863) (-1402.243) (-1406.214) [-1407.147] -- 0:01:22 12500 -- [-1411.198] (-1410.872) (-1416.018) (-1409.716) * (-1409.195) (-1404.295) (-1407.679) [-1412.061] -- 0:01:19 13000 -- (-1419.022) (-1417.285) (-1424.451) [-1415.002] * [-1408.152] (-1404.292) (-1401.534) (-1412.257) -- 0:01:15 13500 -- (-1413.445) (-1410.607) (-1409.961) [-1414.892] * (-1411.208) (-1400.817) (-1404.561) [-1412.831] -- 0:01:13 14000 -- (-1414.024) (-1408.777) [-1407.804] (-1416.865) * (-1415.094) [-1401.194] (-1402.839) (-1424.098) -- 0:01:10 14500 -- (-1407.992) [-1411.706] (-1413.212) (-1412.152) * (-1410.621) (-1410.104) [-1403.031] (-1411.915) -- 0:01:07 15000 -- (-1412.435) [-1410.586] (-1407.833) (-1409.961) * (-1418.148) (-1405.161) (-1401.108) [-1412.575] -- 0:01:05 Average standard deviation of split frequencies: 0.055824 15500 -- [-1408.622] (-1410.560) (-1408.246) (-1411.920) * (-1410.481) [-1404.653] (-1401.279) (-1412.119) -- 0:01:03 16000 -- (-1411.721) (-1414.040) [-1411.300] (-1409.249) * (-1425.044) (-1405.391) (-1401.797) [-1413.892] -- 0:01:01 16500 -- [-1418.502] (-1417.322) (-1407.323) (-1415.353) * (-1414.249) [-1402.504] (-1401.534) (-1412.494) -- 0:00:59 17000 -- (-1408.563) (-1407.117) (-1412.625) [-1418.055] * (-1402.507) (-1403.067) [-1402.547] (-1410.425) -- 0:00:57 17500 -- [-1412.738] (-1416.095) (-1413.665) (-1420.687) * (-1405.853) (-1407.389) (-1402.794) [-1414.433] -- 0:00:56 18000 -- (-1405.665) (-1410.464) (-1417.403) [-1413.405] * (-1401.301) (-1404.534) (-1401.952) [-1412.223] -- 0:00:54 18500 -- [-1402.673] (-1411.616) (-1415.715) (-1417.673) * (-1402.926) (-1405.802) [-1403.725] (-1419.530) -- 0:00:53 19000 -- (-1401.925) (-1414.957) (-1413.969) [-1417.373] * (-1402.473) (-1402.966) [-1406.671] (-1413.684) -- 0:00:51 19500 -- (-1403.982) (-1408.900) [-1415.368] (-1401.592) * [-1402.453] (-1402.114) (-1403.819) (-1412.565) -- 0:00:50 20000 -- (-1402.228) (-1412.543) (-1411.004) [-1402.325] * [-1401.634] (-1403.730) (-1402.919) (-1413.032) -- 0:00:49 Average standard deviation of split frequencies: 0.058292 20500 -- (-1402.673) (-1412.596) (-1406.855) [-1403.366] * (-1401.413) (-1402.896) (-1403.362) [-1413.578] -- 0:00:47 21000 -- [-1402.387] (-1411.798) (-1418.244) (-1403.625) * (-1402.668) (-1403.952) [-1402.140] (-1411.883) -- 0:00:46 21500 -- [-1403.812] (-1409.384) (-1412.468) (-1402.842) * (-1403.312) (-1405.355) (-1404.225) [-1417.245] -- 0:00:45 22000 -- (-1403.216) (-1410.954) [-1410.808] (-1403.057) * (-1403.483) (-1403.791) [-1401.910] (-1412.110) -- 0:00:44 22500 -- (-1401.323) (-1418.960) [-1410.908] (-1405.931) * [-1404.896] (-1400.932) (-1403.008) (-1412.299) -- 0:00:43 23000 -- (-1401.412) (-1406.395) [-1411.063] (-1400.862) * (-1404.961) [-1401.852] (-1403.708) (-1412.267) -- 0:00:42 23500 -- (-1405.365) (-1405.214) [-1415.390] (-1401.069) * (-1403.129) (-1401.751) (-1403.241) [-1414.909] -- 0:00:41 24000 -- (-1404.978) (-1406.725) (-1414.307) [-1403.463] * (-1405.747) (-1402.551) [-1402.319] (-1411.276) -- 0:01:21 24500 -- [-1405.450] (-1406.169) (-1409.922) (-1403.117) * (-1402.029) (-1401.708) (-1402.155) [-1413.430] -- 0:01:19 25000 -- (-1403.589) (-1408.477) (-1411.515) [-1403.196] * (-1403.323) (-1402.117) (-1401.781) [-1413.847] -- 0:01:18 Average standard deviation of split frequencies: 0.038075 25500 -- [-1405.840] (-1411.767) (-1408.162) (-1401.814) * (-1402.333) [-1404.322] (-1402.927) (-1424.846) -- 0:01:16 26000 -- (-1403.905) [-1410.751] (-1413.563) (-1402.270) * (-1404.607) (-1407.490) [-1407.828] (-1411.034) -- 0:01:14 26500 -- [-1403.555] (-1423.206) (-1412.227) (-1402.230) * (-1406.548) (-1403.913) [-1403.747] (-1409.081) -- 0:01:13 27000 -- (-1403.739) (-1409.079) (-1415.370) [-1404.237] * (-1401.332) (-1405.560) [-1402.979] (-1418.039) -- 0:01:12 27500 -- [-1402.348] (-1410.212) (-1410.872) (-1401.796) * (-1403.899) (-1406.781) (-1403.513) [-1419.061] -- 0:01:10 28000 -- (-1402.832) (-1419.749) [-1409.536] (-1402.762) * (-1405.433) [-1403.888] (-1402.086) (-1410.801) -- 0:01:09 28500 -- (-1403.362) (-1414.168) [-1411.982] (-1403.869) * (-1404.617) (-1402.487) [-1402.004] (-1414.148) -- 0:01:08 29000 -- (-1403.944) (-1421.535) [-1407.423] (-1404.935) * (-1404.078) (-1405.406) [-1401.799] (-1422.166) -- 0:01:06 29500 -- (-1402.717) (-1420.723) [-1407.541] (-1403.236) * [-1402.496] (-1401.995) (-1407.117) (-1421.417) -- 0:01:05 30000 -- (-1402.791) (-1424.618) (-1408.420) [-1404.361] * (-1402.490) (-1405.049) (-1401.582) [-1409.595] -- 0:01:04 Average standard deviation of split frequencies: 0.033980 30500 -- [-1404.807] (-1409.742) (-1414.702) (-1404.481) * [-1401.175] (-1408.844) (-1402.444) (-1408.433) -- 0:01:03 31000 -- (-1403.224) [-1409.858] (-1410.364) (-1406.207) * [-1404.378] (-1404.048) (-1403.682) (-1409.695) -- 0:01:02 31500 -- (-1402.046) [-1407.980] (-1418.182) (-1404.316) * (-1403.243) [-1403.764] (-1403.069) (-1418.225) -- 0:01:01 32000 -- (-1402.171) (-1409.390) [-1411.257] (-1400.859) * [-1401.504] (-1403.384) (-1402.889) (-1410.484) -- 0:01:00 32500 -- [-1402.229] (-1410.634) (-1417.552) (-1402.718) * (-1403.396) [-1403.619] (-1402.510) (-1414.871) -- 0:00:59 33000 -- [-1401.272] (-1409.460) (-1408.582) (-1402.622) * (-1401.441) (-1403.210) (-1402.025) [-1416.943] -- 0:00:58 33500 -- [-1401.748] (-1409.647) (-1419.683) (-1402.396) * [-1401.674] (-1403.506) (-1404.121) (-1410.632) -- 0:00:57 34000 -- (-1406.163) (-1407.866) (-1415.747) [-1404.972] * [-1401.411] (-1402.483) (-1403.446) (-1412.287) -- 0:00:56 34500 -- (-1403.066) (-1415.616) [-1412.181] (-1403.976) * [-1406.899] (-1404.413) (-1404.883) (-1408.731) -- 0:00:55 35000 -- (-1405.848) (-1416.087) (-1407.337) [-1403.588] * (-1402.766) (-1404.815) [-1402.128] (-1410.437) -- 0:00:55 Average standard deviation of split frequencies: 0.030772 35500 -- (-1407.357) (-1409.490) (-1416.665) [-1402.749] * [-1401.535] (-1403.995) (-1401.581) (-1411.598) -- 0:00:54 36000 -- (-1405.234) (-1410.136) (-1429.490) [-1402.718] * (-1406.948) [-1407.051] (-1402.372) (-1405.721) -- 0:00:53 36500 -- (-1405.343) (-1408.132) [-1407.826] (-1403.136) * [-1403.604] (-1407.010) (-1403.187) (-1419.845) -- 0:00:52 37000 -- (-1403.132) (-1405.977) [-1407.841] (-1402.289) * (-1403.299) (-1405.675) [-1402.523] (-1412.788) -- 0:00:52 37500 -- (-1403.536) (-1419.274) (-1412.861) [-1402.865] * (-1406.203) (-1406.058) [-1402.321] (-1411.009) -- 0:00:51 38000 -- [-1402.116] (-1414.540) (-1412.063) (-1404.844) * (-1408.515) [-1406.434] (-1402.708) (-1411.889) -- 0:00:50 38500 -- (-1401.819) [-1412.982] (-1411.340) (-1403.241) * (-1403.306) [-1403.492] (-1401.674) (-1410.420) -- 0:00:49 39000 -- (-1402.512) (-1411.930) [-1409.651] (-1403.287) * (-1404.846) (-1409.659) (-1401.912) [-1407.595] -- 0:00:49 39500 -- (-1404.340) (-1414.269) [-1410.671] (-1401.243) * (-1403.629) (-1404.633) [-1403.593] (-1413.764) -- 0:01:12 40000 -- (-1407.998) (-1412.775) [-1415.950] (-1402.434) * [-1403.196] (-1403.310) (-1402.501) (-1411.623) -- 0:01:12 Average standard deviation of split frequencies: 0.031115 40500 -- (-1406.795) [-1416.683] (-1411.962) (-1401.855) * (-1402.002) (-1403.350) [-1404.827] (-1420.161) -- 0:01:11 41000 -- (-1405.308) (-1414.927) [-1407.452] (-1401.138) * [-1405.026] (-1403.667) (-1404.626) (-1413.877) -- 0:01:10 41500 -- (-1404.940) (-1408.763) (-1410.761) [-1401.496] * (-1403.583) (-1406.385) [-1404.318] (-1412.635) -- 0:01:09 42000 -- (-1403.561) (-1411.327) [-1417.646] (-1403.256) * [-1401.719] (-1410.945) (-1402.925) (-1418.499) -- 0:01:08 42500 -- (-1404.076) (-1412.738) [-1415.413] (-1402.905) * (-1406.181) [-1407.192] (-1400.965) (-1413.650) -- 0:01:07 43000 -- [-1401.883] (-1409.014) (-1409.334) (-1401.974) * (-1403.870) (-1400.575) [-1402.446] (-1409.411) -- 0:01:06 43500 -- [-1402.465] (-1408.823) (-1411.885) (-1404.255) * (-1403.921) (-1403.066) (-1406.361) [-1408.257] -- 0:01:05 44000 -- (-1402.594) (-1414.960) (-1425.443) [-1404.230] * (-1402.943) (-1401.819) (-1405.125) [-1408.893] -- 0:01:05 44500 -- [-1401.086] (-1406.602) (-1411.240) (-1404.210) * (-1403.017) (-1401.114) (-1405.166) [-1414.507] -- 0:01:04 45000 -- (-1403.124) (-1408.233) [-1412.493] (-1403.722) * (-1406.106) (-1401.146) (-1410.600) [-1412.965] -- 0:01:03 Average standard deviation of split frequencies: 0.028304 45500 -- (-1401.170) [-1412.523] (-1414.890) (-1403.743) * (-1405.879) [-1401.148] (-1402.424) (-1415.676) -- 0:01:02 46000 -- (-1400.880) [-1408.219] (-1409.409) (-1404.236) * (-1403.437) (-1401.575) (-1401.668) [-1407.782] -- 0:01:02 46500 -- [-1401.771] (-1413.051) (-1415.142) (-1401.670) * (-1405.743) (-1401.496) [-1402.054] (-1414.363) -- 0:01:01 47000 -- [-1401.348] (-1404.703) (-1433.871) (-1404.613) * (-1402.554) (-1401.246) (-1403.942) [-1415.934] -- 0:01:00 47500 -- [-1400.882] (-1409.743) (-1406.968) (-1404.495) * [-1402.584] (-1404.620) (-1402.764) (-1413.982) -- 0:01:00 48000 -- (-1403.661) (-1416.332) (-1402.061) [-1402.014] * (-1403.498) (-1401.435) [-1403.119] (-1417.697) -- 0:00:59 48500 -- [-1404.969] (-1416.099) (-1400.969) (-1407.798) * [-1400.897] (-1401.744) (-1403.074) (-1415.631) -- 0:00:58 49000 -- [-1406.043] (-1406.030) (-1400.998) (-1404.698) * (-1400.951) [-1404.335] (-1402.275) (-1405.626) -- 0:00:58 49500 -- (-1407.153) (-1419.117) [-1400.950] (-1404.180) * (-1400.945) [-1401.671] (-1402.818) (-1404.182) -- 0:00:57 50000 -- (-1404.199) (-1415.035) (-1402.779) [-1402.865] * (-1400.945) (-1401.705) [-1402.784] (-1404.911) -- 0:00:57 Average standard deviation of split frequencies: 0.031900 50500 -- (-1404.693) (-1415.546) (-1403.671) [-1402.549] * [-1400.853] (-1401.501) (-1404.004) (-1405.620) -- 0:00:56 51000 -- (-1404.713) (-1411.041) [-1402.130] (-1402.244) * (-1400.853) (-1401.787) (-1402.091) [-1405.060] -- 0:00:55 51500 -- (-1405.091) (-1412.289) (-1402.963) [-1404.446] * (-1401.166) (-1402.860) (-1401.195) [-1403.842] -- 0:00:55 52000 -- (-1403.140) (-1406.202) (-1403.584) [-1401.405] * (-1410.395) [-1402.683] (-1402.316) (-1406.547) -- 0:00:54 52500 -- (-1405.727) (-1410.269) (-1403.705) [-1402.284] * (-1407.965) [-1404.641] (-1403.038) (-1404.938) -- 0:00:54 53000 -- (-1403.932) (-1412.214) [-1402.929] (-1401.842) * (-1407.341) [-1401.871] (-1402.543) (-1401.522) -- 0:00:53 53500 -- (-1403.519) [-1412.578] (-1401.317) (-1402.133) * (-1404.183) (-1401.444) (-1403.404) [-1401.387] -- 0:00:53 54000 -- (-1402.047) (-1418.962) (-1401.127) [-1400.923] * (-1405.922) (-1408.987) (-1402.593) [-1401.643] -- 0:00:52 54500 -- (-1401.963) (-1414.157) [-1403.519] (-1401.703) * (-1403.659) (-1402.986) (-1405.411) [-1401.295] -- 0:00:52 55000 -- (-1402.374) (-1416.562) (-1403.115) [-1401.058] * (-1405.246) [-1401.157] (-1404.030) (-1402.723) -- 0:00:51 Average standard deviation of split frequencies: 0.034874 55500 -- [-1402.416] (-1417.848) (-1400.662) (-1401.058) * (-1405.847) (-1401.498) [-1408.174] (-1402.946) -- 0:01:08 56000 -- (-1401.845) [-1410.002] (-1403.039) (-1403.573) * (-1405.053) (-1400.948) (-1406.127) [-1404.924] -- 0:01:07 56500 -- (-1403.359) (-1411.893) (-1402.303) [-1401.516] * [-1405.104] (-1403.816) (-1409.077) (-1405.097) -- 0:01:06 57000 -- [-1407.096] (-1412.423) (-1401.967) (-1401.839) * (-1404.034) (-1405.366) [-1405.113] (-1407.170) -- 0:01:06 57500 -- (-1405.112) (-1411.003) [-1401.764] (-1405.852) * (-1402.649) [-1403.038] (-1403.201) (-1410.790) -- 0:01:05 58000 -- (-1404.702) (-1408.968) [-1401.648] (-1405.208) * (-1405.916) (-1401.992) (-1405.431) [-1403.009] -- 0:01:04 58500 -- (-1403.024) [-1406.364] (-1401.173) (-1407.534) * (-1403.365) [-1402.370] (-1406.306) (-1402.195) -- 0:01:04 59000 -- (-1405.165) [-1413.782] (-1401.832) (-1402.250) * (-1406.969) (-1402.747) (-1409.016) [-1402.433] -- 0:01:03 59500 -- (-1405.881) (-1415.479) [-1400.906] (-1404.017) * (-1406.816) [-1404.243] (-1402.984) (-1409.949) -- 0:01:03 60000 -- [-1405.189] (-1425.773) (-1402.531) (-1401.529) * (-1409.663) (-1403.453) [-1401.236] (-1412.296) -- 0:01:02 Average standard deviation of split frequencies: 0.032636 60500 -- (-1405.090) (-1409.920) [-1402.293] (-1401.786) * [-1409.384] (-1403.985) (-1401.730) (-1405.027) -- 0:01:02 61000 -- (-1402.798) (-1409.413) [-1403.200] (-1402.179) * (-1405.774) [-1404.204] (-1401.411) (-1403.344) -- 0:01:01 61500 -- [-1403.897] (-1420.597) (-1402.552) (-1402.695) * [-1406.218] (-1403.652) (-1402.722) (-1402.220) -- 0:01:01 62000 -- (-1402.396) (-1406.539) [-1401.459] (-1402.025) * (-1401.487) (-1404.759) [-1401.807] (-1403.013) -- 0:01:00 62500 -- [-1401.741] (-1403.828) (-1401.985) (-1402.322) * (-1406.856) (-1404.185) [-1402.619] (-1406.987) -- 0:01:00 63000 -- (-1401.871) (-1405.644) [-1403.961] (-1402.321) * (-1407.493) (-1405.295) [-1402.616] (-1403.446) -- 0:00:59 63500 -- (-1402.363) (-1405.302) [-1403.299] (-1401.630) * (-1402.730) (-1402.368) (-1404.450) [-1402.926] -- 0:00:58 64000 -- (-1404.369) (-1404.076) [-1404.040] (-1402.058) * [-1404.685] (-1401.038) (-1404.702) (-1403.334) -- 0:00:58 64500 -- (-1404.058) (-1404.929) [-1405.128] (-1404.201) * (-1404.466) [-1402.614] (-1404.967) (-1403.360) -- 0:00:58 65000 -- (-1403.509) (-1402.412) (-1405.793) [-1405.983] * (-1402.951) (-1401.687) (-1404.641) [-1401.998] -- 0:00:57 Average standard deviation of split frequencies: 0.029641 65500 -- (-1403.204) (-1402.626) (-1414.404) [-1404.839] * (-1402.581) (-1403.273) [-1402.277] (-1401.998) -- 0:00:57 66000 -- [-1408.049] (-1403.251) (-1410.049) (-1404.260) * [-1400.922] (-1403.273) (-1407.246) (-1406.298) -- 0:00:56 66500 -- [-1401.372] (-1405.664) (-1406.282) (-1405.609) * [-1401.141] (-1402.898) (-1403.227) (-1403.087) -- 0:00:56 67000 -- (-1401.274) [-1405.165] (-1416.570) (-1401.918) * [-1403.873] (-1401.033) (-1402.380) (-1402.220) -- 0:00:55 67500 -- (-1404.187) (-1404.321) (-1406.619) [-1401.532] * (-1401.785) [-1400.869] (-1402.320) (-1405.714) -- 0:00:55 68000 -- (-1404.071) [-1403.906] (-1405.271) (-1401.913) * (-1404.518) (-1400.836) (-1403.037) [-1403.796] -- 0:00:54 68500 -- (-1402.131) (-1402.640) (-1402.890) [-1401.416] * (-1402.125) [-1400.745] (-1401.607) (-1403.043) -- 0:00:54 69000 -- [-1401.641] (-1403.838) (-1401.910) (-1403.240) * (-1401.666) (-1409.806) [-1401.607] (-1406.885) -- 0:00:53 69500 -- (-1404.698) (-1403.811) [-1402.430] (-1401.790) * (-1400.685) [-1402.843] (-1401.607) (-1402.317) -- 0:00:53 70000 -- (-1404.687) (-1405.773) [-1404.451] (-1401.789) * (-1402.271) [-1401.761] (-1402.359) (-1406.179) -- 0:00:53 Average standard deviation of split frequencies: 0.026350 70500 -- [-1404.166] (-1404.274) (-1406.037) (-1408.295) * [-1401.995] (-1404.762) (-1403.937) (-1406.049) -- 0:00:52 71000 -- (-1405.192) (-1406.211) (-1404.172) [-1406.709] * (-1403.045) [-1403.441] (-1403.428) (-1403.378) -- 0:01:05 71500 -- (-1404.516) (-1407.638) [-1401.454] (-1406.834) * [-1406.513] (-1402.962) (-1404.551) (-1403.112) -- 0:01:04 72000 -- [-1401.635] (-1406.075) (-1402.801) (-1403.400) * (-1404.161) (-1404.902) (-1410.113) [-1406.947] -- 0:01:04 72500 -- (-1401.630) (-1405.504) (-1404.022) [-1402.064] * (-1403.119) [-1401.764] (-1408.741) (-1407.283) -- 0:01:03 73000 -- (-1403.492) (-1404.907) [-1401.118] (-1402.934) * [-1401.501] (-1403.109) (-1405.841) (-1410.523) -- 0:01:03 73500 -- (-1404.693) [-1402.045] (-1404.559) (-1404.435) * (-1401.641) (-1403.169) [-1402.327] (-1404.692) -- 0:01:03 74000 -- (-1405.135) [-1401.688] (-1405.431) (-1402.614) * (-1402.875) [-1405.434] (-1401.790) (-1407.940) -- 0:01:02 74500 -- (-1405.608) [-1403.164] (-1404.965) (-1403.875) * [-1401.910] (-1403.128) (-1401.874) (-1401.253) -- 0:01:02 75000 -- [-1403.710] (-1403.653) (-1402.184) (-1403.064) * (-1401.795) (-1401.669) [-1403.929] (-1402.396) -- 0:01:01 Average standard deviation of split frequencies: 0.025121 75500 -- (-1405.851) (-1404.779) [-1401.343] (-1405.741) * (-1402.265) (-1401.830) [-1402.806] (-1401.545) -- 0:01:01 76000 -- [-1401.067] (-1403.161) (-1407.176) (-1402.292) * (-1401.762) [-1402.817] (-1403.327) (-1404.295) -- 0:01:00 76500 -- [-1403.974] (-1403.105) (-1406.992) (-1402.110) * [-1401.779] (-1405.875) (-1403.339) (-1404.978) -- 0:01:00 77000 -- [-1401.364] (-1403.261) (-1401.196) (-1400.718) * (-1401.968) (-1405.745) (-1404.478) [-1404.036] -- 0:00:59 77500 -- [-1401.647] (-1403.339) (-1403.048) (-1400.664) * [-1402.131] (-1405.927) (-1405.699) (-1404.760) -- 0:00:59 78000 -- [-1403.236] (-1402.161) (-1401.595) (-1401.719) * (-1402.653) (-1406.143) (-1404.526) [-1404.133] -- 0:00:59 78500 -- (-1404.129) (-1401.837) (-1402.444) [-1402.036] * (-1402.158) [-1403.053] (-1402.002) (-1401.859) -- 0:00:58 79000 -- (-1403.571) (-1400.877) [-1403.228] (-1402.339) * [-1401.584] (-1402.863) (-1404.342) (-1401.850) -- 0:00:58 79500 -- (-1401.983) [-1403.079] (-1405.715) (-1400.920) * [-1403.119] (-1402.738) (-1404.014) (-1402.092) -- 0:00:57 80000 -- (-1403.997) (-1401.903) (-1402.963) [-1401.471] * (-1402.341) [-1402.788] (-1402.387) (-1403.996) -- 0:00:57 Average standard deviation of split frequencies: 0.029804 80500 -- (-1402.338) [-1402.939] (-1405.869) (-1401.416) * (-1402.113) [-1401.419] (-1403.142) (-1403.506) -- 0:00:57 81000 -- (-1402.379) (-1403.509) [-1404.987] (-1401.850) * [-1401.553] (-1401.299) (-1401.024) (-1402.598) -- 0:00:56 81500 -- [-1404.002] (-1404.666) (-1403.113) (-1400.938) * [-1404.746] (-1401.807) (-1401.051) (-1402.448) -- 0:00:56 82000 -- (-1401.735) (-1404.315) (-1403.574) [-1401.823] * (-1402.507) (-1401.334) (-1401.210) [-1401.700] -- 0:00:55 82500 -- [-1401.966] (-1403.194) (-1402.202) (-1401.970) * (-1406.804) (-1402.087) (-1401.040) [-1402.222] -- 0:00:55 83000 -- (-1406.155) (-1406.119) (-1402.234) [-1402.549] * (-1408.419) (-1402.228) [-1401.468] (-1401.907) -- 0:00:55 83500 -- (-1405.207) [-1405.845] (-1402.978) (-1402.116) * (-1405.998) [-1401.264] (-1402.196) (-1404.070) -- 0:00:54 84000 -- (-1405.852) (-1405.215) [-1402.290] (-1401.042) * (-1402.573) (-1407.998) (-1402.079) [-1403.358] -- 0:00:54 84500 -- (-1405.008) (-1403.012) (-1403.365) [-1401.720] * (-1401.677) [-1400.588] (-1401.474) (-1405.223) -- 0:00:54 85000 -- (-1401.921) (-1403.320) [-1402.571] (-1402.321) * (-1402.402) (-1406.947) [-1403.277] (-1402.730) -- 0:00:53 Average standard deviation of split frequencies: 0.032066 85500 -- (-1401.667) [-1401.007] (-1402.296) (-1402.106) * (-1403.607) (-1405.336) (-1401.817) [-1402.168] -- 0:00:53 86000 -- [-1401.696] (-1404.180) (-1401.828) (-1401.809) * (-1402.022) (-1403.292) [-1400.924] (-1403.079) -- 0:00:53 86500 -- [-1401.680] (-1403.678) (-1401.588) (-1402.221) * (-1403.752) (-1401.659) [-1400.913] (-1403.939) -- 0:00:52 87000 -- (-1401.325) [-1401.198] (-1401.247) (-1402.513) * (-1402.150) (-1401.770) [-1400.977] (-1404.288) -- 0:01:02 87500 -- (-1402.587) (-1401.963) (-1401.283) [-1403.848] * (-1403.420) [-1401.157] (-1400.717) (-1402.155) -- 0:01:02 88000 -- (-1402.694) (-1404.093) (-1402.254) [-1402.113] * (-1401.127) (-1400.697) [-1400.708] (-1402.180) -- 0:01:02 88500 -- (-1401.428) (-1404.070) (-1402.346) [-1403.361] * (-1402.464) [-1403.643] (-1401.671) (-1403.892) -- 0:01:01 89000 -- [-1401.926] (-1401.491) (-1401.571) (-1403.083) * [-1401.341] (-1401.277) (-1400.913) (-1402.563) -- 0:01:01 89500 -- (-1406.946) (-1401.202) [-1401.200] (-1404.932) * (-1404.354) [-1401.369] (-1404.958) (-1402.646) -- 0:01:01 90000 -- [-1405.356] (-1401.323) (-1402.774) (-1402.760) * (-1404.082) [-1403.648] (-1401.104) (-1401.882) -- 0:01:00 Average standard deviation of split frequencies: 0.029828 90500 -- (-1402.009) (-1401.752) [-1403.742] (-1404.891) * [-1401.904] (-1412.270) (-1404.795) (-1402.036) -- 0:01:00 91000 -- (-1402.153) (-1406.010) [-1402.485] (-1405.769) * (-1402.459) (-1404.616) (-1403.794) [-1402.201] -- 0:00:59 91500 -- [-1401.376] (-1406.277) (-1402.505) (-1405.315) * (-1403.158) [-1401.934] (-1403.101) (-1403.128) -- 0:00:59 92000 -- [-1401.649] (-1401.400) (-1400.809) (-1407.085) * (-1403.153) [-1403.622] (-1404.291) (-1402.166) -- 0:00:59 92500 -- (-1402.697) [-1402.343] (-1401.191) (-1406.281) * (-1402.851) [-1403.622] (-1404.020) (-1401.437) -- 0:00:58 93000 -- (-1403.603) (-1401.287) [-1401.509] (-1405.402) * [-1404.749] (-1400.745) (-1403.862) (-1405.007) -- 0:00:58 93500 -- (-1402.202) (-1401.225) (-1401.394) [-1405.493] * [-1405.203] (-1401.857) (-1403.167) (-1407.038) -- 0:00:58 94000 -- [-1401.331] (-1401.760) (-1401.513) (-1407.182) * (-1403.186) [-1402.885] (-1402.844) (-1404.309) -- 0:00:57 94500 -- (-1404.929) [-1403.167] (-1401.125) (-1404.755) * (-1405.459) (-1401.469) (-1402.823) [-1403.628] -- 0:00:57 95000 -- (-1401.323) [-1402.390] (-1402.390) (-1402.762) * (-1404.654) (-1401.469) [-1404.283] (-1406.142) -- 0:00:57 Average standard deviation of split frequencies: 0.027358 95500 -- [-1400.873] (-1405.490) (-1407.165) (-1403.355) * [-1406.848] (-1401.469) (-1404.457) (-1409.605) -- 0:00:56 96000 -- [-1402.343] (-1408.543) (-1405.932) (-1402.433) * (-1406.069) (-1402.529) [-1402.232] (-1409.922) -- 0:00:56 96500 -- (-1403.080) (-1404.732) [-1404.258] (-1403.735) * (-1411.275) (-1402.058) (-1401.061) [-1406.788] -- 0:00:56 97000 -- (-1405.567) (-1404.362) [-1404.018] (-1402.920) * (-1408.833) (-1403.944) (-1401.261) [-1403.888] -- 0:00:55 97500 -- (-1404.374) (-1405.243) (-1401.572) [-1401.862] * [-1406.724] (-1402.728) (-1401.615) (-1401.993) -- 0:00:55 98000 -- (-1406.191) (-1413.599) [-1403.737] (-1402.816) * (-1407.894) (-1407.843) [-1403.348] (-1400.788) -- 0:00:55 98500 -- (-1405.702) [-1403.770] (-1402.640) (-1401.517) * (-1407.230) (-1404.893) (-1402.254) [-1400.854] -- 0:00:54 99000 -- [-1401.408] (-1402.300) (-1403.131) (-1407.035) * [-1403.409] (-1402.992) (-1404.168) (-1401.621) -- 0:00:54 99500 -- (-1404.102) [-1402.332] (-1405.819) (-1405.081) * (-1402.523) [-1402.186] (-1408.935) (-1409.286) -- 0:00:54 100000 -- (-1407.930) (-1403.555) (-1403.675) [-1406.255] * [-1402.935] (-1402.141) (-1404.464) (-1414.138) -- 0:00:54 Average standard deviation of split frequencies: 0.026926 100500 -- (-1403.804) (-1402.676) [-1404.514] (-1406.794) * [-1401.206] (-1405.066) (-1403.614) (-1404.052) -- 0:00:53 101000 -- [-1405.197] (-1400.824) (-1402.525) (-1406.385) * (-1401.476) (-1410.306) [-1403.578] (-1403.122) -- 0:00:53 101500 -- [-1406.407] (-1401.900) (-1405.274) (-1406.723) * (-1404.997) [-1405.652] (-1402.081) (-1404.857) -- 0:00:53 102000 -- (-1402.898) (-1402.250) [-1402.984] (-1405.856) * [-1402.020] (-1404.506) (-1404.763) (-1404.791) -- 0:00:52 102500 -- (-1402.817) (-1403.196) (-1403.483) [-1404.747] * [-1404.105] (-1402.576) (-1405.454) (-1403.847) -- 0:01:01 103000 -- (-1402.832) (-1400.948) [-1403.769] (-1402.182) * (-1402.515) (-1405.549) (-1405.207) [-1401.494] -- 0:01:00 103500 -- (-1402.410) (-1400.867) (-1404.516) [-1402.149] * (-1406.597) (-1405.633) [-1405.482] (-1401.112) -- 0:01:00 104000 -- (-1404.051) (-1403.402) [-1405.235] (-1407.375) * (-1404.154) (-1406.186) [-1403.561] (-1401.991) -- 0:01:00 104500 -- [-1403.028] (-1404.026) (-1404.062) (-1404.968) * (-1403.535) (-1404.076) (-1402.522) [-1402.021] -- 0:00:59 105000 -- [-1401.376] (-1404.828) (-1403.304) (-1407.685) * (-1402.740) (-1401.857) [-1402.790] (-1401.014) -- 0:00:59 Average standard deviation of split frequencies: 0.026895 105500 -- (-1404.342) (-1402.482) (-1403.133) [-1406.475] * (-1403.035) (-1406.093) [-1403.810] (-1401.328) -- 0:00:59 106000 -- (-1403.854) (-1403.628) [-1403.973] (-1406.946) * (-1404.247) (-1404.568) [-1403.944] (-1402.264) -- 0:00:59 106500 -- [-1402.493] (-1401.894) (-1402.696) (-1403.583) * (-1403.852) (-1407.415) (-1407.459) [-1401.416] -- 0:00:58 107000 -- (-1402.018) [-1402.308] (-1404.186) (-1402.163) * [-1403.431] (-1402.652) (-1405.400) (-1400.689) -- 0:00:58 107500 -- (-1405.501) [-1404.069] (-1408.750) (-1401.981) * (-1401.705) [-1402.156] (-1409.027) (-1402.974) -- 0:00:58 108000 -- (-1404.042) (-1405.557) [-1403.650] (-1403.385) * (-1403.012) (-1401.961) [-1401.702] (-1407.726) -- 0:00:57 108500 -- (-1403.234) (-1406.346) (-1403.634) [-1403.539] * (-1403.918) [-1401.238] (-1401.640) (-1408.546) -- 0:00:57 109000 -- (-1403.884) (-1407.055) [-1403.094] (-1402.558) * (-1403.330) [-1401.719] (-1402.127) (-1401.575) -- 0:00:57 109500 -- (-1403.068) (-1404.607) (-1405.187) [-1403.477] * (-1401.685) (-1401.013) [-1401.934] (-1401.541) -- 0:00:56 110000 -- (-1404.531) (-1404.824) (-1401.337) [-1402.125] * (-1401.506) (-1405.322) (-1403.673) [-1401.032] -- 0:00:56 Average standard deviation of split frequencies: 0.023327 110500 -- (-1402.545) [-1402.439] (-1402.209) (-1402.106) * (-1401.637) (-1407.823) [-1404.689] (-1403.083) -- 0:00:56 111000 -- [-1402.926] (-1406.360) (-1402.116) (-1401.141) * [-1401.420] (-1406.440) (-1404.076) (-1402.436) -- 0:00:56 111500 -- [-1402.829] (-1401.566) (-1403.412) (-1401.321) * [-1404.171] (-1402.672) (-1402.665) (-1403.821) -- 0:00:55 112000 -- (-1403.612) (-1406.465) (-1402.723) [-1403.346] * [-1406.800] (-1405.450) (-1403.973) (-1404.808) -- 0:00:55 112500 -- [-1404.421] (-1405.669) (-1401.574) (-1404.355) * (-1407.259) (-1402.304) (-1401.522) [-1404.770] -- 0:00:55 113000 -- [-1401.070] (-1401.083) (-1402.327) (-1407.217) * (-1400.896) (-1402.346) [-1403.027] (-1404.791) -- 0:00:54 113500 -- [-1401.430] (-1401.809) (-1402.519) (-1404.407) * (-1406.397) (-1403.023) [-1401.931] (-1402.412) -- 0:00:54 114000 -- (-1403.306) [-1401.390] (-1401.398) (-1403.839) * (-1407.935) (-1402.749) [-1401.592] (-1401.129) -- 0:00:54 114500 -- [-1401.960] (-1402.672) (-1401.294) (-1407.762) * (-1405.190) (-1401.353) [-1401.889] (-1403.084) -- 0:00:54 115000 -- [-1401.548] (-1410.124) (-1405.531) (-1403.088) * (-1408.315) (-1405.623) (-1402.867) [-1403.226] -- 0:00:53 Average standard deviation of split frequencies: 0.020929 115500 -- (-1404.059) (-1406.945) (-1404.854) [-1403.638] * (-1404.885) [-1403.891] (-1402.326) (-1402.613) -- 0:00:53 116000 -- (-1404.073) [-1406.456] (-1402.964) (-1402.325) * [-1402.884] (-1403.501) (-1402.897) (-1402.286) -- 0:00:53 116500 -- (-1404.687) (-1403.743) [-1401.604] (-1405.836) * [-1402.888] (-1403.855) (-1402.530) (-1401.587) -- 0:00:53 117000 -- (-1404.779) [-1405.120] (-1404.235) (-1403.080) * (-1405.538) (-1406.693) (-1404.685) [-1401.786] -- 0:00:52 117500 -- [-1404.689] (-1403.299) (-1402.918) (-1402.229) * (-1406.273) (-1405.252) (-1404.371) [-1401.254] -- 0:00:52 118000 -- [-1402.113] (-1402.261) (-1402.989) (-1403.628) * [-1404.012] (-1405.451) (-1402.928) (-1401.239) -- 0:00:59 118500 -- (-1401.922) (-1401.938) (-1404.868) [-1403.508] * [-1404.968] (-1409.996) (-1406.420) (-1401.048) -- 0:00:59 119000 -- (-1403.284) (-1402.063) [-1406.368] (-1405.102) * (-1405.881) (-1407.516) [-1405.228] (-1402.802) -- 0:00:59 119500 -- (-1407.493) [-1406.487] (-1404.913) (-1402.846) * (-1403.373) [-1402.316] (-1406.202) (-1402.058) -- 0:00:58 120000 -- [-1402.126] (-1405.552) (-1403.133) (-1402.518) * (-1402.464) (-1402.385) (-1404.058) [-1401.091] -- 0:00:58 Average standard deviation of split frequencies: 0.024417 120500 -- [-1401.819] (-1402.186) (-1408.958) (-1405.639) * (-1402.959) (-1401.523) [-1402.892] (-1402.081) -- 0:00:58 121000 -- (-1405.145) (-1403.106) (-1406.740) [-1402.360] * (-1403.173) (-1403.180) [-1402.404] (-1402.107) -- 0:00:58 121500 -- (-1405.096) (-1403.080) [-1405.801] (-1405.916) * [-1402.036] (-1405.412) (-1401.899) (-1400.820) -- 0:00:57 122000 -- (-1401.487) (-1403.175) (-1404.268) [-1403.980] * (-1402.063) (-1403.683) (-1406.592) [-1403.055] -- 0:00:57 122500 -- (-1401.755) (-1401.752) [-1406.748] (-1403.197) * [-1402.190] (-1403.291) (-1404.580) (-1407.944) -- 0:00:57 123000 -- (-1403.267) (-1402.543) [-1401.868] (-1403.633) * (-1402.190) (-1403.471) [-1404.210] (-1411.017) -- 0:00:57 123500 -- (-1406.020) [-1401.867] (-1402.412) (-1405.012) * (-1402.872) (-1403.458) [-1404.367] (-1408.426) -- 0:00:56 124000 -- (-1404.845) (-1401.528) [-1402.245] (-1404.225) * [-1402.872] (-1401.441) (-1403.879) (-1409.104) -- 0:00:56 124500 -- (-1403.395) (-1404.006) [-1402.600] (-1404.221) * (-1402.304) [-1402.092] (-1401.216) (-1408.256) -- 0:00:56 125000 -- (-1402.790) (-1406.736) (-1403.911) [-1404.702] * [-1402.327] (-1402.484) (-1402.069) (-1406.441) -- 0:00:56 Average standard deviation of split frequencies: 0.025655 125500 -- [-1402.349] (-1402.897) (-1401.657) (-1404.682) * (-1404.473) [-1407.434] (-1403.197) (-1405.150) -- 0:00:55 126000 -- [-1402.395] (-1403.964) (-1402.323) (-1403.436) * (-1404.091) [-1404.459] (-1404.996) (-1404.631) -- 0:00:55 126500 -- [-1404.159] (-1403.284) (-1401.950) (-1401.326) * [-1403.125] (-1401.160) (-1402.399) (-1407.321) -- 0:00:55 127000 -- (-1401.987) [-1403.002] (-1402.161) (-1401.482) * (-1405.142) (-1401.456) [-1401.818] (-1404.806) -- 0:00:54 127500 -- (-1402.727) [-1403.409] (-1401.176) (-1401.813) * (-1406.020) (-1402.422) [-1401.031] (-1404.225) -- 0:00:54 128000 -- (-1403.391) (-1406.287) (-1402.744) [-1401.854] * (-1406.406) (-1404.487) (-1401.551) [-1406.760] -- 0:00:54 128500 -- (-1403.394) (-1403.947) (-1401.846) [-1404.043] * [-1401.406] (-1408.666) (-1402.222) (-1407.233) -- 0:00:54 129000 -- (-1404.526) [-1401.947] (-1404.084) (-1403.409) * [-1400.646] (-1405.747) (-1401.835) (-1403.771) -- 0:00:54 129500 -- (-1402.739) (-1402.392) [-1401.566] (-1403.213) * (-1405.205) (-1401.014) [-1402.201] (-1404.400) -- 0:00:53 130000 -- (-1404.043) (-1402.574) [-1401.946] (-1401.771) * (-1407.800) [-1401.183] (-1403.078) (-1403.333) -- 0:00:53 Average standard deviation of split frequencies: 0.024223 130500 -- (-1403.213) (-1402.551) (-1402.706) [-1401.861] * [-1407.625] (-1400.870) (-1402.225) (-1401.984) -- 0:00:53 131000 -- (-1404.430) [-1402.481] (-1401.658) (-1404.218) * (-1405.115) (-1400.910) (-1401.269) [-1402.397] -- 0:00:53 131500 -- (-1405.200) [-1406.119] (-1403.223) (-1401.916) * (-1404.718) [-1401.826] (-1401.164) (-1406.773) -- 0:00:52 132000 -- (-1406.955) [-1402.877] (-1402.897) (-1402.855) * (-1406.199) [-1402.159] (-1401.075) (-1404.970) -- 0:00:52 132500 -- (-1409.358) [-1402.252] (-1402.332) (-1403.019) * (-1406.625) [-1403.097] (-1401.422) (-1404.346) -- 0:00:52 133000 -- (-1406.296) (-1402.278) (-1401.856) [-1404.689] * (-1401.042) (-1403.285) (-1401.718) [-1400.786] -- 0:00:52 133500 -- (-1405.591) [-1403.260] (-1401.206) (-1403.772) * (-1402.597) (-1403.269) (-1402.560) [-1403.431] -- 0:00:51 134000 -- [-1401.852] (-1402.439) (-1402.301) (-1403.331) * [-1402.860] (-1402.633) (-1400.903) (-1402.892) -- 0:00:58 134500 -- [-1402.907] (-1403.089) (-1401.143) (-1401.259) * [-1402.636] (-1405.176) (-1400.903) (-1402.089) -- 0:00:57 135000 -- (-1404.432) (-1402.696) [-1401.526] (-1401.547) * [-1403.930] (-1403.329) (-1404.129) (-1404.546) -- 0:00:57 Average standard deviation of split frequencies: 0.024263 135500 -- (-1401.750) (-1402.819) (-1402.564) [-1401.202] * (-1402.127) [-1402.514] (-1405.353) (-1401.813) -- 0:00:57 136000 -- (-1402.452) (-1402.269) (-1401.918) [-1402.107] * (-1401.899) [-1404.561] (-1404.029) (-1404.123) -- 0:00:57 136500 -- [-1401.886] (-1404.425) (-1400.947) (-1401.386) * (-1403.177) (-1406.678) (-1407.411) [-1403.060] -- 0:00:56 137000 -- (-1403.625) [-1405.572] (-1401.615) (-1401.411) * [-1401.614] (-1409.920) (-1403.429) (-1404.925) -- 0:00:56 137500 -- (-1405.068) (-1402.330) [-1401.077] (-1402.075) * [-1402.645] (-1410.382) (-1402.228) (-1403.645) -- 0:00:56 138000 -- (-1405.513) [-1406.035] (-1403.428) (-1403.325) * (-1403.313) (-1404.269) [-1401.443] (-1402.379) -- 0:00:56 138500 -- (-1408.275) (-1404.608) [-1404.834] (-1402.976) * (-1401.283) [-1400.931] (-1403.003) (-1401.895) -- 0:00:55 139000 -- (-1402.241) [-1404.624] (-1402.331) (-1403.472) * (-1402.320) [-1403.105] (-1402.625) (-1403.611) -- 0:00:55 139500 -- (-1402.622) (-1402.627) [-1402.200] (-1403.712) * (-1401.840) (-1403.279) [-1403.435] (-1406.399) -- 0:00:55 140000 -- (-1402.877) (-1406.170) (-1406.350) [-1403.543] * [-1401.029] (-1401.803) (-1402.995) (-1403.436) -- 0:00:55 Average standard deviation of split frequencies: 0.024762 140500 -- (-1402.691) (-1404.609) [-1406.364] (-1406.109) * (-1401.961) (-1405.815) [-1401.570] (-1405.734) -- 0:00:55 141000 -- (-1403.426) [-1404.895] (-1406.497) (-1405.660) * (-1405.556) [-1402.069] (-1403.432) (-1402.693) -- 0:00:54 141500 -- [-1403.337] (-1404.422) (-1403.344) (-1408.088) * (-1402.657) (-1401.279) (-1401.459) [-1401.177] -- 0:00:54 142000 -- (-1405.818) [-1405.142] (-1402.971) (-1409.794) * (-1401.923) [-1401.899] (-1406.696) (-1403.111) -- 0:00:54 142500 -- (-1406.223) [-1402.676] (-1402.596) (-1402.727) * (-1401.536) (-1401.990) (-1402.335) [-1402.792] -- 0:00:54 143000 -- (-1402.076) (-1402.351) (-1401.772) [-1402.454] * (-1402.773) (-1402.982) (-1401.798) [-1401.533] -- 0:00:53 143500 -- (-1403.823) (-1403.162) [-1402.601] (-1403.747) * (-1401.848) (-1402.064) (-1402.173) [-1400.973] -- 0:00:53 144000 -- (-1404.512) (-1403.850) (-1403.400) [-1402.702] * (-1402.897) (-1402.454) (-1401.221) [-1402.423] -- 0:00:53 144500 -- (-1402.635) (-1401.564) [-1402.593] (-1402.264) * (-1402.519) [-1405.585] (-1401.098) (-1404.316) -- 0:00:53 145000 -- (-1402.871) [-1403.720] (-1404.068) (-1405.013) * [-1402.288] (-1404.238) (-1402.042) (-1405.096) -- 0:00:53 Average standard deviation of split frequencies: 0.021833 145500 -- (-1403.909) (-1403.970) [-1402.713] (-1402.141) * (-1402.814) (-1403.589) (-1405.569) [-1406.022] -- 0:00:52 146000 -- (-1404.302) [-1401.980] (-1404.009) (-1401.781) * [-1402.305] (-1404.446) (-1405.963) (-1403.098) -- 0:00:52 146500 -- (-1402.494) (-1403.195) (-1403.977) [-1401.807] * (-1401.691) (-1402.719) (-1402.345) [-1403.374] -- 0:00:52 147000 -- [-1402.544] (-1404.205) (-1402.649) (-1401.542) * (-1402.427) (-1403.529) [-1406.699] (-1403.090) -- 0:00:52 147500 -- [-1403.143] (-1408.240) (-1403.149) (-1402.333) * (-1403.461) [-1402.994] (-1404.625) (-1403.423) -- 0:00:52 148000 -- (-1403.827) (-1404.607) (-1406.952) [-1402.826] * (-1403.386) (-1401.960) (-1406.552) [-1404.228] -- 0:00:51 148500 -- (-1406.760) [-1405.279] (-1401.555) (-1402.780) * [-1402.273] (-1403.128) (-1412.056) (-1403.492) -- 0:00:51 149000 -- (-1401.803) (-1406.541) (-1402.146) [-1404.543] * (-1401.359) (-1402.223) [-1404.150] (-1403.365) -- 0:00:51 149500 -- (-1402.112) (-1404.828) [-1403.472] (-1403.772) * [-1402.575] (-1403.242) (-1403.266) (-1404.319) -- 0:00:51 150000 -- (-1401.853) (-1405.086) [-1402.897] (-1403.240) * [-1403.939] (-1403.268) (-1403.158) (-1403.110) -- 0:00:56 Average standard deviation of split frequencies: 0.021745 150500 -- (-1401.445) [-1405.375] (-1402.890) (-1404.025) * (-1403.238) (-1406.367) (-1403.070) [-1403.273] -- 0:00:56 151000 -- (-1403.442) (-1402.559) (-1401.767) [-1404.223] * (-1403.310) (-1402.964) [-1405.379] (-1403.284) -- 0:00:56 151500 -- (-1407.958) [-1401.214] (-1401.099) (-1402.449) * (-1404.448) (-1401.462) [-1408.357] (-1402.624) -- 0:00:56 152000 -- (-1402.875) (-1404.685) [-1402.020] (-1412.138) * (-1404.470) (-1403.588) [-1401.908] (-1403.010) -- 0:00:55 152500 -- (-1404.732) [-1403.291] (-1402.964) (-1406.366) * [-1403.021] (-1405.268) (-1401.699) (-1403.759) -- 0:00:55 153000 -- (-1404.000) [-1402.372] (-1403.536) (-1404.382) * [-1403.114] (-1408.088) (-1402.725) (-1402.791) -- 0:00:55 153500 -- (-1402.625) (-1408.741) [-1403.384] (-1408.038) * (-1401.379) [-1406.711] (-1403.936) (-1402.873) -- 0:00:55 154000 -- [-1403.008] (-1404.023) (-1401.115) (-1404.474) * (-1404.403) (-1406.675) [-1402.675] (-1402.539) -- 0:00:54 154500 -- (-1401.547) (-1406.279) [-1402.188] (-1406.811) * [-1404.201] (-1404.866) (-1404.311) (-1402.065) -- 0:00:54 155000 -- [-1402.625] (-1413.438) (-1403.526) (-1402.374) * [-1404.757] (-1403.676) (-1402.044) (-1402.606) -- 0:00:54 Average standard deviation of split frequencies: 0.021471 155500 -- (-1401.135) (-1408.444) (-1405.257) [-1401.217] * (-1405.196) (-1404.083) [-1401.199] (-1401.881) -- 0:00:54 156000 -- [-1401.140] (-1408.029) (-1405.293) (-1401.402) * (-1404.344) (-1403.033) [-1401.814] (-1401.782) -- 0:00:54 156500 -- (-1401.004) (-1409.977) [-1404.307] (-1404.645) * [-1405.140] (-1406.635) (-1401.730) (-1404.715) -- 0:00:53 157000 -- (-1401.670) (-1407.226) (-1403.551) [-1403.059] * [-1405.902] (-1405.098) (-1401.630) (-1402.025) -- 0:00:53 157500 -- [-1401.496] (-1406.127) (-1403.188) (-1402.789) * (-1404.667) [-1401.557] (-1404.414) (-1403.790) -- 0:00:53 158000 -- (-1401.082) [-1400.955] (-1403.737) (-1401.815) * (-1405.198) (-1405.384) (-1402.804) [-1401.632] -- 0:00:53 158500 -- [-1401.969] (-1402.351) (-1408.280) (-1400.888) * [-1402.990] (-1401.845) (-1403.003) (-1401.712) -- 0:00:53 159000 -- (-1401.882) (-1401.411) [-1401.543] (-1400.902) * (-1405.628) (-1403.603) (-1403.402) [-1402.697] -- 0:00:52 159500 -- (-1401.787) [-1401.545] (-1401.954) (-1402.766) * (-1403.317) (-1403.210) (-1401.210) [-1401.498] -- 0:00:52 160000 -- (-1402.228) (-1401.655) (-1402.676) [-1402.109] * (-1405.941) (-1403.098) [-1402.805] (-1402.528) -- 0:00:52 Average standard deviation of split frequencies: 0.019457 160500 -- (-1403.247) (-1402.534) (-1402.663) [-1405.280] * [-1402.360] (-1401.297) (-1401.608) (-1402.971) -- 0:00:52 161000 -- (-1404.640) (-1401.623) [-1403.973] (-1403.027) * (-1402.164) [-1407.211] (-1410.705) (-1404.506) -- 0:00:52 161500 -- (-1402.704) [-1400.593] (-1404.532) (-1404.595) * (-1403.744) (-1405.507) [-1401.920] (-1402.266) -- 0:00:51 162000 -- (-1402.063) [-1400.748] (-1405.657) (-1403.842) * (-1403.256) (-1405.811) [-1402.881] (-1402.227) -- 0:00:51 162500 -- [-1404.066] (-1402.188) (-1404.917) (-1402.351) * (-1405.533) [-1401.890] (-1402.092) (-1403.143) -- 0:00:51 163000 -- (-1409.613) (-1403.988) [-1409.352] (-1402.717) * (-1405.323) (-1401.882) [-1401.184] (-1403.143) -- 0:00:51 163500 -- (-1403.540) [-1403.824] (-1408.619) (-1404.464) * (-1403.870) (-1401.992) [-1402.400] (-1404.458) -- 0:00:51 164000 -- (-1404.367) (-1403.216) [-1402.847] (-1403.796) * (-1402.584) [-1402.882] (-1405.039) (-1403.864) -- 0:00:50 164500 -- (-1401.970) [-1403.143] (-1402.676) (-1405.257) * (-1403.248) [-1404.499] (-1404.413) (-1402.933) -- 0:00:50 165000 -- (-1402.300) [-1402.947] (-1404.490) (-1401.674) * (-1403.284) (-1403.542) [-1404.132] (-1401.680) -- 0:00:50 Average standard deviation of split frequencies: 0.019281 165500 -- (-1402.682) [-1403.312] (-1404.434) (-1402.563) * [-1403.264] (-1406.454) (-1404.177) (-1402.577) -- 0:00:55 166000 -- (-1402.561) (-1402.584) (-1404.451) [-1402.563] * (-1405.022) [-1402.654] (-1404.721) (-1404.377) -- 0:00:55 166500 -- (-1402.934) (-1403.032) [-1401.471] (-1402.674) * [-1400.988] (-1403.475) (-1403.028) (-1401.754) -- 0:00:55 167000 -- (-1403.651) (-1405.729) [-1403.989] (-1403.965) * (-1402.167) (-1402.428) [-1406.207] (-1403.222) -- 0:00:54 167500 -- [-1403.423] (-1402.344) (-1402.445) (-1401.144) * [-1401.791] (-1404.617) (-1402.493) (-1404.827) -- 0:00:54 168000 -- (-1405.050) [-1401.389] (-1402.854) (-1401.776) * (-1401.407) [-1404.823] (-1401.704) (-1401.974) -- 0:00:54 168500 -- (-1402.223) (-1401.099) (-1402.765) [-1401.740] * (-1402.898) (-1401.446) (-1403.659) [-1403.488] -- 0:00:54 169000 -- [-1401.856] (-1404.840) (-1403.281) (-1402.949) * (-1401.761) [-1404.626] (-1406.454) (-1402.902) -- 0:00:54 169500 -- (-1402.365) [-1405.043] (-1402.611) (-1402.290) * (-1404.906) (-1404.358) (-1407.276) [-1403.721] -- 0:00:53 170000 -- [-1401.863] (-1406.309) (-1402.676) (-1404.266) * (-1403.257) [-1403.466] (-1404.598) (-1403.640) -- 0:00:53 Average standard deviation of split frequencies: 0.018463 170500 -- (-1406.267) (-1404.031) (-1402.351) [-1402.011] * (-1402.120) (-1403.296) [-1402.823] (-1406.131) -- 0:00:53 171000 -- (-1403.858) (-1406.949) [-1402.550] (-1402.371) * (-1401.875) (-1404.151) [-1409.975] (-1401.581) -- 0:00:53 171500 -- [-1403.857] (-1403.186) (-1403.626) (-1401.041) * (-1401.730) (-1402.337) (-1404.221) [-1403.076] -- 0:00:53 172000 -- (-1404.618) [-1405.717] (-1402.357) (-1401.608) * (-1402.483) [-1402.187] (-1401.116) (-1403.021) -- 0:00:52 172500 -- [-1406.982] (-1406.191) (-1402.105) (-1402.229) * (-1404.477) (-1405.824) (-1402.296) [-1402.272] -- 0:00:52 173000 -- (-1404.203) [-1406.152] (-1402.686) (-1401.819) * (-1405.804) [-1405.916] (-1405.936) (-1402.105) -- 0:00:52 173500 -- [-1401.413] (-1405.268) (-1400.782) (-1401.857) * [-1401.297] (-1403.229) (-1405.134) (-1404.959) -- 0:00:52 174000 -- (-1404.929) (-1402.507) [-1401.368] (-1403.008) * (-1401.408) [-1401.528] (-1402.212) (-1402.354) -- 0:00:52 174500 -- (-1407.448) [-1403.506] (-1402.192) (-1404.856) * [-1403.354] (-1401.493) (-1402.693) (-1402.960) -- 0:00:52 175000 -- (-1407.785) (-1404.060) (-1402.514) [-1401.537] * (-1402.971) (-1401.392) (-1403.970) [-1402.483] -- 0:00:51 Average standard deviation of split frequencies: 0.020832 175500 -- (-1404.812) [-1403.128] (-1403.700) (-1404.728) * [-1402.644] (-1402.654) (-1403.181) (-1402.482) -- 0:00:51 176000 -- [-1403.888] (-1403.139) (-1402.945) (-1400.957) * [-1404.810] (-1402.070) (-1401.538) (-1403.488) -- 0:00:51 176500 -- (-1403.253) (-1402.273) (-1406.783) [-1404.868] * [-1401.837] (-1401.055) (-1404.608) (-1402.132) -- 0:00:51 177000 -- (-1407.680) (-1404.101) [-1404.871] (-1403.798) * [-1401.413] (-1403.079) (-1404.385) (-1402.267) -- 0:00:51 177500 -- [-1405.363] (-1402.744) (-1405.405) (-1402.404) * (-1406.347) (-1403.057) (-1404.733) [-1402.277] -- 0:00:50 178000 -- (-1404.432) (-1402.909) [-1402.743] (-1402.262) * (-1408.226) [-1404.020] (-1403.475) (-1403.332) -- 0:00:50 178500 -- (-1403.875) (-1402.028) [-1403.080] (-1403.459) * (-1407.085) (-1402.033) [-1403.681] (-1403.201) -- 0:00:50 179000 -- (-1407.257) (-1401.033) (-1403.987) [-1404.170] * (-1404.024) (-1404.765) [-1401.788] (-1400.928) -- 0:00:50 179500 -- (-1406.059) [-1403.011] (-1403.251) (-1404.055) * (-1402.814) (-1403.954) [-1401.637] (-1400.903) -- 0:00:50 180000 -- (-1406.415) [-1402.457] (-1402.400) (-1403.861) * (-1407.385) (-1403.538) (-1402.810) [-1401.434] -- 0:00:50 Average standard deviation of split frequencies: 0.022869 180500 -- [-1401.428] (-1402.096) (-1403.766) (-1401.573) * (-1411.015) [-1402.051] (-1402.581) (-1401.932) -- 0:00:49 181000 -- (-1403.685) (-1401.680) [-1404.156] (-1405.520) * (-1402.852) (-1402.410) [-1405.999] (-1401.640) -- 0:00:49 181500 -- (-1403.217) [-1401.099] (-1409.119) (-1406.117) * (-1404.824) (-1402.493) [-1402.481] (-1402.351) -- 0:00:54 182000 -- [-1405.942] (-1401.574) (-1405.572) (-1404.509) * [-1402.399] (-1404.703) (-1404.139) (-1401.538) -- 0:00:53 182500 -- (-1405.894) [-1401.127] (-1407.189) (-1406.047) * [-1402.237] (-1405.317) (-1401.340) (-1402.873) -- 0:00:53 183000 -- (-1402.797) (-1403.423) [-1404.079] (-1403.904) * (-1405.541) (-1404.735) (-1401.558) [-1402.682] -- 0:00:53 183500 -- (-1404.714) [-1402.757] (-1402.861) (-1401.659) * (-1404.728) (-1405.049) (-1403.340) [-1403.309] -- 0:00:53 184000 -- (-1403.097) (-1402.132) (-1403.942) [-1400.810] * [-1401.544] (-1411.501) (-1405.468) (-1401.079) -- 0:00:53 184500 -- [-1404.271] (-1402.380) (-1403.697) (-1403.074) * (-1404.493) [-1406.347] (-1404.040) (-1402.069) -- 0:00:53 185000 -- (-1404.233) [-1403.410] (-1404.874) (-1401.884) * (-1402.979) [-1404.323] (-1408.280) (-1404.538) -- 0:00:52 Average standard deviation of split frequencies: 0.021120 185500 -- (-1403.852) [-1401.832] (-1403.618) (-1403.072) * [-1402.667] (-1404.827) (-1405.016) (-1402.079) -- 0:00:52 186000 -- (-1406.516) [-1401.765] (-1403.228) (-1404.060) * (-1403.141) (-1405.181) [-1402.655] (-1409.629) -- 0:00:52 186500 -- (-1402.666) (-1403.152) [-1402.258] (-1402.542) * (-1403.642) [-1403.565] (-1407.034) (-1405.498) -- 0:00:52 187000 -- (-1404.443) (-1402.501) [-1404.612] (-1401.875) * (-1403.828) (-1404.411) [-1401.357] (-1404.978) -- 0:00:52 187500 -- (-1402.416) (-1401.382) (-1405.167) [-1400.938] * (-1404.761) (-1401.694) [-1403.963] (-1406.933) -- 0:00:52 188000 -- (-1402.831) (-1403.461) [-1404.313] (-1401.093) * (-1403.346) [-1401.826] (-1405.742) (-1402.508) -- 0:00:51 188500 -- (-1404.971) [-1402.789] (-1403.477) (-1400.676) * [-1403.838] (-1401.390) (-1404.288) (-1402.531) -- 0:00:51 189000 -- [-1403.138] (-1402.194) (-1406.076) (-1403.043) * (-1404.267) (-1401.700) [-1401.924] (-1402.875) -- 0:00:51 189500 -- (-1403.922) (-1401.860) [-1404.870] (-1402.704) * (-1405.022) (-1402.500) (-1403.254) [-1402.275] -- 0:00:51 190000 -- (-1403.030) (-1402.548) [-1409.922] (-1401.686) * (-1406.436) [-1401.235] (-1402.559) (-1402.094) -- 0:00:51 Average standard deviation of split frequencies: 0.019092 190500 -- [-1401.551] (-1405.921) (-1404.649) (-1408.466) * (-1407.722) (-1402.878) (-1401.799) [-1404.639] -- 0:00:50 191000 -- (-1404.231) (-1404.629) (-1405.808) [-1408.934] * [-1404.254] (-1402.721) (-1402.888) (-1401.235) -- 0:00:50 191500 -- (-1404.291) (-1404.667) (-1407.771) [-1402.452] * [-1401.161] (-1403.192) (-1400.624) (-1401.043) -- 0:00:50 192000 -- (-1401.234) (-1405.629) (-1403.993) [-1402.299] * (-1400.966) (-1401.281) (-1400.550) [-1400.873] -- 0:00:50 192500 -- (-1401.637) [-1405.696] (-1404.163) (-1405.700) * (-1400.955) [-1402.024] (-1401.283) (-1401.544) -- 0:00:50 193000 -- [-1401.112] (-1409.713) (-1405.095) (-1402.325) * (-1400.966) (-1401.927) [-1401.977] (-1404.400) -- 0:00:50 193500 -- [-1400.673] (-1401.342) (-1402.969) (-1402.409) * (-1400.976) (-1401.941) [-1404.113] (-1404.049) -- 0:00:50 194000 -- (-1401.434) (-1403.594) (-1402.773) [-1405.273] * (-1401.697) (-1403.785) (-1402.696) [-1404.075] -- 0:00:49 194500 -- (-1401.381) (-1401.724) [-1402.436] (-1405.210) * (-1402.227) (-1406.359) (-1402.427) [-1404.036] -- 0:00:49 195000 -- (-1401.267) (-1402.920) [-1404.477] (-1402.022) * (-1403.940) [-1401.762] (-1403.457) (-1407.213) -- 0:00:49 Average standard deviation of split frequencies: 0.018840 195500 -- [-1402.462] (-1404.211) (-1404.668) (-1401.693) * (-1403.297) (-1402.263) (-1403.735) [-1402.221] -- 0:00:49 196000 -- (-1402.533) (-1408.022) (-1402.214) [-1401.919] * (-1404.714) (-1405.002) (-1403.684) [-1401.064] -- 0:00:49 196500 -- (-1400.777) (-1406.598) [-1402.198] (-1402.551) * (-1404.582) [-1401.625] (-1405.382) (-1404.332) -- 0:00:49 197000 -- (-1402.961) [-1403.277] (-1403.787) (-1402.864) * (-1403.950) [-1404.093] (-1405.294) (-1401.592) -- 0:00:52 197500 -- (-1405.959) [-1403.009] (-1403.890) (-1405.817) * [-1402.832] (-1401.784) (-1400.997) (-1401.777) -- 0:00:52 198000 -- [-1401.906] (-1406.224) (-1404.900) (-1401.785) * [-1402.018] (-1402.746) (-1401.968) (-1401.050) -- 0:00:52 198500 -- (-1401.906) (-1403.741) (-1404.712) [-1405.131] * (-1401.439) (-1403.343) (-1401.817) [-1401.407] -- 0:00:52 199000 -- (-1401.496) [-1402.106] (-1402.428) (-1407.122) * [-1401.486] (-1401.993) (-1401.568) (-1401.376) -- 0:00:52 199500 -- (-1402.007) [-1406.745] (-1403.696) (-1402.349) * (-1404.422) [-1401.429] (-1401.171) (-1402.209) -- 0:00:52 200000 -- (-1403.109) [-1401.164] (-1405.042) (-1402.510) * (-1408.833) (-1403.128) [-1401.511] (-1402.304) -- 0:00:51 Average standard deviation of split frequencies: 0.018924 200500 -- [-1404.765] (-1402.388) (-1401.537) (-1402.943) * (-1402.926) (-1402.389) [-1402.895] (-1403.250) -- 0:00:51 201000 -- (-1403.611) [-1402.391] (-1401.623) (-1402.553) * (-1404.462) (-1401.733) [-1401.638] (-1402.759) -- 0:00:51 201500 -- (-1403.620) (-1402.813) (-1401.498) [-1402.640] * (-1402.388) (-1402.404) (-1401.398) [-1402.224] -- 0:00:51 202000 -- [-1403.615] (-1403.683) (-1406.394) (-1402.113) * (-1402.388) (-1402.874) [-1402.377] (-1405.079) -- 0:00:51 202500 -- (-1403.612) [-1400.990] (-1403.809) (-1402.141) * (-1409.156) (-1402.110) [-1402.668] (-1402.649) -- 0:00:51 203000 -- [-1405.887] (-1404.729) (-1403.207) (-1401.526) * (-1407.997) [-1403.269] (-1403.880) (-1403.260) -- 0:00:51 203500 -- (-1408.863) [-1406.608] (-1403.300) (-1401.537) * [-1404.908] (-1403.181) (-1403.324) (-1402.676) -- 0:00:50 204000 -- (-1406.780) (-1407.411) (-1403.170) [-1402.846] * (-1404.927) (-1402.659) [-1403.324] (-1404.340) -- 0:00:50 204500 -- (-1403.612) (-1406.082) [-1401.734] (-1403.145) * (-1409.213) (-1404.362) (-1402.942) [-1401.462] -- 0:00:50 205000 -- (-1403.983) (-1406.067) [-1405.456] (-1403.444) * [-1404.492] (-1403.180) (-1401.158) (-1402.784) -- 0:00:50 Average standard deviation of split frequencies: 0.017036 205500 -- (-1401.583) [-1404.577] (-1404.462) (-1402.960) * (-1401.649) (-1403.132) [-1401.158] (-1403.533) -- 0:00:50 206000 -- [-1401.572] (-1401.307) (-1403.945) (-1405.872) * (-1406.220) (-1403.424) [-1403.884] (-1405.314) -- 0:00:50 206500 -- (-1405.760) (-1404.415) [-1403.033] (-1402.641) * [-1401.707] (-1404.033) (-1404.388) (-1401.813) -- 0:00:49 207000 -- [-1406.023] (-1403.845) (-1403.299) (-1401.476) * (-1401.522) [-1405.265] (-1403.800) (-1404.423) -- 0:00:49 207500 -- [-1403.098] (-1401.762) (-1407.386) (-1404.717) * (-1403.157) [-1405.035] (-1402.912) (-1402.544) -- 0:00:49 208000 -- [-1401.696] (-1402.437) (-1403.524) (-1404.517) * (-1402.331) [-1404.229] (-1403.524) (-1405.229) -- 0:00:49 208500 -- (-1405.649) (-1402.436) [-1405.896] (-1402.269) * (-1402.758) (-1401.892) [-1403.127] (-1404.128) -- 0:00:49 209000 -- (-1404.605) (-1402.689) [-1404.571] (-1405.948) * [-1403.223] (-1402.028) (-1403.316) (-1405.694) -- 0:00:49 209500 -- (-1403.169) [-1404.799] (-1404.660) (-1404.607) * (-1405.503) (-1402.377) (-1402.370) [-1404.531] -- 0:00:49 210000 -- (-1401.716) [-1403.562] (-1403.721) (-1405.615) * [-1402.438] (-1402.939) (-1405.336) (-1404.442) -- 0:00:48 Average standard deviation of split frequencies: 0.015664 210500 -- (-1404.386) [-1402.376] (-1403.813) (-1402.579) * (-1403.386) (-1402.328) (-1403.681) [-1403.572] -- 0:00:48 211000 -- (-1401.802) [-1403.809] (-1406.247) (-1405.846) * [-1403.578] (-1402.753) (-1401.851) (-1405.555) -- 0:00:48 211500 -- [-1403.225] (-1403.234) (-1402.146) (-1405.230) * (-1402.961) (-1401.649) (-1401.976) [-1407.276] -- 0:00:48 212000 -- (-1403.303) (-1401.722) [-1401.437] (-1407.012) * (-1403.573) [-1404.675] (-1402.040) (-1403.154) -- 0:00:48 212500 -- (-1402.292) (-1403.102) [-1402.136] (-1402.831) * [-1403.572] (-1402.933) (-1402.043) (-1404.712) -- 0:00:48 213000 -- [-1401.377] (-1404.300) (-1401.970) (-1405.273) * (-1405.321) [-1401.145] (-1406.186) (-1405.071) -- 0:00:51 213500 -- (-1402.934) (-1401.655) [-1402.670] (-1406.483) * (-1406.011) (-1401.147) (-1405.825) [-1405.729] -- 0:00:51 214000 -- (-1407.606) (-1401.593) [-1404.626] (-1405.007) * (-1403.351) (-1401.003) [-1401.300] (-1404.498) -- 0:00:51 214500 -- (-1403.403) (-1403.408) [-1406.513] (-1402.254) * (-1403.184) [-1401.139] (-1402.133) (-1407.372) -- 0:00:51 215000 -- (-1402.490) (-1404.534) (-1405.956) [-1402.841] * (-1403.316) (-1401.175) (-1402.483) [-1403.384] -- 0:00:51 Average standard deviation of split frequencies: 0.014186 215500 -- (-1401.993) [-1403.139] (-1404.903) (-1403.850) * (-1403.209) (-1402.247) [-1401.745] (-1403.149) -- 0:00:50 216000 -- (-1401.865) (-1401.779) (-1404.644) [-1402.440] * (-1403.708) (-1402.389) (-1404.922) [-1403.275] -- 0:00:50 216500 -- (-1401.692) [-1401.167] (-1404.637) (-1403.646) * (-1404.078) [-1401.461] (-1405.167) (-1403.946) -- 0:00:50 217000 -- (-1401.040) (-1401.167) [-1406.049] (-1403.350) * [-1402.543] (-1401.460) (-1405.966) (-1405.592) -- 0:00:50 217500 -- (-1402.796) [-1402.055] (-1402.448) (-1403.507) * (-1402.502) (-1401.000) [-1405.317] (-1405.671) -- 0:00:50 218000 -- [-1402.737] (-1404.065) (-1402.186) (-1403.073) * [-1403.385] (-1405.825) (-1404.714) (-1407.823) -- 0:00:50 218500 -- [-1402.000] (-1404.893) (-1407.075) (-1403.427) * (-1403.241) (-1404.966) [-1404.956] (-1402.763) -- 0:00:50 219000 -- (-1401.996) (-1403.625) (-1404.750) [-1403.120] * (-1404.109) [-1402.572] (-1403.267) (-1402.762) -- 0:00:49 219500 -- (-1402.311) [-1403.456] (-1402.230) (-1403.031) * (-1403.711) [-1402.587] (-1402.108) (-1402.410) -- 0:00:49 220000 -- [-1401.982] (-1402.437) (-1402.760) (-1401.693) * (-1403.777) (-1403.805) (-1401.045) [-1403.033] -- 0:00:49 Average standard deviation of split frequencies: 0.013069 220500 -- [-1405.378] (-1403.005) (-1402.600) (-1402.559) * (-1405.808) [-1404.528] (-1401.084) (-1403.199) -- 0:00:49 221000 -- (-1402.622) (-1403.654) (-1405.015) [-1402.129] * (-1401.672) [-1406.251] (-1404.781) (-1402.015) -- 0:00:49 221500 -- (-1405.967) [-1403.959] (-1402.362) (-1405.509) * (-1401.747) (-1401.515) (-1404.781) [-1403.373] -- 0:00:49 222000 -- (-1408.069) (-1402.178) (-1402.563) [-1403.129] * (-1401.027) (-1402.133) (-1404.679) [-1402.455] -- 0:00:49 222500 -- [-1403.957] (-1403.443) (-1402.630) (-1404.194) * (-1408.883) (-1402.175) (-1407.809) [-1402.477] -- 0:00:48 223000 -- [-1403.439] (-1404.566) (-1404.333) (-1403.045) * [-1403.668] (-1405.746) (-1407.080) (-1401.623) -- 0:00:48 223500 -- [-1402.225] (-1402.149) (-1403.058) (-1404.268) * (-1400.655) [-1403.547] (-1403.677) (-1401.369) -- 0:00:48 224000 -- [-1402.233] (-1403.363) (-1401.661) (-1406.926) * (-1402.682) (-1402.093) [-1401.690] (-1402.483) -- 0:00:48 224500 -- [-1402.544] (-1404.642) (-1401.900) (-1403.492) * (-1402.225) (-1405.783) (-1401.383) [-1402.474] -- 0:00:48 225000 -- (-1401.811) (-1404.626) [-1402.023] (-1406.518) * (-1402.159) [-1404.447] (-1402.857) (-1402.198) -- 0:00:48 Average standard deviation of split frequencies: 0.013251 225500 -- [-1400.793] (-1407.725) (-1402.273) (-1401.991) * [-1404.643] (-1404.536) (-1403.335) (-1402.173) -- 0:00:48 226000 -- [-1405.794] (-1405.704) (-1402.582) (-1403.394) * (-1404.019) [-1401.651] (-1404.499) (-1402.177) -- 0:00:47 226500 -- (-1402.283) (-1405.924) (-1403.491) [-1404.219] * (-1404.860) (-1401.436) [-1400.930] (-1404.637) -- 0:00:47 227000 -- [-1401.774] (-1402.356) (-1403.161) (-1407.006) * [-1402.075] (-1402.345) (-1401.199) (-1402.514) -- 0:00:47 227500 -- [-1402.721] (-1400.658) (-1402.491) (-1402.319) * (-1407.928) (-1408.310) (-1403.066) [-1402.192] -- 0:00:47 228000 -- [-1403.040] (-1402.605) (-1401.955) (-1403.042) * (-1403.437) (-1408.774) [-1402.497] (-1401.948) -- 0:00:47 228500 -- (-1402.061) [-1401.763] (-1401.895) (-1402.640) * (-1402.924) [-1402.320] (-1402.374) (-1400.774) -- 0:00:47 229000 -- (-1404.362) (-1403.332) [-1401.557] (-1402.800) * (-1402.603) (-1406.379) [-1401.959] (-1400.915) -- 0:00:50 229500 -- (-1403.664) (-1404.984) (-1405.577) [-1402.740] * [-1402.002] (-1406.662) (-1403.898) (-1404.134) -- 0:00:50 230000 -- [-1403.266] (-1407.341) (-1404.581) (-1401.271) * (-1401.984) (-1401.638) (-1401.575) [-1401.122] -- 0:00:50 Average standard deviation of split frequencies: 0.011921 230500 -- (-1402.976) (-1403.110) [-1402.475] (-1403.213) * [-1402.490] (-1402.629) (-1403.976) (-1404.919) -- 0:00:50 231000 -- [-1401.633] (-1402.228) (-1401.914) (-1405.398) * (-1408.419) (-1403.085) (-1403.050) [-1401.823] -- 0:00:49 231500 -- [-1402.214] (-1402.871) (-1405.823) (-1405.865) * (-1408.227) (-1404.759) [-1403.161] (-1401.175) -- 0:00:49 232000 -- (-1401.416) (-1402.528) [-1402.558] (-1404.130) * (-1408.882) (-1402.255) (-1407.516) [-1403.424] -- 0:00:49 232500 -- [-1403.202] (-1402.334) (-1406.010) (-1403.586) * (-1402.827) [-1403.134] (-1403.478) (-1401.432) -- 0:00:49 233000 -- [-1402.621] (-1404.495) (-1402.980) (-1405.804) * (-1403.406) (-1403.134) (-1405.577) [-1401.307] -- 0:00:49 233500 -- (-1403.102) [-1402.971] (-1402.837) (-1405.757) * (-1403.024) (-1401.759) (-1403.367) [-1404.541] -- 0:00:49 234000 -- [-1401.730] (-1403.625) (-1404.234) (-1403.251) * (-1403.335) (-1403.945) (-1408.266) [-1400.777] -- 0:00:49 234500 -- (-1402.347) (-1402.994) [-1407.356] (-1402.703) * (-1403.975) (-1405.083) (-1402.552) [-1404.624] -- 0:00:48 235000 -- (-1403.722) (-1401.781) [-1404.254] (-1402.772) * [-1403.622] (-1403.152) (-1403.509) (-1404.339) -- 0:00:48 Average standard deviation of split frequencies: 0.011669 235500 -- (-1402.584) (-1400.688) (-1402.232) [-1402.833] * (-1409.795) [-1402.893] (-1402.007) (-1406.883) -- 0:00:48 236000 -- (-1401.304) (-1404.165) [-1402.790] (-1402.538) * (-1403.695) [-1414.239] (-1403.247) (-1404.957) -- 0:00:48 236500 -- (-1401.913) (-1404.928) (-1402.102) [-1401.287] * [-1401.617] (-1402.386) (-1402.871) (-1403.454) -- 0:00:48 237000 -- [-1401.925] (-1401.793) (-1401.682) (-1401.810) * (-1403.643) (-1400.832) [-1401.926] (-1403.445) -- 0:00:48 237500 -- (-1406.121) [-1401.768] (-1402.054) (-1402.810) * (-1403.037) [-1401.214] (-1401.679) (-1404.332) -- 0:00:48 238000 -- (-1404.035) [-1404.422] (-1401.905) (-1402.409) * (-1402.327) [-1401.381] (-1403.930) (-1403.296) -- 0:00:48 238500 -- (-1403.171) (-1404.784) [-1404.795] (-1403.193) * (-1404.293) [-1405.091] (-1402.934) (-1401.684) -- 0:00:47 239000 -- (-1403.890) [-1402.699] (-1405.686) (-1402.598) * (-1405.732) (-1403.600) [-1402.713] (-1402.057) -- 0:00:47 239500 -- (-1404.530) (-1403.265) [-1402.782] (-1404.447) * [-1408.748] (-1403.204) (-1402.304) (-1402.486) -- 0:00:47 240000 -- [-1404.039] (-1403.738) (-1401.759) (-1402.932) * (-1401.513) (-1401.848) [-1402.975] (-1404.090) -- 0:00:47 Average standard deviation of split frequencies: 0.011970 240500 -- (-1408.949) (-1405.358) (-1401.679) [-1402.370] * (-1402.696) (-1401.970) [-1400.958] (-1404.023) -- 0:00:47 241000 -- (-1406.107) (-1403.053) [-1401.696] (-1402.241) * (-1404.589) (-1402.527) (-1401.437) [-1403.752] -- 0:00:47 241500 -- (-1405.034) [-1403.099] (-1406.940) (-1403.930) * (-1405.481) [-1401.310] (-1401.539) (-1404.390) -- 0:00:47 242000 -- [-1410.113] (-1403.342) (-1406.346) (-1403.984) * (-1407.476) (-1401.314) [-1402.368] (-1402.187) -- 0:00:46 242500 -- [-1401.860] (-1404.184) (-1405.437) (-1404.806) * (-1406.573) (-1401.351) [-1401.576] (-1402.601) -- 0:00:46 243000 -- [-1402.814] (-1405.294) (-1405.598) (-1402.313) * [-1402.715] (-1401.368) (-1402.063) (-1402.063) -- 0:00:46 243500 -- (-1402.917) [-1402.253] (-1404.387) (-1401.163) * (-1402.756) (-1403.481) [-1402.054] (-1402.341) -- 0:00:46 244000 -- [-1403.909] (-1405.000) (-1401.925) (-1402.695) * (-1403.112) (-1401.621) [-1403.336] (-1401.906) -- 0:00:46 244500 -- (-1405.118) (-1408.866) (-1402.051) [-1409.725] * (-1404.519) (-1401.355) (-1405.797) [-1402.115] -- 0:00:49 245000 -- (-1405.724) [-1402.982] (-1403.914) (-1405.770) * (-1401.700) (-1401.018) [-1405.967] (-1402.075) -- 0:00:49 Average standard deviation of split frequencies: 0.011285 245500 -- (-1404.355) (-1403.552) (-1408.798) [-1404.584] * (-1401.765) [-1400.947] (-1405.038) (-1405.260) -- 0:00:49 246000 -- [-1404.695] (-1401.756) (-1403.662) (-1404.268) * (-1400.960) (-1403.448) [-1402.450] (-1403.219) -- 0:00:49 246500 -- (-1405.199) [-1401.205] (-1403.614) (-1402.406) * (-1402.176) [-1403.500] (-1403.170) (-1402.106) -- 0:00:48 247000 -- (-1401.938) [-1402.033] (-1403.418) (-1400.920) * (-1404.181) (-1404.711) [-1402.649] (-1401.399) -- 0:00:48 247500 -- (-1401.911) [-1401.530] (-1402.302) (-1402.294) * (-1404.459) (-1408.174) [-1401.651] (-1403.755) -- 0:00:48 248000 -- (-1401.163) [-1402.286] (-1401.071) (-1407.175) * (-1402.423) (-1406.276) (-1406.183) [-1403.637] -- 0:00:48 248500 -- (-1402.748) (-1402.359) [-1401.071] (-1403.978) * (-1402.426) (-1408.276) (-1402.341) [-1405.314] -- 0:00:48 249000 -- [-1403.455] (-1402.994) (-1404.044) (-1405.015) * [-1402.426] (-1407.193) (-1400.843) (-1404.645) -- 0:00:48 249500 -- [-1403.951] (-1403.538) (-1407.546) (-1404.190) * (-1403.931) (-1404.174) [-1401.580] (-1405.270) -- 0:00:48 250000 -- (-1403.543) [-1401.747] (-1405.310) (-1407.289) * (-1403.208) (-1407.414) [-1402.622] (-1405.025) -- 0:00:48 Average standard deviation of split frequencies: 0.012224 250500 -- (-1403.951) [-1402.190] (-1404.194) (-1407.746) * (-1408.134) [-1404.782] (-1401.116) (-1402.466) -- 0:00:47 251000 -- (-1403.776) (-1402.146) [-1406.537] (-1403.078) * (-1402.755) (-1404.899) (-1401.851) [-1402.377] -- 0:00:47 251500 -- (-1402.763) [-1401.779] (-1404.470) (-1402.172) * [-1402.626] (-1402.654) (-1402.588) (-1402.517) -- 0:00:47 252000 -- (-1401.290) (-1401.360) (-1404.209) [-1402.482] * (-1402.529) (-1401.257) [-1402.652] (-1401.320) -- 0:00:47 252500 -- (-1402.445) (-1401.398) (-1402.046) [-1402.508] * [-1403.824] (-1403.272) (-1402.991) (-1403.153) -- 0:00:47 253000 -- (-1400.959) [-1401.879] (-1402.057) (-1405.621) * (-1403.076) (-1401.990) (-1402.798) [-1404.191] -- 0:00:47 253500 -- (-1401.437) [-1404.191] (-1402.992) (-1402.393) * [-1402.291] (-1402.104) (-1402.573) (-1406.523) -- 0:00:47 254000 -- (-1404.182) (-1403.126) (-1402.890) [-1402.864] * (-1402.755) (-1400.726) [-1401.523] (-1405.089) -- 0:00:46 254500 -- (-1410.551) (-1402.250) (-1402.890) [-1401.852] * (-1404.287) (-1401.098) (-1401.438) [-1403.616] -- 0:00:46 255000 -- (-1407.819) (-1403.592) [-1402.216] (-1402.147) * (-1403.472) (-1400.777) (-1400.939) [-1402.254] -- 0:00:46 Average standard deviation of split frequencies: 0.012788 255500 -- [-1404.383] (-1401.836) (-1401.145) (-1401.498) * (-1403.957) (-1400.777) [-1402.438] (-1402.132) -- 0:00:46 256000 -- (-1404.813) (-1402.177) (-1402.295) [-1401.938] * [-1402.570] (-1400.843) (-1403.187) (-1402.801) -- 0:00:46 256500 -- (-1404.159) [-1404.432] (-1402.064) (-1402.545) * (-1402.415) [-1401.986] (-1401.498) (-1403.094) -- 0:00:46 257000 -- (-1404.794) (-1403.116) (-1402.075) [-1403.345] * (-1403.663) (-1402.539) (-1402.474) [-1402.328] -- 0:00:46 257500 -- (-1405.339) (-1405.298) (-1404.580) [-1403.232] * (-1406.512) (-1404.741) (-1400.668) [-1402.526] -- 0:00:46 258000 -- [-1402.342] (-1402.148) (-1407.287) (-1406.099) * [-1407.026] (-1402.212) (-1401.665) (-1402.912) -- 0:00:46 258500 -- (-1406.226) (-1401.665) (-1402.941) [-1402.267] * (-1401.942) [-1402.261] (-1401.390) (-1402.056) -- 0:00:45 259000 -- [-1407.080] (-1402.037) (-1402.883) (-1405.570) * (-1407.195) [-1407.111] (-1401.173) (-1401.507) -- 0:00:45 259500 -- (-1405.302) [-1401.241] (-1403.911) (-1403.877) * (-1407.244) (-1404.694) (-1401.182) [-1400.677] -- 0:00:45 260000 -- [-1404.115] (-1402.494) (-1402.444) (-1403.801) * [-1404.919] (-1403.627) (-1401.006) (-1406.718) -- 0:00:45 Average standard deviation of split frequencies: 0.012659 260500 -- [-1404.654] (-1402.695) (-1403.387) (-1400.998) * (-1406.512) (-1402.048) [-1401.615] (-1400.908) -- 0:00:48 261000 -- (-1405.819) [-1402.752] (-1402.745) (-1401.853) * (-1410.863) [-1402.735] (-1402.035) (-1402.455) -- 0:00:48 261500 -- (-1405.656) (-1403.088) (-1403.133) [-1401.923] * (-1402.811) (-1401.734) [-1401.908] (-1401.243) -- 0:00:48 262000 -- (-1405.356) (-1402.920) (-1408.036) [-1402.121] * (-1403.292) [-1401.635] (-1401.734) (-1402.263) -- 0:00:47 262500 -- (-1402.480) (-1407.906) (-1403.706) [-1403.256] * (-1402.174) (-1403.324) [-1402.375] (-1402.169) -- 0:00:47 263000 -- (-1404.351) (-1405.770) [-1401.959] (-1401.720) * (-1403.172) (-1404.189) (-1401.912) [-1403.658] -- 0:00:47 263500 -- (-1401.483) [-1404.000] (-1401.639) (-1401.948) * (-1402.986) [-1405.201] (-1402.898) (-1402.378) -- 0:00:47 264000 -- (-1403.833) (-1403.535) [-1402.931] (-1402.798) * [-1402.484] (-1402.117) (-1404.213) (-1402.236) -- 0:00:47 264500 -- (-1405.119) (-1402.429) [-1402.689] (-1406.451) * (-1401.427) (-1401.814) [-1402.254] (-1404.500) -- 0:00:47 265000 -- [-1402.167] (-1401.978) (-1403.025) (-1403.629) * (-1401.212) (-1405.076) [-1402.477] (-1405.250) -- 0:00:47 Average standard deviation of split frequencies: 0.012307 265500 -- [-1411.746] (-1401.796) (-1404.534) (-1402.306) * (-1403.210) [-1402.290] (-1403.486) (-1406.099) -- 0:00:47 266000 -- (-1405.900) (-1404.105) [-1403.554] (-1403.770) * (-1402.376) (-1402.204) (-1402.336) [-1407.481] -- 0:00:46 266500 -- (-1402.462) [-1406.786] (-1401.302) (-1403.254) * (-1401.185) [-1404.199] (-1403.117) (-1402.124) -- 0:00:46 267000 -- (-1401.721) (-1405.729) [-1402.622] (-1403.285) * (-1404.164) [-1402.896] (-1403.895) (-1402.592) -- 0:00:46 267500 -- (-1401.830) [-1406.967] (-1405.009) (-1403.194) * [-1404.634] (-1406.727) (-1403.710) (-1401.730) -- 0:00:46 268000 -- (-1403.419) [-1401.384] (-1402.703) (-1402.814) * (-1405.367) (-1406.131) (-1401.411) [-1403.468] -- 0:00:46 268500 -- [-1401.999] (-1401.253) (-1402.309) (-1401.834) * (-1407.898) (-1408.422) (-1401.714) [-1401.056] -- 0:00:46 269000 -- (-1403.273) (-1401.765) (-1406.556) [-1401.490] * (-1404.186) (-1406.258) (-1402.255) [-1401.615] -- 0:00:46 269500 -- (-1401.869) [-1402.495] (-1405.108) (-1400.948) * [-1402.998] (-1407.942) (-1402.833) (-1400.706) -- 0:00:46 270000 -- [-1401.301] (-1402.743) (-1406.977) (-1401.230) * (-1405.486) (-1403.417) [-1403.489] (-1403.518) -- 0:00:45 Average standard deviation of split frequencies: 0.013353 270500 -- (-1404.558) (-1402.862) (-1404.889) [-1402.595] * [-1404.225] (-1401.785) (-1402.509) (-1404.128) -- 0:00:45 271000 -- (-1405.242) (-1403.936) (-1402.328) [-1401.572] * (-1400.781) (-1404.168) (-1401.832) [-1404.283] -- 0:00:45 271500 -- (-1405.425) [-1403.039] (-1403.445) (-1401.560) * [-1402.767] (-1402.230) (-1403.252) (-1405.273) -- 0:00:45 272000 -- [-1402.910] (-1409.043) (-1404.968) (-1402.856) * [-1402.509] (-1404.533) (-1402.868) (-1401.459) -- 0:00:45 272500 -- (-1404.492) (-1409.933) (-1403.724) [-1401.979] * [-1403.345] (-1405.348) (-1406.701) (-1404.460) -- 0:00:45 273000 -- [-1407.243] (-1404.069) (-1406.390) (-1405.783) * [-1406.823] (-1403.015) (-1407.412) (-1405.277) -- 0:00:45 273500 -- (-1404.701) (-1403.303) (-1402.245) [-1402.610] * (-1403.970) [-1402.415] (-1407.213) (-1402.578) -- 0:00:45 274000 -- (-1403.321) (-1406.520) (-1404.719) [-1404.108] * (-1406.736) [-1403.910] (-1405.170) (-1403.301) -- 0:00:45 274500 -- (-1402.726) (-1403.936) [-1401.657] (-1404.200) * (-1404.189) (-1405.053) [-1404.708] (-1402.358) -- 0:00:44 275000 -- [-1402.724] (-1402.508) (-1404.088) (-1404.442) * (-1402.773) (-1402.855) [-1403.301] (-1406.327) -- 0:00:44 Average standard deviation of split frequencies: 0.013854 275500 -- (-1402.064) (-1403.228) [-1402.409] (-1405.001) * (-1403.485) (-1404.520) (-1402.074) [-1405.141] -- 0:00:44 276000 -- (-1402.318) [-1402.624] (-1405.669) (-1402.817) * (-1404.299) [-1404.019] (-1405.059) (-1402.964) -- 0:00:44 276500 -- (-1403.071) [-1401.512] (-1405.973) (-1402.837) * (-1403.514) (-1403.778) (-1403.376) [-1402.269] -- 0:00:47 277000 -- (-1404.589) (-1401.614) (-1400.711) [-1401.125] * (-1404.179) (-1404.828) [-1401.270] (-1402.328) -- 0:00:46 277500 -- [-1403.346] (-1402.775) (-1400.711) (-1401.492) * (-1403.108) (-1402.714) [-1402.209] (-1404.562) -- 0:00:46 278000 -- [-1402.561] (-1402.580) (-1403.799) (-1403.600) * (-1401.999) [-1408.034] (-1404.986) (-1406.149) -- 0:00:46 278500 -- (-1404.711) [-1404.285] (-1403.355) (-1401.035) * (-1401.544) (-1406.190) [-1402.630] (-1404.401) -- 0:00:46 279000 -- (-1407.196) [-1404.040] (-1402.275) (-1401.704) * [-1400.910] (-1403.140) (-1401.824) (-1403.444) -- 0:00:46 279500 -- (-1404.527) (-1402.755) [-1402.122] (-1401.477) * [-1400.956] (-1400.687) (-1404.556) (-1403.805) -- 0:00:46 280000 -- (-1406.502) [-1402.365] (-1401.521) (-1400.932) * (-1403.041) [-1402.958] (-1402.717) (-1404.078) -- 0:00:46 Average standard deviation of split frequencies: 0.012641 280500 -- (-1405.281) (-1402.402) (-1401.400) [-1404.781] * (-1405.970) (-1406.667) [-1401.913] (-1402.598) -- 0:00:46 281000 -- (-1401.221) (-1402.612) (-1401.271) [-1402.492] * (-1403.309) (-1402.304) [-1402.744] (-1402.168) -- 0:00:46 281500 -- (-1400.617) [-1404.785] (-1401.726) (-1404.322) * (-1402.456) (-1404.225) [-1401.513] (-1402.069) -- 0:00:45 282000 -- (-1401.817) (-1402.927) [-1401.901] (-1404.641) * (-1403.250) (-1401.905) [-1401.656] (-1401.661) -- 0:00:45 282500 -- (-1402.457) (-1402.401) (-1401.877) [-1404.461] * (-1404.321) [-1402.484] (-1407.075) (-1403.964) -- 0:00:45 283000 -- (-1403.484) (-1406.298) [-1406.291] (-1402.805) * (-1403.903) (-1403.701) (-1405.801) [-1402.352] -- 0:00:45 283500 -- (-1401.531) [-1405.264] (-1405.951) (-1401.430) * (-1405.013) (-1404.732) [-1405.952] (-1404.290) -- 0:00:45 284000 -- (-1404.772) [-1407.347] (-1402.235) (-1406.009) * (-1402.436) (-1406.529) [-1407.012] (-1403.039) -- 0:00:45 284500 -- [-1402.866] (-1405.206) (-1405.225) (-1403.780) * (-1401.376) (-1405.888) (-1403.091) [-1404.586] -- 0:00:45 285000 -- (-1406.567) (-1402.260) (-1401.562) [-1404.767] * [-1403.976] (-1406.765) (-1405.217) (-1404.632) -- 0:00:45 Average standard deviation of split frequencies: 0.012405 285500 -- (-1401.986) (-1409.785) [-1401.202] (-1402.415) * (-1404.289) (-1408.959) [-1402.937] (-1409.829) -- 0:00:45 286000 -- (-1405.110) (-1403.192) [-1400.985] (-1401.610) * [-1403.966] (-1402.037) (-1401.902) (-1406.258) -- 0:00:44 286500 -- (-1402.219) [-1402.121] (-1401.485) (-1404.505) * (-1402.756) (-1401.167) (-1400.875) [-1403.096] -- 0:00:44 287000 -- (-1402.030) (-1403.825) [-1402.222] (-1403.813) * (-1405.995) (-1406.727) [-1402.278] (-1404.962) -- 0:00:44 287500 -- (-1401.920) (-1401.231) [-1402.100] (-1402.551) * (-1404.988) (-1401.334) [-1403.219] (-1401.807) -- 0:00:44 288000 -- (-1401.988) (-1402.504) (-1402.224) [-1402.179] * (-1401.294) (-1401.365) [-1402.315] (-1402.258) -- 0:00:44 288500 -- (-1402.399) (-1404.984) [-1403.150] (-1409.796) * (-1401.825) (-1410.028) (-1403.919) [-1404.045] -- 0:00:44 289000 -- (-1402.159) (-1406.747) [-1402.813] (-1406.450) * (-1402.687) (-1404.564) [-1402.840] (-1407.938) -- 0:00:44 289500 -- [-1403.161] (-1402.575) (-1404.241) (-1403.228) * (-1401.689) (-1407.257) [-1402.104] (-1406.126) -- 0:00:44 290000 -- (-1404.937) (-1402.390) (-1404.622) [-1403.267] * (-1404.512) [-1404.050] (-1405.994) (-1405.169) -- 0:00:44 Average standard deviation of split frequencies: 0.011779 290500 -- (-1402.448) [-1401.188] (-1401.410) (-1403.088) * [-1403.317] (-1404.354) (-1402.003) (-1404.172) -- 0:00:43 291000 -- (-1403.788) (-1403.242) (-1400.827) [-1403.716] * (-1404.443) (-1401.851) [-1401.680] (-1404.033) -- 0:00:43 291500 -- [-1404.162] (-1402.187) (-1400.829) (-1402.906) * (-1403.880) (-1401.158) (-1402.282) [-1405.024] -- 0:00:43 292000 -- [-1403.018] (-1402.894) (-1402.161) (-1403.685) * (-1405.463) (-1402.526) [-1402.490] (-1402.626) -- 0:00:43 292500 -- (-1405.260) (-1406.200) (-1401.379) [-1402.288] * (-1404.192) (-1402.452) (-1402.293) [-1401.661] -- 0:00:45 293000 -- (-1406.706) (-1406.200) [-1403.411] (-1403.344) * (-1403.447) [-1403.741] (-1403.654) (-1405.767) -- 0:00:45 293500 -- (-1408.291) (-1407.005) (-1405.009) [-1404.438] * [-1401.911] (-1405.206) (-1402.893) (-1402.787) -- 0:00:45 294000 -- [-1403.174] (-1402.838) (-1402.389) (-1403.156) * [-1401.983] (-1405.780) (-1405.219) (-1402.176) -- 0:00:45 294500 -- (-1401.702) (-1403.425) [-1401.316] (-1406.193) * (-1402.093) (-1403.412) [-1401.057] (-1404.261) -- 0:00:45 295000 -- (-1403.014) [-1403.109] (-1403.250) (-1402.135) * (-1402.694) (-1405.323) [-1402.388] (-1405.452) -- 0:00:45 Average standard deviation of split frequencies: 0.011316 295500 -- [-1402.767] (-1401.722) (-1403.550) (-1402.051) * [-1404.700] (-1403.776) (-1402.994) (-1403.493) -- 0:00:45 296000 -- (-1401.483) (-1402.263) [-1402.754] (-1400.951) * (-1404.970) [-1403.646] (-1402.098) (-1402.026) -- 0:00:45 296500 -- (-1403.908) (-1402.963) (-1409.626) [-1400.970] * (-1403.198) (-1403.348) (-1404.045) [-1403.846] -- 0:00:45 297000 -- (-1403.651) [-1401.855] (-1408.000) (-1404.180) * (-1404.776) (-1402.928) (-1403.722) [-1403.813] -- 0:00:44 297500 -- (-1401.918) [-1401.374] (-1402.375) (-1404.199) * (-1405.386) (-1405.523) (-1404.487) [-1404.551] -- 0:00:44 298000 -- (-1402.943) (-1403.402) [-1406.379] (-1405.441) * (-1403.303) (-1400.789) (-1401.515) [-1403.607] -- 0:00:44 298500 -- (-1402.134) (-1406.202) [-1409.848] (-1403.311) * (-1404.497) [-1400.929] (-1405.264) (-1406.764) -- 0:00:44 299000 -- (-1404.967) (-1404.184) (-1406.015) [-1401.217] * (-1401.616) (-1402.035) (-1404.863) [-1403.731] -- 0:00:44 299500 -- (-1403.564) [-1404.679] (-1402.541) (-1403.394) * [-1401.206] (-1406.221) (-1402.170) (-1403.354) -- 0:00:44 300000 -- [-1401.877] (-1402.926) (-1402.973) (-1404.778) * (-1402.604) (-1402.969) [-1403.384] (-1401.799) -- 0:00:44 Average standard deviation of split frequencies: 0.012048 300500 -- (-1402.097) (-1406.684) (-1404.511) [-1402.879] * (-1403.851) (-1404.898) [-1401.892] (-1402.653) -- 0:00:44 301000 -- (-1404.637) [-1404.222] (-1404.482) (-1402.702) * (-1402.898) (-1402.496) [-1402.546] (-1401.989) -- 0:00:44 301500 -- (-1402.730) [-1404.762] (-1402.388) (-1402.558) * (-1401.538) (-1402.091) (-1401.449) [-1402.852] -- 0:00:44 302000 -- [-1403.262] (-1403.669) (-1402.389) (-1403.138) * (-1403.327) [-1404.377] (-1406.488) (-1408.890) -- 0:00:43 302500 -- (-1404.020) (-1404.365) (-1402.523) [-1403.365] * (-1403.861) (-1402.216) [-1405.644] (-1402.802) -- 0:00:43 303000 -- (-1404.327) (-1407.878) (-1401.905) [-1402.238] * (-1405.582) (-1400.918) (-1403.785) [-1401.280] -- 0:00:43 303500 -- (-1409.024) (-1407.373) [-1402.181] (-1401.541) * [-1403.660] (-1404.268) (-1404.550) (-1402.382) -- 0:00:43 304000 -- (-1407.750) (-1402.788) (-1401.996) [-1402.382] * [-1404.897] (-1402.637) (-1404.008) (-1402.242) -- 0:00:43 304500 -- [-1403.629] (-1404.974) (-1402.498) (-1401.706) * (-1403.443) [-1403.548] (-1401.977) (-1404.563) -- 0:00:43 305000 -- [-1402.356] (-1409.584) (-1402.498) (-1402.289) * (-1404.861) (-1402.054) (-1403.615) [-1402.998] -- 0:00:43 Average standard deviation of split frequencies: 0.012811 305500 -- (-1402.511) [-1401.950] (-1403.998) (-1402.829) * [-1402.130] (-1405.153) (-1405.265) (-1402.474) -- 0:00:43 306000 -- (-1406.064) (-1401.216) (-1407.313) [-1402.789] * (-1402.993) (-1403.640) (-1401.641) [-1402.938] -- 0:00:43 306500 -- (-1405.593) [-1402.319] (-1402.640) (-1402.882) * (-1403.300) [-1405.171] (-1405.927) (-1401.877) -- 0:00:42 307000 -- (-1402.183) (-1401.433) [-1400.875] (-1404.637) * [-1403.653] (-1402.727) (-1402.747) (-1403.215) -- 0:00:42 307500 -- (-1402.894) [-1404.465] (-1402.291) (-1403.890) * (-1402.384) (-1400.800) (-1402.818) [-1403.655] -- 0:00:42 308000 -- (-1403.295) (-1400.730) [-1401.251] (-1404.263) * [-1401.248] (-1402.264) (-1403.801) (-1406.277) -- 0:00:44 308500 -- (-1404.211) (-1401.185) [-1401.215] (-1408.703) * (-1401.601) (-1402.457) (-1402.118) [-1404.201] -- 0:00:44 309000 -- (-1400.693) [-1404.183] (-1401.537) (-1408.558) * (-1403.597) (-1403.428) (-1402.515) [-1403.906] -- 0:00:44 309500 -- (-1404.490) [-1407.077] (-1401.351) (-1404.713) * (-1408.468) (-1401.258) [-1401.590] (-1401.405) -- 0:00:44 310000 -- (-1403.853) (-1402.234) (-1401.662) [-1402.481] * (-1403.364) (-1406.537) [-1405.463] (-1404.359) -- 0:00:44 Average standard deviation of split frequencies: 0.011580 310500 -- (-1402.390) (-1402.503) [-1402.599] (-1404.981) * (-1402.468) (-1402.734) [-1401.417] (-1403.410) -- 0:00:44 311000 -- (-1403.018) [-1402.552] (-1402.356) (-1404.328) * (-1403.551) (-1403.506) (-1402.916) [-1404.437] -- 0:00:44 311500 -- (-1404.859) [-1402.103] (-1404.216) (-1403.064) * (-1402.159) [-1403.561] (-1403.405) (-1403.627) -- 0:00:44 312000 -- [-1403.687] (-1403.719) (-1404.394) (-1401.261) * [-1402.109] (-1404.590) (-1403.101) (-1404.828) -- 0:00:44 312500 -- [-1404.109] (-1403.689) (-1402.660) (-1403.439) * (-1401.192) [-1404.823] (-1402.864) (-1402.350) -- 0:00:44 313000 -- (-1405.404) [-1401.221] (-1403.066) (-1403.320) * (-1401.993) (-1405.231) [-1404.777] (-1406.063) -- 0:00:43 313500 -- (-1405.130) (-1401.950) [-1402.821] (-1403.954) * [-1401.719] (-1401.335) (-1402.587) (-1402.440) -- 0:00:43 314000 -- (-1401.982) (-1402.198) (-1403.951) [-1401.043] * (-1402.762) (-1401.274) (-1402.437) [-1406.067] -- 0:00:43 314500 -- (-1401.238) (-1401.949) (-1402.474) [-1402.326] * (-1402.781) [-1401.116] (-1405.801) (-1402.259) -- 0:00:43 315000 -- (-1407.398) (-1403.892) (-1402.601) [-1402.626] * [-1403.126] (-1402.349) (-1403.900) (-1403.451) -- 0:00:43 Average standard deviation of split frequencies: 0.010992 315500 -- [-1406.704] (-1401.522) (-1404.783) (-1403.061) * (-1404.823) [-1406.968] (-1403.589) (-1402.577) -- 0:00:43 316000 -- [-1401.941] (-1409.188) (-1404.974) (-1402.119) * (-1403.299) (-1403.217) [-1402.228] (-1405.398) -- 0:00:43 316500 -- [-1402.136] (-1405.126) (-1403.842) (-1402.446) * [-1402.324] (-1403.840) (-1402.822) (-1402.017) -- 0:00:43 317000 -- (-1406.858) (-1407.334) [-1402.584] (-1402.087) * (-1402.338) [-1404.878] (-1406.398) (-1402.737) -- 0:00:43 317500 -- (-1403.071) (-1406.686) (-1401.819) [-1402.125] * (-1403.032) [-1403.208] (-1404.765) (-1403.264) -- 0:00:42 318000 -- [-1405.919] (-1403.975) (-1401.726) (-1402.235) * (-1402.844) (-1406.698) (-1407.513) [-1402.495] -- 0:00:42 318500 -- (-1405.467) [-1405.221] (-1403.045) (-1404.079) * (-1402.978) [-1405.297] (-1404.209) (-1402.548) -- 0:00:42 319000 -- (-1404.475) [-1404.698] (-1402.578) (-1407.385) * (-1402.411) (-1406.676) (-1407.140) [-1403.951] -- 0:00:42 319500 -- (-1401.653) (-1401.566) (-1401.803) [-1405.166] * (-1401.980) [-1403.154] (-1403.690) (-1402.148) -- 0:00:42 320000 -- (-1405.087) (-1402.249) [-1403.586] (-1402.043) * (-1402.081) (-1402.255) (-1401.190) [-1401.755] -- 0:00:42 Average standard deviation of split frequencies: 0.010832 320500 -- (-1403.496) [-1401.724] (-1403.485) (-1403.978) * (-1402.393) (-1402.262) [-1401.817] (-1402.050) -- 0:00:42 321000 -- (-1403.575) [-1402.612] (-1403.313) (-1402.484) * (-1403.792) [-1402.316] (-1404.054) (-1402.335) -- 0:00:42 321500 -- (-1404.521) [-1402.114] (-1402.526) (-1406.969) * [-1402.476] (-1402.421) (-1402.723) (-1403.095) -- 0:00:42 322000 -- (-1403.886) [-1402.122] (-1405.521) (-1401.589) * (-1402.765) (-1408.012) (-1402.014) [-1403.114] -- 0:00:42 322500 -- (-1403.310) (-1403.239) [-1403.793] (-1401.470) * (-1401.652) (-1407.240) [-1405.555] (-1405.450) -- 0:00:42 323000 -- (-1403.903) (-1402.635) (-1403.236) [-1404.599] * (-1402.880) (-1401.662) [-1400.953] (-1404.532) -- 0:00:41 323500 -- (-1404.585) [-1402.064] (-1402.732) (-1403.568) * (-1402.310) [-1401.574] (-1400.908) (-1409.502) -- 0:00:41 324000 -- (-1404.120) [-1402.401] (-1403.699) (-1402.415) * (-1404.738) (-1403.125) [-1400.903] (-1403.542) -- 0:00:43 324500 -- (-1401.988) (-1401.633) [-1402.645] (-1407.096) * (-1403.740) [-1402.027] (-1402.635) (-1404.979) -- 0:00:43 325000 -- (-1401.132) (-1402.439) [-1403.113] (-1407.965) * (-1401.237) [-1401.993] (-1402.268) (-1401.475) -- 0:00:43 Average standard deviation of split frequencies: 0.011644 325500 -- (-1401.843) (-1403.631) [-1405.638] (-1407.805) * (-1402.760) (-1402.447) (-1400.841) [-1401.659] -- 0:00:43 326000 -- (-1402.807) (-1405.559) (-1405.278) [-1404.220] * (-1404.424) (-1402.252) [-1402.818] (-1401.504) -- 0:00:43 326500 -- (-1402.500) (-1401.635) (-1402.745) [-1402.567] * (-1403.694) (-1406.724) (-1401.409) [-1401.795] -- 0:00:43 327000 -- (-1401.968) [-1401.542] (-1403.664) (-1401.974) * (-1402.815) (-1410.436) (-1401.859) [-1403.002] -- 0:00:43 327500 -- (-1402.034) [-1402.731] (-1406.048) (-1403.147) * (-1402.274) (-1403.943) [-1402.953] (-1401.750) -- 0:00:43 328000 -- (-1402.096) (-1402.802) [-1407.181] (-1403.049) * (-1402.669) [-1406.103] (-1406.339) (-1403.193) -- 0:00:43 328500 -- [-1400.672] (-1402.536) (-1404.394) (-1411.242) * (-1403.421) (-1402.100) [-1404.444] (-1404.386) -- 0:00:42 329000 -- [-1402.811] (-1403.838) (-1403.139) (-1407.293) * [-1403.496] (-1403.690) (-1402.027) (-1403.324) -- 0:00:42 329500 -- [-1401.595] (-1402.560) (-1404.209) (-1402.171) * (-1403.087) (-1402.611) [-1403.435] (-1402.859) -- 0:00:42 330000 -- (-1402.549) [-1401.122] (-1402.184) (-1403.230) * (-1403.760) (-1402.579) [-1401.799] (-1407.429) -- 0:00:42 Average standard deviation of split frequencies: 0.012230 330500 -- [-1403.312] (-1403.557) (-1401.359) (-1403.057) * (-1403.591) [-1402.883] (-1402.257) (-1403.586) -- 0:00:42 331000 -- [-1403.453] (-1404.647) (-1400.778) (-1406.539) * (-1404.485) (-1402.001) (-1402.165) [-1407.225] -- 0:00:42 331500 -- (-1404.889) [-1405.901] (-1401.177) (-1405.684) * [-1405.006] (-1401.953) (-1403.386) (-1402.703) -- 0:00:42 332000 -- [-1403.436] (-1405.691) (-1401.168) (-1403.259) * (-1408.849) (-1403.907) [-1403.167] (-1401.720) -- 0:00:42 332500 -- [-1403.097] (-1407.211) (-1401.907) (-1403.767) * [-1402.735] (-1403.029) (-1402.071) (-1403.279) -- 0:00:42 333000 -- [-1402.802] (-1402.318) (-1403.028) (-1403.957) * (-1406.919) (-1401.018) (-1402.582) [-1402.767] -- 0:00:42 333500 -- (-1402.462) [-1405.042] (-1404.167) (-1401.309) * (-1403.499) [-1401.170] (-1404.139) (-1402.856) -- 0:00:41 334000 -- (-1402.446) [-1404.147] (-1404.896) (-1402.351) * (-1407.493) (-1403.808) [-1404.645] (-1402.679) -- 0:00:41 334500 -- (-1405.915) (-1404.443) [-1405.170] (-1401.778) * [-1402.682] (-1402.066) (-1401.460) (-1407.723) -- 0:00:41 335000 -- (-1406.695) (-1405.263) [-1404.769] (-1408.067) * [-1403.468] (-1401.027) (-1403.263) (-1403.720) -- 0:00:41 Average standard deviation of split frequencies: 0.012258 335500 -- [-1405.443] (-1402.355) (-1401.707) (-1404.936) * (-1401.646) (-1401.222) [-1403.448] (-1404.879) -- 0:00:41 336000 -- (-1402.597) (-1402.742) [-1403.547] (-1403.436) * [-1401.239] (-1401.222) (-1400.963) (-1404.575) -- 0:00:41 336500 -- (-1402.789) (-1403.624) (-1403.885) [-1403.834] * (-1401.275) (-1402.623) (-1401.001) [-1404.602] -- 0:00:41 337000 -- (-1403.095) (-1402.572) [-1403.056] (-1404.894) * (-1403.749) (-1402.779) [-1402.279] (-1402.746) -- 0:00:41 337500 -- (-1401.370) (-1401.841) [-1404.050] (-1403.502) * (-1404.342) (-1401.289) (-1401.783) [-1404.617] -- 0:00:41 338000 -- (-1402.294) (-1401.585) [-1402.540] (-1405.294) * [-1401.514] (-1403.235) (-1401.805) (-1403.588) -- 0:00:41 338500 -- (-1403.030) (-1401.233) [-1404.147] (-1402.329) * (-1402.549) [-1401.614] (-1401.573) (-1402.761) -- 0:00:41 339000 -- (-1402.823) (-1401.925) [-1403.390] (-1402.695) * (-1402.966) (-1403.860) (-1402.872) [-1402.942] -- 0:00:40 339500 -- (-1403.337) (-1401.578) (-1402.510) [-1403.040] * (-1401.570) (-1401.458) [-1403.360] (-1404.063) -- 0:00:40 340000 -- (-1406.561) (-1402.543) [-1401.173] (-1401.399) * (-1401.695) [-1406.133] (-1401.996) (-1401.700) -- 0:00:42 Average standard deviation of split frequencies: 0.011871 340500 -- [-1406.206] (-1401.027) (-1403.442) (-1408.511) * (-1401.976) (-1402.023) (-1402.497) [-1400.982] -- 0:00:42 341000 -- [-1401.637] (-1400.812) (-1401.640) (-1402.462) * (-1402.209) (-1402.534) [-1403.437] (-1401.838) -- 0:00:42 341500 -- [-1402.451] (-1402.708) (-1403.827) (-1401.434) * [-1402.561] (-1401.766) (-1402.601) (-1401.539) -- 0:00:42 342000 -- (-1401.817) (-1402.441) (-1403.222) [-1401.932] * [-1405.346] (-1402.670) (-1401.822) (-1401.644) -- 0:00:42 342500 -- (-1401.893) [-1402.667] (-1401.958) (-1403.695) * [-1404.218] (-1402.785) (-1401.686) (-1400.981) -- 0:00:42 343000 -- (-1403.321) (-1404.202) (-1401.174) [-1402.781] * [-1401.115] (-1402.622) (-1402.483) (-1401.725) -- 0:00:42 343500 -- [-1401.315] (-1403.746) (-1402.358) (-1404.594) * [-1403.444] (-1401.733) (-1401.243) (-1403.744) -- 0:00:42 344000 -- (-1402.537) (-1402.580) [-1403.830] (-1403.724) * (-1403.972) (-1404.192) [-1400.865] (-1401.865) -- 0:00:41 344500 -- (-1402.535) (-1404.088) (-1403.404) [-1402.240] * (-1401.819) (-1406.396) [-1401.505] (-1402.005) -- 0:00:41 345000 -- (-1403.581) (-1401.993) [-1403.226] (-1402.520) * (-1401.782) (-1406.302) [-1400.714] (-1402.680) -- 0:00:41 Average standard deviation of split frequencies: 0.011832 345500 -- (-1405.634) (-1404.252) (-1406.154) [-1401.739] * (-1401.597) [-1406.817] (-1400.735) (-1402.264) -- 0:00:41 346000 -- [-1402.259] (-1403.053) (-1405.954) (-1401.526) * [-1402.490] (-1401.486) (-1402.127) (-1404.612) -- 0:00:41 346500 -- (-1401.894) [-1402.280] (-1406.531) (-1404.032) * (-1402.031) (-1406.084) (-1401.886) [-1402.166] -- 0:00:41 347000 -- [-1401.894] (-1404.841) (-1403.417) (-1406.325) * (-1402.591) (-1401.207) [-1403.790] (-1404.400) -- 0:00:41 347500 -- [-1404.243] (-1403.917) (-1403.177) (-1405.670) * (-1404.062) (-1401.861) (-1402.259) [-1404.805] -- 0:00:41 348000 -- [-1404.715] (-1404.154) (-1405.917) (-1404.834) * (-1405.601) (-1401.266) (-1408.101) [-1403.431] -- 0:00:41 348500 -- [-1405.201] (-1404.454) (-1405.920) (-1407.452) * (-1403.223) (-1403.718) (-1402.311) [-1402.351] -- 0:00:41 349000 -- (-1403.347) (-1405.632) [-1402.809] (-1404.924) * [-1402.569] (-1402.931) (-1402.798) (-1402.894) -- 0:00:41 349500 -- (-1402.995) (-1403.429) (-1402.831) [-1407.277] * (-1404.153) (-1402.279) (-1402.773) [-1404.706] -- 0:00:40 350000 -- [-1403.795] (-1404.804) (-1404.679) (-1403.871) * (-1401.999) (-1402.676) [-1401.492] (-1401.967) -- 0:00:40 Average standard deviation of split frequencies: 0.013578 350500 -- [-1403.663] (-1402.556) (-1403.942) (-1401.556) * [-1401.933] (-1401.960) (-1402.682) (-1401.446) -- 0:00:40 351000 -- (-1404.352) [-1402.266] (-1403.499) (-1404.920) * (-1401.934) (-1401.316) (-1403.487) [-1401.928] -- 0:00:40 351500 -- (-1403.126) [-1402.774] (-1404.905) (-1407.227) * (-1401.716) (-1402.766) [-1404.360] (-1403.265) -- 0:00:40 352000 -- (-1402.216) (-1401.853) [-1403.450] (-1404.327) * (-1401.849) [-1402.475] (-1409.223) (-1401.432) -- 0:00:40 352500 -- (-1403.377) (-1404.501) [-1402.353] (-1405.540) * [-1405.805] (-1401.867) (-1410.095) (-1402.082) -- 0:00:40 353000 -- (-1402.748) (-1401.348) [-1401.890] (-1402.634) * (-1404.320) [-1402.282] (-1402.693) (-1402.965) -- 0:00:40 353500 -- (-1402.713) (-1400.863) (-1403.458) [-1403.365] * [-1403.925] (-1402.750) (-1403.449) (-1404.689) -- 0:00:40 354000 -- (-1404.296) (-1401.452) [-1401.405] (-1403.770) * (-1402.124) (-1402.529) (-1405.002) [-1404.695] -- 0:00:40 354500 -- (-1403.396) (-1401.232) [-1400.891] (-1403.887) * (-1406.147) (-1402.153) [-1403.988] (-1404.393) -- 0:00:40 355000 -- [-1403.448] (-1402.142) (-1400.727) (-1402.615) * (-1401.971) (-1402.742) [-1405.108] (-1402.374) -- 0:00:39 Average standard deviation of split frequencies: 0.012911 355500 -- (-1401.531) (-1404.508) (-1400.727) [-1401.032] * (-1400.950) [-1405.803] (-1402.413) (-1403.375) -- 0:00:41 356000 -- (-1402.762) (-1402.959) (-1400.694) [-1401.762] * [-1405.390] (-1409.161) (-1403.146) (-1406.378) -- 0:00:41 356500 -- (-1403.678) (-1406.130) [-1405.044] (-1402.449) * (-1404.523) [-1402.265] (-1408.608) (-1403.222) -- 0:00:41 357000 -- (-1403.475) [-1405.814] (-1402.020) (-1403.403) * (-1408.968) (-1403.372) [-1405.895] (-1403.653) -- 0:00:41 357500 -- (-1402.878) [-1403.204] (-1405.993) (-1405.058) * (-1403.293) (-1403.768) [-1404.980] (-1404.575) -- 0:00:41 358000 -- (-1402.280) [-1405.137] (-1402.471) (-1403.711) * [-1403.222] (-1404.489) (-1403.130) (-1407.533) -- 0:00:41 358500 -- [-1402.966] (-1406.150) (-1402.397) (-1406.249) * (-1402.750) (-1409.365) [-1403.125] (-1406.890) -- 0:00:41 359000 -- [-1402.040] (-1402.390) (-1401.901) (-1403.940) * [-1402.668] (-1404.979) (-1402.987) (-1406.723) -- 0:00:41 359500 -- (-1404.217) (-1402.713) (-1401.410) [-1401.726] * [-1402.422] (-1402.582) (-1402.094) (-1406.511) -- 0:00:40 360000 -- (-1404.501) (-1403.530) (-1404.311) [-1403.633] * (-1406.285) (-1402.376) [-1403.922] (-1403.237) -- 0:00:40 Average standard deviation of split frequencies: 0.013070 360500 -- [-1403.076] (-1402.713) (-1403.968) (-1406.190) * (-1401.451) (-1405.550) [-1407.565] (-1401.966) -- 0:00:40 361000 -- [-1404.834] (-1401.511) (-1404.254) (-1404.211) * (-1402.952) [-1408.775] (-1402.719) (-1402.117) -- 0:00:40 361500 -- (-1403.921) (-1401.430) (-1404.120) [-1401.715] * (-1403.684) (-1407.672) [-1403.045] (-1401.604) -- 0:00:40 362000 -- (-1403.466) [-1401.853] (-1402.828) (-1406.878) * (-1401.416) [-1406.910] (-1402.697) (-1404.324) -- 0:00:40 362500 -- (-1406.065) (-1402.238) [-1403.581] (-1405.252) * (-1404.458) (-1403.013) (-1404.229) [-1402.521] -- 0:00:40 363000 -- (-1405.483) (-1401.449) (-1403.285) [-1410.048] * (-1404.191) (-1406.297) (-1401.469) [-1404.335] -- 0:00:40 363500 -- (-1403.568) [-1403.094] (-1402.594) (-1409.781) * (-1404.667) (-1405.205) (-1403.601) [-1403.907] -- 0:00:40 364000 -- (-1402.317) (-1402.714) [-1401.253] (-1406.734) * (-1405.051) (-1403.436) [-1402.712] (-1402.678) -- 0:00:40 364500 -- (-1401.265) [-1404.709] (-1404.742) (-1402.181) * (-1404.088) (-1402.549) [-1402.338] (-1401.773) -- 0:00:40 365000 -- [-1401.297] (-1403.878) (-1401.280) (-1402.190) * [-1403.560] (-1401.827) (-1402.156) (-1402.945) -- 0:00:40 Average standard deviation of split frequencies: 0.012558 365500 -- (-1401.708) [-1404.668] (-1400.997) (-1403.248) * (-1405.271) (-1401.141) [-1401.386] (-1402.325) -- 0:00:39 366000 -- [-1401.716] (-1402.394) (-1405.737) (-1402.924) * (-1410.056) (-1401.641) [-1403.272] (-1401.997) -- 0:00:39 366500 -- (-1401.639) (-1402.674) [-1406.353] (-1403.685) * (-1404.255) (-1402.678) (-1401.191) [-1403.521] -- 0:00:39 367000 -- (-1402.085) [-1402.853] (-1404.432) (-1402.181) * (-1401.556) (-1402.352) [-1407.318] (-1402.057) -- 0:00:39 367500 -- (-1402.358) (-1403.093) [-1402.541] (-1404.281) * (-1401.010) (-1402.463) [-1402.461] (-1402.756) -- 0:00:39 368000 -- [-1401.496] (-1403.613) (-1406.949) (-1403.659) * (-1402.749) [-1402.732] (-1401.819) (-1401.629) -- 0:00:39 368500 -- (-1401.432) (-1403.214) [-1404.922] (-1409.523) * (-1401.628) [-1402.257] (-1401.703) (-1401.902) -- 0:00:39 369000 -- (-1401.351) [-1407.346] (-1403.526) (-1405.370) * (-1405.919) (-1401.824) (-1401.431) [-1401.595] -- 0:00:39 369500 -- (-1402.122) (-1404.119) [-1401.682] (-1402.471) * (-1402.190) [-1402.186] (-1403.677) (-1402.545) -- 0:00:39 370000 -- (-1403.141) [-1401.108] (-1402.491) (-1402.861) * (-1404.768) [-1401.240] (-1405.856) (-1404.146) -- 0:00:39 Average standard deviation of split frequencies: 0.011828 370500 -- (-1403.291) (-1402.419) [-1402.176] (-1403.853) * [-1402.255] (-1401.717) (-1402.962) (-1402.171) -- 0:00:39 371000 -- (-1404.588) (-1403.245) (-1402.154) [-1402.422] * [-1403.552] (-1402.120) (-1403.239) (-1402.032) -- 0:00:38 371500 -- (-1402.842) [-1405.067] (-1405.939) (-1405.261) * [-1405.778] (-1409.394) (-1404.504) (-1401.356) -- 0:00:40 372000 -- (-1405.298) [-1402.236] (-1403.967) (-1404.269) * [-1405.190] (-1406.437) (-1403.237) (-1403.451) -- 0:00:40 372500 -- (-1408.251) [-1401.438] (-1404.384) (-1406.136) * (-1403.466) (-1403.774) [-1402.605] (-1404.572) -- 0:00:40 373000 -- (-1402.763) [-1402.787] (-1404.701) (-1403.236) * (-1403.281) (-1404.752) (-1401.608) [-1402.499] -- 0:00:40 373500 -- [-1402.679] (-1402.136) (-1401.198) (-1403.807) * [-1401.746] (-1403.696) (-1401.458) (-1403.449) -- 0:00:40 374000 -- (-1401.238) (-1401.727) (-1403.464) [-1402.528] * (-1401.775) (-1402.251) (-1404.345) [-1402.851] -- 0:00:40 374500 -- (-1401.515) [-1401.733] (-1401.081) (-1401.573) * [-1402.410] (-1403.926) (-1400.875) (-1403.901) -- 0:00:40 375000 -- (-1403.255) (-1404.251) (-1401.038) [-1402.475] * (-1402.710) (-1403.580) (-1404.706) [-1401.034] -- 0:00:40 Average standard deviation of split frequencies: 0.011680 375500 -- (-1402.153) (-1405.831) (-1400.852) [-1403.471] * [-1403.144] (-1405.828) (-1403.110) (-1400.935) -- 0:00:39 376000 -- (-1402.387) [-1408.076] (-1403.898) (-1401.087) * [-1401.497] (-1400.993) (-1402.479) (-1400.895) -- 0:00:39 376500 -- (-1402.151) (-1407.427) (-1400.916) [-1401.037] * (-1401.382) (-1406.254) [-1403.767] (-1400.880) -- 0:00:39 377000 -- (-1401.497) (-1407.323) (-1402.706) [-1403.802] * [-1401.019] (-1409.908) (-1402.117) (-1402.537) -- 0:00:39 377500 -- [-1401.412] (-1406.066) (-1403.440) (-1403.839) * [-1403.067] (-1402.749) (-1403.947) (-1402.068) -- 0:00:39 378000 -- [-1402.859] (-1406.042) (-1402.379) (-1405.147) * [-1403.439] (-1402.570) (-1402.912) (-1403.226) -- 0:00:39 378500 -- [-1401.197] (-1402.195) (-1402.775) (-1402.789) * (-1401.062) (-1402.965) (-1402.531) [-1403.126] -- 0:00:39 379000 -- (-1401.217) [-1401.340] (-1402.624) (-1407.036) * [-1401.345] (-1402.000) (-1405.750) (-1404.569) -- 0:00:39 379500 -- (-1401.217) (-1406.762) [-1400.673] (-1405.201) * (-1402.676) (-1401.207) [-1402.741] (-1405.844) -- 0:00:39 380000 -- [-1401.321] (-1403.213) (-1402.227) (-1405.439) * (-1403.918) [-1402.432] (-1402.784) (-1402.191) -- 0:00:39 Average standard deviation of split frequencies: 0.012058 380500 -- (-1401.951) [-1401.187] (-1405.880) (-1407.177) * (-1405.223) (-1409.028) [-1403.262] (-1404.194) -- 0:00:39 381000 -- [-1403.306] (-1406.550) (-1404.173) (-1404.876) * (-1402.902) [-1401.104] (-1403.979) (-1400.890) -- 0:00:38 381500 -- (-1400.943) (-1402.099) [-1402.507] (-1402.350) * (-1402.511) [-1402.157] (-1401.064) (-1401.633) -- 0:00:38 382000 -- (-1401.480) (-1403.889) (-1405.894) [-1402.594] * [-1402.667] (-1401.822) (-1405.206) (-1402.344) -- 0:00:38 382500 -- (-1407.542) (-1402.440) [-1404.065] (-1404.751) * (-1406.985) [-1401.182] (-1407.139) (-1401.439) -- 0:00:38 383000 -- [-1402.871] (-1406.548) (-1403.996) (-1405.408) * (-1408.819) (-1403.584) [-1403.686] (-1401.084) -- 0:00:38 383500 -- (-1402.428) (-1402.205) [-1404.002] (-1407.567) * (-1406.449) [-1410.049] (-1402.138) (-1403.016) -- 0:00:38 384000 -- (-1409.531) (-1403.880) (-1403.158) [-1404.162] * [-1401.768] (-1406.286) (-1400.841) (-1402.234) -- 0:00:38 384500 -- (-1407.863) (-1403.252) [-1402.990] (-1403.000) * (-1403.358) (-1403.253) (-1402.463) [-1403.129] -- 0:00:38 385000 -- (-1404.172) (-1405.848) [-1401.370] (-1403.638) * (-1405.945) [-1403.382] (-1403.402) (-1402.928) -- 0:00:38 Average standard deviation of split frequencies: 0.011184 385500 -- (-1406.180) (-1404.037) (-1401.086) [-1400.934] * (-1405.537) (-1404.213) [-1406.576] (-1401.597) -- 0:00:38 386000 -- (-1402.675) (-1402.103) (-1405.052) [-1401.309] * [-1404.832] (-1402.917) (-1405.029) (-1403.378) -- 0:00:38 386500 -- (-1401.358) (-1402.282) (-1404.810) [-1401.019] * (-1402.533) (-1401.651) [-1408.030] (-1401.294) -- 0:00:38 387000 -- (-1401.557) [-1401.669] (-1401.748) (-1403.091) * (-1401.908) (-1402.820) [-1404.947] (-1402.962) -- 0:00:39 387500 -- (-1402.858) (-1404.057) [-1402.379] (-1403.926) * [-1402.671] (-1405.311) (-1404.699) (-1403.689) -- 0:00:39 388000 -- [-1405.890] (-1408.791) (-1402.379) (-1401.043) * (-1403.359) (-1404.663) [-1401.202] (-1402.112) -- 0:00:39 388500 -- (-1404.474) [-1403.766] (-1402.389) (-1403.067) * [-1406.371] (-1404.902) (-1400.861) (-1405.053) -- 0:00:39 389000 -- [-1402.697] (-1404.313) (-1401.049) (-1402.307) * (-1402.869) (-1403.337) [-1401.970] (-1405.043) -- 0:00:39 389500 -- (-1401.797) (-1404.993) [-1402.377] (-1404.412) * (-1404.229) (-1404.760) [-1401.179] (-1404.588) -- 0:00:39 390000 -- (-1401.510) (-1403.308) [-1402.152] (-1405.443) * (-1403.786) (-1408.730) [-1404.214] (-1414.407) -- 0:00:39 Average standard deviation of split frequencies: 0.010733 390500 -- (-1403.614) (-1403.289) [-1402.343] (-1403.266) * (-1402.125) (-1407.042) [-1401.776] (-1411.638) -- 0:00:39 391000 -- (-1403.379) (-1403.111) [-1402.212] (-1402.397) * (-1403.057) (-1404.856) [-1405.499] (-1403.288) -- 0:00:38 391500 -- (-1403.150) [-1401.198] (-1405.151) (-1404.850) * (-1403.117) (-1403.078) [-1403.008] (-1403.625) -- 0:00:38 392000 -- (-1402.340) (-1403.955) [-1402.886] (-1404.191) * (-1403.583) (-1401.813) [-1402.753] (-1401.733) -- 0:00:38 392500 -- (-1403.453) (-1402.769) [-1403.936] (-1407.044) * (-1401.502) (-1410.047) [-1401.624] (-1402.386) -- 0:00:38 393000 -- (-1403.970) (-1402.594) (-1405.100) [-1403.127] * (-1401.365) (-1401.235) (-1404.089) [-1400.898] -- 0:00:38 393500 -- (-1403.751) (-1402.042) (-1408.483) [-1404.309] * (-1405.123) (-1401.259) [-1402.513] (-1402.568) -- 0:00:38 394000 -- [-1403.622] (-1405.638) (-1405.940) (-1406.080) * (-1403.996) [-1401.859] (-1403.894) (-1402.862) -- 0:00:38 394500 -- (-1403.272) (-1405.573) (-1406.415) [-1406.561] * [-1402.375] (-1402.423) (-1401.474) (-1401.035) -- 0:00:38 395000 -- [-1402.434] (-1402.883) (-1405.612) (-1402.359) * (-1404.750) (-1403.878) (-1401.410) [-1404.751] -- 0:00:38 Average standard deviation of split frequencies: 0.011027 395500 -- [-1401.830] (-1402.181) (-1407.028) (-1401.394) * (-1403.738) (-1403.245) (-1402.747) [-1401.506] -- 0:00:38 396000 -- (-1402.598) (-1400.779) [-1402.342] (-1402.165) * (-1404.614) (-1402.984) [-1402.831] (-1401.321) -- 0:00:38 396500 -- [-1403.600] (-1403.824) (-1401.305) (-1402.228) * [-1402.157] (-1403.729) (-1401.272) (-1401.776) -- 0:00:38 397000 -- (-1406.015) (-1406.781) (-1402.401) [-1401.379] * (-1402.502) [-1401.602] (-1402.768) (-1400.848) -- 0:00:37 397500 -- (-1408.015) (-1403.404) [-1401.382] (-1402.235) * [-1403.296] (-1402.263) (-1402.779) (-1404.057) -- 0:00:37 398000 -- [-1403.870] (-1404.525) (-1402.335) (-1400.945) * (-1401.433) [-1401.767] (-1401.951) (-1405.268) -- 0:00:37 398500 -- (-1401.473) (-1404.644) (-1402.401) [-1403.222] * (-1402.370) [-1401.594] (-1402.944) (-1401.463) -- 0:00:37 399000 -- (-1401.725) (-1406.009) [-1403.159] (-1402.698) * (-1401.732) (-1403.929) [-1402.207] (-1401.546) -- 0:00:37 399500 -- (-1403.371) (-1405.713) (-1403.316) [-1400.902] * (-1403.674) [-1401.714] (-1403.894) (-1402.609) -- 0:00:37 400000 -- (-1405.652) [-1402.218] (-1403.128) (-1400.940) * (-1402.004) (-1401.754) [-1403.070] (-1401.357) -- 0:00:37 Average standard deviation of split frequencies: 0.010713 400500 -- (-1401.816) (-1404.377) (-1403.043) [-1402.672] * (-1403.014) [-1401.850] (-1403.862) (-1402.314) -- 0:00:37 401000 -- [-1401.734] (-1402.701) (-1403.584) (-1402.762) * (-1404.359) [-1401.707] (-1402.835) (-1401.450) -- 0:00:37 401500 -- (-1402.341) (-1403.025) [-1402.528] (-1404.644) * (-1404.359) (-1402.693) [-1401.783] (-1402.659) -- 0:00:37 402000 -- (-1402.763) (-1403.672) [-1402.581] (-1407.793) * (-1406.817) (-1405.753) [-1405.688] (-1404.501) -- 0:00:37 402500 -- (-1403.464) (-1402.413) (-1402.211) [-1403.740] * (-1406.171) [-1403.252] (-1403.362) (-1403.533) -- 0:00:38 403000 -- (-1403.849) [-1401.736] (-1405.012) (-1403.971) * (-1406.698) (-1402.100) [-1403.256] (-1407.186) -- 0:00:38 403500 -- (-1403.121) (-1403.242) [-1401.730] (-1401.344) * (-1402.163) [-1402.840] (-1402.179) (-1405.592) -- 0:00:38 404000 -- (-1402.712) (-1403.267) [-1402.253] (-1401.356) * (-1402.202) (-1404.455) (-1401.994) [-1401.311] -- 0:00:38 404500 -- (-1407.289) (-1401.500) [-1403.649] (-1400.812) * (-1403.599) (-1406.209) (-1401.239) [-1401.858] -- 0:00:38 405000 -- (-1400.786) [-1401.726] (-1404.444) (-1402.360) * (-1403.387) (-1401.478) (-1404.203) [-1401.570] -- 0:00:38 Average standard deviation of split frequencies: 0.010878 405500 -- (-1403.649) (-1401.504) [-1406.000] (-1408.412) * (-1401.802) (-1401.185) (-1402.197) [-1401.304] -- 0:00:38 406000 -- [-1403.254] (-1404.272) (-1403.957) (-1407.561) * (-1401.300) (-1401.025) (-1402.599) [-1403.867] -- 0:00:38 406500 -- (-1400.822) (-1405.144) (-1403.997) [-1404.463] * [-1401.805] (-1402.894) (-1401.481) (-1412.682) -- 0:00:37 407000 -- (-1400.717) [-1401.784] (-1404.428) (-1401.789) * (-1401.061) (-1401.605) [-1402.032] (-1401.935) -- 0:00:37 407500 -- (-1401.487) (-1402.772) [-1403.931] (-1402.386) * [-1402.987] (-1401.527) (-1401.951) (-1402.757) -- 0:00:37 408000 -- [-1402.343] (-1407.600) (-1402.303) (-1402.318) * (-1404.706) [-1401.316] (-1402.880) (-1402.809) -- 0:00:37 408500 -- (-1400.884) (-1402.472) [-1401.231] (-1402.459) * (-1406.302) (-1403.689) [-1402.492] (-1403.150) -- 0:00:37 409000 -- (-1403.521) [-1401.862] (-1401.149) (-1402.284) * [-1404.994] (-1403.134) (-1404.328) (-1404.543) -- 0:00:37 409500 -- (-1409.548) [-1402.935] (-1402.865) (-1405.636) * (-1401.535) (-1403.991) [-1402.140] (-1402.139) -- 0:00:37 410000 -- [-1405.037] (-1403.118) (-1403.515) (-1403.337) * (-1401.832) (-1403.639) (-1402.436) [-1403.215] -- 0:00:37 Average standard deviation of split frequencies: 0.010150 410500 -- (-1404.877) (-1410.337) [-1402.901] (-1404.608) * (-1402.569) (-1403.026) (-1402.691) [-1401.876] -- 0:00:37 411000 -- [-1401.865] (-1405.119) (-1401.620) (-1404.746) * (-1401.087) (-1406.858) (-1402.691) [-1400.858] -- 0:00:37 411500 -- (-1401.312) (-1402.891) [-1402.110] (-1403.065) * [-1400.820] (-1404.369) (-1402.691) (-1402.579) -- 0:00:37 412000 -- (-1401.387) [-1405.162] (-1402.509) (-1402.793) * (-1402.719) (-1403.816) [-1402.915] (-1402.982) -- 0:00:37 412500 -- [-1401.656] (-1401.171) (-1403.666) (-1402.156) * (-1406.317) [-1405.120] (-1404.942) (-1401.386) -- 0:00:37 413000 -- [-1402.945] (-1404.106) (-1403.914) (-1403.296) * (-1406.528) (-1405.386) (-1405.078) [-1401.996] -- 0:00:36 413500 -- (-1402.296) (-1403.385) [-1402.570] (-1402.942) * [-1404.505] (-1405.096) (-1406.014) (-1408.530) -- 0:00:36 414000 -- (-1401.951) [-1401.984] (-1404.581) (-1404.715) * [-1404.470] (-1408.829) (-1404.631) (-1402.685) -- 0:00:36 414500 -- (-1404.849) [-1403.292] (-1402.848) (-1404.281) * [-1404.629] (-1412.146) (-1404.055) (-1402.685) -- 0:00:36 415000 -- (-1404.965) (-1404.128) (-1403.624) [-1404.481] * [-1402.229] (-1401.613) (-1403.400) (-1402.372) -- 0:00:36 Average standard deviation of split frequencies: 0.010139 415500 -- (-1405.040) [-1403.800] (-1402.401) (-1403.773) * (-1402.776) [-1400.927] (-1404.348) (-1402.695) -- 0:00:36 416000 -- (-1406.590) (-1403.992) [-1403.521] (-1402.966) * (-1404.350) (-1400.644) [-1403.331] (-1404.644) -- 0:00:36 416500 -- (-1401.580) (-1403.401) [-1403.120] (-1403.103) * [-1404.415] (-1401.505) (-1403.168) (-1404.431) -- 0:00:36 417000 -- (-1401.786) [-1402.307] (-1401.032) (-1402.580) * (-1402.063) (-1402.150) [-1401.437] (-1401.836) -- 0:00:36 417500 -- (-1400.913) [-1401.810] (-1401.099) (-1403.492) * [-1402.491] (-1401.706) (-1409.647) (-1402.590) -- 0:00:37 418000 -- (-1401.826) [-1404.770] (-1401.939) (-1403.735) * (-1402.400) (-1401.880) [-1404.437] (-1401.593) -- 0:00:37 418500 -- (-1404.239) (-1405.775) [-1401.878] (-1402.422) * (-1402.755) [-1400.570] (-1406.840) (-1401.779) -- 0:00:37 419000 -- [-1402.986] (-1404.179) (-1402.350) (-1403.972) * [-1403.219] (-1401.384) (-1404.705) (-1406.283) -- 0:00:37 419500 -- [-1403.178] (-1402.922) (-1403.724) (-1404.923) * (-1401.761) (-1401.023) (-1401.518) [-1402.165] -- 0:00:37 420000 -- [-1403.774] (-1401.025) (-1402.303) (-1404.846) * (-1404.734) (-1401.389) [-1403.488] (-1401.139) -- 0:00:37 Average standard deviation of split frequencies: 0.010380 420500 -- (-1402.240) [-1400.932] (-1402.296) (-1403.728) * (-1406.630) [-1401.284] (-1402.934) (-1401.698) -- 0:00:37 421000 -- (-1401.890) [-1403.011] (-1403.868) (-1402.519) * (-1403.695) [-1401.442] (-1404.207) (-1402.444) -- 0:00:37 421500 -- [-1402.598] (-1403.117) (-1402.970) (-1402.866) * (-1401.552) (-1401.146) (-1402.361) [-1401.693] -- 0:00:37 422000 -- (-1404.014) [-1404.387] (-1402.385) (-1406.560) * (-1403.235) [-1400.904] (-1403.201) (-1404.481) -- 0:00:36 422500 -- (-1405.748) (-1401.694) [-1404.234] (-1406.782) * (-1406.598) (-1402.257) (-1404.143) [-1402.676] -- 0:00:36 423000 -- (-1412.519) (-1404.896) (-1405.558) [-1403.271] * [-1401.984] (-1402.011) (-1404.965) (-1403.360) -- 0:00:36 423500 -- [-1402.357] (-1402.282) (-1404.849) (-1402.309) * (-1401.298) (-1407.267) (-1403.619) [-1402.836] -- 0:00:36 424000 -- (-1402.237) (-1401.962) (-1405.060) [-1402.281] * [-1402.356] (-1403.873) (-1403.657) (-1400.851) -- 0:00:36 424500 -- (-1402.076) (-1402.022) (-1401.364) [-1401.718] * [-1402.799] (-1405.474) (-1403.510) (-1404.253) -- 0:00:36 425000 -- [-1401.441] (-1402.476) (-1401.817) (-1406.082) * [-1404.945] (-1401.354) (-1403.802) (-1403.556) -- 0:00:36 Average standard deviation of split frequencies: 0.009959 425500 -- [-1403.796] (-1405.293) (-1402.337) (-1408.724) * (-1403.380) (-1403.003) [-1402.391] (-1403.434) -- 0:00:36 426000 -- (-1404.845) [-1403.604] (-1403.796) (-1402.549) * [-1402.791] (-1404.692) (-1402.381) (-1405.582) -- 0:00:36 426500 -- (-1400.949) (-1405.783) [-1401.653] (-1402.254) * (-1403.893) (-1403.271) [-1403.326] (-1408.680) -- 0:00:36 427000 -- (-1403.709) [-1401.387] (-1402.175) (-1403.608) * [-1403.313] (-1405.988) (-1406.465) (-1405.551) -- 0:00:36 427500 -- (-1402.668) [-1401.621] (-1402.472) (-1406.342) * (-1401.087) [-1402.733] (-1403.223) (-1408.981) -- 0:00:36 428000 -- (-1408.209) (-1406.787) [-1403.003] (-1406.345) * [-1401.087] (-1403.998) (-1413.165) (-1402.979) -- 0:00:36 428500 -- (-1402.374) (-1402.639) (-1411.114) [-1403.218] * (-1402.107) [-1402.454] (-1403.995) (-1403.116) -- 0:00:36 429000 -- (-1403.056) (-1402.593) [-1403.210] (-1402.388) * (-1400.925) (-1405.121) (-1403.868) [-1401.825] -- 0:00:35 429500 -- [-1405.136] (-1402.080) (-1403.323) (-1402.014) * [-1401.567] (-1403.854) (-1402.177) (-1404.723) -- 0:00:35 430000 -- [-1403.262] (-1403.939) (-1402.382) (-1403.196) * [-1400.610] (-1403.027) (-1402.173) (-1403.539) -- 0:00:35 Average standard deviation of split frequencies: 0.009909 430500 -- (-1402.758) (-1405.097) [-1406.541] (-1403.375) * (-1404.852) [-1403.631] (-1403.050) (-1405.820) -- 0:00:35 431000 -- (-1402.637) (-1404.623) (-1403.905) [-1402.587] * (-1401.729) (-1404.537) [-1401.174] (-1403.437) -- 0:00:35 431500 -- (-1404.162) (-1401.352) (-1403.665) [-1405.465] * (-1403.319) (-1403.315) [-1401.174] (-1405.254) -- 0:00:35 432000 -- (-1403.525) [-1402.876] (-1401.279) (-1403.596) * (-1402.773) (-1402.661) [-1402.512] (-1403.785) -- 0:00:35 432500 -- (-1401.425) (-1404.690) (-1403.603) [-1404.119] * (-1402.984) (-1401.531) [-1402.971] (-1402.556) -- 0:00:35 433000 -- (-1401.896) (-1404.126) (-1405.125) [-1403.869] * (-1406.905) (-1403.749) [-1401.670] (-1402.981) -- 0:00:36 433500 -- (-1404.401) (-1401.521) [-1404.598] (-1402.132) * (-1407.833) (-1404.557) [-1401.932] (-1402.753) -- 0:00:36 434000 -- (-1404.632) (-1403.679) [-1403.389] (-1403.642) * (-1403.762) [-1401.577] (-1401.815) (-1401.584) -- 0:00:36 434500 -- (-1408.722) [-1403.338] (-1402.770) (-1405.124) * (-1402.992) (-1403.172) [-1401.767] (-1403.235) -- 0:00:36 435000 -- [-1404.375] (-1400.768) (-1408.498) (-1401.416) * (-1405.915) (-1403.505) [-1401.766] (-1402.201) -- 0:00:36 Average standard deviation of split frequencies: 0.009902 435500 -- (-1402.325) (-1400.905) [-1405.170] (-1401.816) * (-1406.122) (-1407.054) (-1402.869) [-1402.608] -- 0:00:36 436000 -- (-1404.974) (-1401.164) (-1400.978) [-1401.906] * (-1401.362) [-1401.355] (-1401.770) (-1402.584) -- 0:00:36 436500 -- [-1406.612] (-1402.277) (-1400.631) (-1401.812) * (-1401.068) (-1401.890) [-1401.649] (-1405.212) -- 0:00:36 437000 -- (-1402.492) [-1403.014] (-1400.749) (-1408.050) * (-1401.929) (-1402.262) [-1403.089] (-1402.937) -- 0:00:36 437500 -- [-1402.448] (-1401.894) (-1402.019) (-1405.766) * (-1403.208) (-1402.083) (-1402.805) [-1403.273] -- 0:00:36 438000 -- (-1402.940) (-1403.135) (-1402.658) [-1402.932] * (-1401.664) [-1402.468] (-1401.764) (-1403.195) -- 0:00:35 438500 -- [-1403.219] (-1404.316) (-1400.902) (-1401.313) * (-1403.987) [-1401.592] (-1405.352) (-1402.021) -- 0:00:35 439000 -- (-1401.571) (-1402.299) (-1401.671) [-1403.269] * [-1403.877] (-1403.596) (-1404.032) (-1402.542) -- 0:00:35 439500 -- (-1401.801) (-1401.209) (-1402.127) [-1405.729] * (-1403.175) (-1403.569) [-1403.476] (-1403.839) -- 0:00:35 440000 -- (-1402.264) [-1400.541] (-1403.265) (-1401.512) * (-1403.750) (-1402.206) [-1403.347] (-1402.895) -- 0:00:35 Average standard deviation of split frequencies: 0.009684 440500 -- (-1404.096) (-1400.600) (-1401.586) [-1402.190] * (-1405.520) [-1401.359] (-1403.651) (-1403.146) -- 0:00:35 441000 -- (-1403.128) (-1400.958) [-1401.681] (-1403.108) * (-1403.270) [-1401.460] (-1405.478) (-1400.877) -- 0:00:35 441500 -- [-1407.590] (-1400.545) (-1401.019) (-1403.666) * (-1405.062) (-1402.828) (-1401.427) [-1401.555] -- 0:00:35 442000 -- (-1402.997) (-1400.631) (-1404.945) [-1403.567] * [-1404.107] (-1406.670) (-1401.391) (-1402.928) -- 0:00:35 442500 -- [-1401.757] (-1402.025) (-1401.910) (-1402.635) * (-1402.237) (-1404.210) (-1402.237) [-1401.448] -- 0:00:35 443000 -- (-1402.082) [-1401.935] (-1401.975) (-1405.939) * [-1402.193] (-1400.540) (-1402.265) (-1404.608) -- 0:00:35 443500 -- (-1403.737) (-1402.188) (-1402.701) [-1402.440] * [-1401.569] (-1401.981) (-1403.043) (-1404.705) -- 0:00:35 444000 -- (-1405.940) (-1402.683) [-1402.108] (-1402.824) * (-1402.308) (-1405.510) [-1403.187] (-1403.489) -- 0:00:35 444500 -- (-1402.331) (-1403.224) (-1401.709) [-1401.854] * [-1401.364] (-1403.040) (-1402.996) (-1401.167) -- 0:00:34 445000 -- (-1402.944) (-1401.070) [-1401.466] (-1403.264) * (-1404.658) (-1402.177) (-1401.896) [-1401.177] -- 0:00:34 Average standard deviation of split frequencies: 0.009290 445500 -- (-1402.731) (-1403.667) [-1402.125] (-1401.312) * (-1402.328) (-1402.382) [-1403.014] (-1400.913) -- 0:00:34 446000 -- (-1404.752) (-1407.657) [-1402.092] (-1401.997) * (-1401.128) (-1407.061) [-1403.004] (-1402.654) -- 0:00:34 446500 -- (-1405.321) (-1406.029) [-1401.789] (-1404.692) * (-1402.489) [-1401.994] (-1402.171) (-1401.517) -- 0:00:34 447000 -- (-1405.528) (-1403.760) [-1401.626] (-1408.652) * [-1404.320] (-1403.355) (-1403.358) (-1404.367) -- 0:00:34 447500 -- (-1404.369) (-1409.898) [-1402.127] (-1404.598) * [-1402.094] (-1403.122) (-1406.010) (-1402.552) -- 0:00:34 448000 -- [-1403.428] (-1404.521) (-1402.539) (-1406.916) * (-1403.070) (-1402.785) [-1405.080] (-1407.508) -- 0:00:34 448500 -- (-1401.780) (-1401.607) [-1401.516] (-1404.057) * (-1400.960) [-1402.498] (-1405.931) (-1411.425) -- 0:00:34 449000 -- (-1403.169) (-1402.069) (-1404.213) [-1404.107] * (-1400.978) [-1405.631] (-1407.000) (-1403.931) -- 0:00:35 449500 -- [-1404.119] (-1401.807) (-1401.853) (-1403.352) * (-1401.610) (-1403.722) [-1406.318] (-1403.917) -- 0:00:35 450000 -- (-1405.753) (-1403.252) (-1405.093) [-1404.577] * [-1401.641] (-1401.972) (-1402.256) (-1402.426) -- 0:00:35 Average standard deviation of split frequencies: 0.009689 450500 -- (-1405.634) [-1403.730] (-1405.093) (-1407.515) * (-1403.719) (-1406.534) [-1407.698] (-1403.613) -- 0:00:35 451000 -- (-1403.251) (-1404.334) (-1401.915) [-1402.109] * (-1403.947) (-1410.403) (-1405.118) [-1407.353] -- 0:00:35 451500 -- [-1402.843] (-1403.245) (-1402.486) (-1401.490) * [-1401.756] (-1408.808) (-1404.612) (-1407.693) -- 0:00:35 452000 -- (-1405.417) (-1405.180) [-1403.306] (-1408.053) * (-1401.919) (-1408.754) (-1405.220) [-1403.135] -- 0:00:35 452500 -- (-1407.587) (-1401.514) [-1403.426] (-1402.565) * [-1404.483] (-1403.897) (-1401.746) (-1403.515) -- 0:00:35 453000 -- (-1405.038) (-1404.072) [-1402.999] (-1405.456) * (-1405.370) (-1403.921) [-1401.758] (-1406.268) -- 0:00:35 453500 -- (-1404.340) (-1401.101) (-1401.734) [-1402.448] * (-1403.336) (-1403.288) (-1401.658) [-1402.511] -- 0:00:34 454000 -- (-1404.786) (-1401.656) (-1400.589) [-1402.376] * (-1403.534) [-1402.023] (-1403.628) (-1403.178) -- 0:00:34 454500 -- [-1402.814] (-1408.995) (-1401.956) (-1402.297) * (-1401.363) (-1401.359) [-1402.458] (-1401.765) -- 0:00:34 455000 -- [-1402.051] (-1402.086) (-1402.131) (-1404.618) * (-1405.857) [-1401.879] (-1403.258) (-1403.356) -- 0:00:34 Average standard deviation of split frequencies: 0.009630 455500 -- (-1402.437) [-1401.145] (-1401.922) (-1404.911) * (-1401.403) (-1402.385) [-1402.727] (-1402.838) -- 0:00:34 456000 -- (-1401.537) (-1402.230) (-1403.318) [-1402.355] * [-1402.674] (-1402.750) (-1401.718) (-1403.615) -- 0:00:34 456500 -- (-1404.921) [-1401.649] (-1403.415) (-1402.209) * [-1402.866] (-1405.638) (-1401.399) (-1402.997) -- 0:00:34 457000 -- [-1402.446] (-1402.897) (-1403.550) (-1402.520) * [-1404.894] (-1402.889) (-1402.163) (-1402.187) -- 0:00:34 457500 -- (-1403.577) [-1403.016] (-1400.973) (-1402.453) * [-1401.029] (-1402.315) (-1403.864) (-1401.961) -- 0:00:34 458000 -- (-1402.951) [-1400.946] (-1400.699) (-1407.179) * (-1400.625) (-1401.603) (-1402.745) [-1401.383] -- 0:00:34 458500 -- (-1405.132) (-1401.197) [-1404.942] (-1404.242) * (-1402.150) [-1402.431] (-1402.307) (-1401.267) -- 0:00:34 459000 -- (-1404.159) (-1401.438) (-1406.668) [-1401.808] * (-1404.153) (-1401.114) (-1402.784) [-1400.991] -- 0:00:34 459500 -- (-1402.414) (-1403.184) (-1405.794) [-1401.095] * [-1405.539] (-1401.113) (-1402.786) (-1400.991) -- 0:00:34 460000 -- [-1402.328] (-1400.552) (-1402.105) (-1406.575) * (-1402.559) [-1401.187] (-1404.152) (-1402.657) -- 0:00:34 Average standard deviation of split frequencies: 0.009425 460500 -- (-1408.322) [-1402.305] (-1402.157) (-1407.308) * (-1402.867) [-1403.979] (-1403.635) (-1402.481) -- 0:00:33 461000 -- (-1403.453) (-1401.635) (-1402.349) [-1402.028] * (-1403.108) (-1401.844) [-1403.050] (-1402.062) -- 0:00:33 461500 -- (-1405.096) [-1402.840] (-1401.157) (-1402.779) * [-1401.766] (-1400.807) (-1402.776) (-1401.740) -- 0:00:33 462000 -- [-1406.828] (-1402.218) (-1402.164) (-1407.951) * (-1402.730) (-1401.227) (-1405.367) [-1402.040] -- 0:00:33 462500 -- (-1405.360) [-1402.253] (-1405.272) (-1405.041) * (-1403.563) (-1401.338) (-1403.947) [-1403.679] -- 0:00:33 463000 -- (-1402.898) (-1402.571) (-1404.028) [-1403.909] * (-1403.082) (-1401.272) (-1405.319) [-1403.550] -- 0:00:33 463500 -- (-1404.083) (-1401.877) [-1403.523] (-1404.511) * (-1406.716) (-1403.016) (-1405.847) [-1402.343] -- 0:00:33 464000 -- (-1403.386) [-1401.855] (-1401.224) (-1403.052) * [-1402.329] (-1405.160) (-1404.150) (-1402.673) -- 0:00:33 464500 -- (-1404.442) (-1403.420) (-1401.641) [-1405.237] * (-1402.556) (-1401.852) (-1402.920) [-1403.970] -- 0:00:33 465000 -- (-1403.749) (-1402.340) [-1400.882] (-1405.482) * (-1402.943) [-1406.622] (-1404.407) (-1402.322) -- 0:00:34 Average standard deviation of split frequencies: 0.009690 465500 -- [-1400.838] (-1401.571) (-1401.841) (-1402.129) * (-1402.137) (-1400.889) (-1404.676) [-1403.397] -- 0:00:34 466000 -- (-1400.840) [-1402.159] (-1401.605) (-1402.129) * [-1402.339] (-1402.891) (-1405.050) (-1405.146) -- 0:00:34 466500 -- (-1403.261) (-1407.888) (-1401.473) [-1402.923] * [-1401.672] (-1411.464) (-1404.691) (-1405.485) -- 0:00:34 467000 -- (-1403.122) [-1409.028] (-1401.291) (-1403.024) * (-1402.106) (-1405.169) [-1402.216] (-1406.231) -- 0:00:34 467500 -- (-1401.491) (-1401.279) [-1401.373] (-1401.354) * [-1402.139] (-1405.099) (-1402.564) (-1404.069) -- 0:00:34 468000 -- (-1405.111) (-1402.525) [-1401.114] (-1400.980) * (-1403.334) [-1404.808] (-1404.095) (-1406.451) -- 0:00:34 468500 -- (-1402.671) (-1402.954) (-1402.063) [-1401.017] * (-1404.314) (-1403.193) [-1403.279] (-1401.255) -- 0:00:34 469000 -- (-1402.758) (-1405.056) (-1405.200) [-1404.368] * [-1403.314] (-1402.251) (-1403.188) (-1403.491) -- 0:00:33 469500 -- (-1402.361) [-1407.051] (-1405.279) (-1402.744) * (-1403.461) [-1402.187] (-1405.539) (-1401.604) -- 0:00:33 470000 -- (-1403.755) (-1402.450) [-1401.235] (-1401.891) * (-1405.729) (-1401.186) (-1402.761) [-1401.431] -- 0:00:33 Average standard deviation of split frequencies: 0.009181 470500 -- (-1401.728) (-1405.768) (-1402.692) [-1401.418] * (-1402.054) [-1401.653] (-1402.837) (-1403.673) -- 0:00:33 471000 -- (-1401.523) (-1402.949) (-1402.285) [-1402.381] * (-1403.153) (-1401.390) [-1402.389] (-1401.813) -- 0:00:33 471500 -- [-1401.504] (-1406.887) (-1402.584) (-1404.294) * (-1402.156) [-1401.142] (-1401.838) (-1402.692) -- 0:00:33 472000 -- [-1400.853] (-1402.718) (-1402.010) (-1402.858) * (-1405.655) (-1402.428) [-1401.314] (-1402.391) -- 0:00:33 472500 -- (-1400.985) (-1403.801) [-1401.550] (-1400.965) * (-1403.844) (-1403.138) (-1402.326) [-1401.234] -- 0:00:33 473000 -- (-1401.026) (-1402.733) (-1404.742) [-1401.111] * [-1403.724] (-1402.774) (-1401.023) (-1401.346) -- 0:00:33 473500 -- (-1402.149) [-1404.830] (-1404.577) (-1401.115) * (-1404.695) [-1402.172] (-1401.469) (-1401.578) -- 0:00:33 474000 -- (-1401.318) [-1401.309] (-1405.513) (-1404.459) * (-1402.102) (-1401.012) (-1402.749) [-1402.377] -- 0:00:33 474500 -- (-1400.758) (-1406.178) [-1401.257] (-1402.119) * (-1402.461) (-1404.126) [-1403.082] (-1402.377) -- 0:00:33 475000 -- (-1401.839) (-1401.463) [-1405.939] (-1404.187) * (-1403.305) (-1404.077) [-1402.187] (-1403.537) -- 0:00:33 Average standard deviation of split frequencies: 0.009078 475500 -- (-1401.211) (-1401.711) (-1402.988) [-1401.971] * (-1403.577) [-1403.040] (-1407.510) (-1404.145) -- 0:00:33 476000 -- (-1401.698) (-1403.021) (-1403.913) [-1404.432] * (-1403.075) (-1402.252) (-1407.054) [-1403.790] -- 0:00:33 476500 -- (-1403.893) (-1403.455) (-1402.004) [-1402.890] * (-1403.738) (-1404.151) (-1401.479) [-1400.907] -- 0:00:32 477000 -- (-1402.088) [-1402.093] (-1403.303) (-1402.328) * (-1405.402) (-1404.079) [-1408.187] (-1400.907) -- 0:00:32 477500 -- (-1403.972) [-1403.814] (-1404.525) (-1402.070) * (-1401.568) [-1404.609] (-1402.165) (-1401.120) -- 0:00:32 478000 -- (-1402.554) (-1405.424) (-1403.662) [-1402.093] * (-1405.018) [-1402.827] (-1404.147) (-1404.814) -- 0:00:32 478500 -- [-1402.833] (-1404.035) (-1402.599) (-1405.136) * (-1405.389) (-1402.806) [-1402.019] (-1402.425) -- 0:00:32 479000 -- (-1402.944) [-1404.173] (-1402.158) (-1402.799) * (-1404.827) (-1402.363) (-1402.860) [-1404.124] -- 0:00:32 479500 -- (-1403.883) (-1401.850) (-1402.887) [-1403.454] * (-1403.137) [-1404.524] (-1402.027) (-1403.145) -- 0:00:32 480000 -- (-1405.395) (-1403.346) (-1403.681) [-1404.851] * (-1404.204) (-1406.660) (-1404.835) [-1405.636] -- 0:00:32 Average standard deviation of split frequencies: 0.009045 480500 -- (-1405.275) (-1402.876) [-1405.518] (-1401.359) * [-1403.744] (-1402.623) (-1404.326) (-1407.457) -- 0:00:33 481000 -- (-1403.603) (-1402.703) (-1401.200) [-1401.867] * [-1402.333] (-1405.482) (-1407.013) (-1401.314) -- 0:00:33 481500 -- (-1401.767) [-1401.483] (-1400.839) (-1403.290) * (-1403.301) (-1402.738) (-1410.266) [-1401.350] -- 0:00:33 482000 -- (-1401.837) (-1404.239) (-1401.271) [-1403.389] * (-1402.432) [-1401.621] (-1406.234) (-1401.715) -- 0:00:33 482500 -- [-1402.903] (-1402.317) (-1400.895) (-1408.685) * (-1404.406) (-1401.833) (-1402.358) [-1402.838] -- 0:00:33 483000 -- (-1402.220) (-1403.239) [-1400.895] (-1405.595) * (-1405.122) (-1401.924) [-1401.506] (-1406.668) -- 0:00:33 483500 -- (-1402.060) (-1402.007) (-1402.840) [-1403.401] * [-1400.974] (-1401.927) (-1404.299) (-1407.012) -- 0:00:33 484000 -- (-1401.599) (-1403.173) [-1404.231] (-1403.648) * (-1400.974) (-1403.488) (-1405.421) [-1405.500] -- 0:00:33 484500 -- (-1401.766) (-1402.091) [-1404.847] (-1402.290) * [-1401.827] (-1402.369) (-1404.701) (-1402.265) -- 0:00:32 485000 -- (-1403.882) (-1402.008) (-1402.344) [-1402.567] * [-1401.642] (-1404.205) (-1404.840) (-1403.573) -- 0:00:32 Average standard deviation of split frequencies: 0.008945 485500 -- (-1401.894) (-1402.755) [-1402.159] (-1406.113) * [-1404.382] (-1403.121) (-1404.373) (-1401.100) -- 0:00:32 486000 -- (-1404.732) [-1402.446] (-1400.948) (-1405.407) * (-1401.075) [-1403.097] (-1401.638) (-1402.838) -- 0:00:32 486500 -- [-1401.801] (-1402.445) (-1402.073) (-1406.297) * (-1402.850) (-1403.404) [-1401.407] (-1405.335) -- 0:00:32 487000 -- (-1403.026) (-1402.635) (-1402.915) [-1401.898] * (-1402.605) [-1404.636] (-1402.354) (-1402.834) -- 0:00:32 487500 -- [-1402.978] (-1401.730) (-1403.043) (-1401.672) * (-1403.463) [-1404.560] (-1403.242) (-1403.684) -- 0:00:32 488000 -- (-1406.334) (-1401.798) (-1404.098) [-1401.068] * [-1402.248] (-1402.398) (-1402.453) (-1404.135) -- 0:00:32 488500 -- (-1408.310) (-1402.398) (-1404.048) [-1402.775] * [-1403.667] (-1402.631) (-1402.338) (-1402.482) -- 0:00:32 489000 -- [-1402.660] (-1401.649) (-1402.661) (-1403.155) * (-1402.525) (-1402.723) [-1402.338] (-1404.580) -- 0:00:32 489500 -- [-1401.740] (-1401.753) (-1404.595) (-1401.521) * (-1405.154) (-1404.542) (-1401.515) [-1401.682] -- 0:00:32 490000 -- (-1403.889) (-1405.594) (-1404.448) [-1402.152] * [-1404.224] (-1403.172) (-1401.598) (-1405.487) -- 0:00:32 Average standard deviation of split frequencies: 0.009155 490500 -- [-1403.202] (-1402.838) (-1402.679) (-1404.483) * (-1402.209) [-1404.357] (-1405.854) (-1401.673) -- 0:00:32 491000 -- (-1401.871) (-1402.502) (-1402.068) [-1403.558] * [-1402.670] (-1405.331) (-1403.070) (-1402.244) -- 0:00:32 491500 -- [-1402.773] (-1403.438) (-1403.487) (-1403.671) * [-1404.403] (-1403.632) (-1402.618) (-1403.526) -- 0:00:32 492000 -- (-1401.187) (-1402.288) [-1402.348] (-1402.815) * (-1403.316) (-1402.595) (-1402.171) [-1402.517] -- 0:00:32 492500 -- [-1401.793] (-1402.006) (-1401.637) (-1401.931) * (-1402.742) (-1404.277) (-1403.709) [-1403.172] -- 0:00:31 493000 -- (-1401.318) [-1402.842] (-1407.226) (-1405.447) * (-1402.233) (-1403.651) (-1402.665) [-1402.582] -- 0:00:31 493500 -- (-1401.212) (-1402.317) [-1404.225] (-1402.009) * (-1402.341) (-1406.118) (-1402.452) [-1406.315] -- 0:00:31 494000 -- (-1413.985) (-1404.732) [-1401.932] (-1403.871) * (-1403.008) (-1403.874) (-1402.243) [-1405.437] -- 0:00:31 494500 -- [-1402.250] (-1402.238) (-1402.302) (-1406.653) * [-1401.076] (-1408.250) (-1402.243) (-1405.680) -- 0:00:31 495000 -- (-1401.945) [-1403.085] (-1401.594) (-1403.721) * (-1402.565) (-1402.834) [-1400.803] (-1407.080) -- 0:00:31 Average standard deviation of split frequencies: 0.009448 495500 -- [-1408.585] (-1401.182) (-1401.509) (-1404.521) * (-1402.902) [-1405.997] (-1401.510) (-1402.317) -- 0:00:31 496000 -- (-1402.429) [-1400.938] (-1401.868) (-1402.968) * (-1402.411) (-1403.770) [-1401.995] (-1401.260) -- 0:00:32 496500 -- (-1403.442) (-1401.588) [-1402.971] (-1405.255) * (-1400.871) [-1403.868] (-1402.181) (-1400.878) -- 0:00:32 497000 -- (-1403.118) (-1400.878) [-1403.963] (-1402.188) * (-1401.459) (-1405.713) (-1407.371) [-1403.009] -- 0:00:32 497500 -- (-1401.158) [-1400.875] (-1405.334) (-1404.317) * (-1401.346) (-1401.992) (-1401.625) [-1404.200] -- 0:00:32 498000 -- (-1404.507) [-1401.416] (-1405.469) (-1404.094) * (-1404.935) [-1403.292] (-1402.442) (-1403.591) -- 0:00:32 498500 -- (-1401.054) (-1401.493) [-1403.615] (-1404.164) * [-1403.637] (-1403.329) (-1403.417) (-1406.408) -- 0:00:32 499000 -- (-1403.711) (-1404.596) (-1401.024) [-1406.158] * [-1402.656] (-1402.917) (-1404.002) (-1402.145) -- 0:00:32 499500 -- (-1401.962) (-1405.689) [-1404.333] (-1406.860) * (-1402.395) (-1403.007) (-1404.673) [-1404.027] -- 0:00:32 500000 -- (-1403.071) [-1403.649] (-1400.758) (-1406.212) * (-1401.420) (-1405.808) [-1404.031] (-1414.218) -- 0:00:32 Average standard deviation of split frequencies: 0.008474 500500 -- (-1402.826) (-1401.055) [-1403.660] (-1404.230) * (-1404.040) (-1403.630) (-1400.928) [-1407.677] -- 0:00:31 501000 -- (-1404.469) (-1401.660) [-1402.336] (-1403.044) * (-1401.736) (-1401.864) [-1402.083] (-1402.869) -- 0:00:31 501500 -- (-1401.904) [-1401.891] (-1403.224) (-1402.578) * (-1403.118) (-1409.708) [-1401.485] (-1403.219) -- 0:00:31 502000 -- (-1401.458) (-1401.418) (-1402.751) [-1401.489] * [-1402.353] (-1405.165) (-1402.144) (-1404.502) -- 0:00:31 502500 -- (-1401.230) (-1401.104) [-1401.955] (-1401.700) * (-1403.409) [-1401.748] (-1402.883) (-1403.042) -- 0:00:31 503000 -- (-1402.956) (-1401.678) [-1403.807] (-1401.272) * [-1402.296] (-1401.980) (-1403.239) (-1402.831) -- 0:00:31 503500 -- [-1401.740] (-1401.783) (-1402.516) (-1404.207) * (-1406.968) [-1401.438] (-1404.389) (-1405.704) -- 0:00:31 504000 -- (-1402.079) (-1404.087) [-1402.448] (-1402.613) * (-1402.213) (-1402.253) [-1403.276] (-1404.278) -- 0:00:31 504500 -- [-1401.971] (-1403.860) (-1403.179) (-1402.479) * [-1403.717] (-1404.560) (-1402.627) (-1401.724) -- 0:00:31 505000 -- [-1403.671] (-1403.713) (-1405.646) (-1402.453) * (-1406.734) [-1402.288] (-1401.909) (-1404.427) -- 0:00:31 Average standard deviation of split frequencies: 0.008878 505500 -- (-1401.584) (-1405.565) (-1405.302) [-1406.842] * (-1406.700) (-1402.947) [-1402.351] (-1407.390) -- 0:00:31 506000 -- (-1401.279) (-1402.685) [-1404.530] (-1405.002) * (-1406.368) (-1405.776) [-1402.057] (-1401.942) -- 0:00:31 506500 -- (-1403.673) [-1402.141] (-1403.910) (-1403.429) * (-1406.064) [-1404.996] (-1402.425) (-1403.636) -- 0:00:31 507000 -- (-1403.107) [-1401.876] (-1405.985) (-1402.715) * (-1410.114) (-1401.359) [-1403.249] (-1404.122) -- 0:00:31 507500 -- (-1404.777) (-1401.627) [-1404.421] (-1402.565) * [-1403.224] (-1401.748) (-1406.818) (-1407.292) -- 0:00:31 508000 -- (-1404.868) [-1402.990] (-1402.319) (-1406.433) * (-1406.549) [-1406.221] (-1407.941) (-1404.158) -- 0:00:30 508500 -- (-1401.210) (-1404.325) (-1404.051) [-1403.101] * [-1405.972] (-1403.821) (-1407.218) (-1403.496) -- 0:00:30 509000 -- [-1402.522] (-1407.044) (-1401.609) (-1406.148) * [-1401.528] (-1401.881) (-1404.326) (-1404.797) -- 0:00:30 509500 -- (-1402.294) (-1403.750) (-1401.521) [-1401.752] * (-1402.216) (-1402.673) [-1401.845] (-1401.637) -- 0:00:30 510000 -- (-1400.990) (-1404.139) (-1401.602) [-1401.289] * (-1401.758) (-1403.840) [-1402.460] (-1402.845) -- 0:00:30 Average standard deviation of split frequencies: 0.009014 510500 -- [-1402.269] (-1401.563) (-1402.070) (-1402.213) * (-1406.425) [-1403.790] (-1401.498) (-1401.835) -- 0:00:30 511000 -- (-1402.640) (-1402.900) (-1401.577) [-1403.691] * (-1402.761) (-1401.567) [-1403.043] (-1405.443) -- 0:00:30 511500 -- [-1402.449] (-1402.253) (-1401.180) (-1406.002) * (-1402.187) [-1402.465] (-1402.925) (-1406.893) -- 0:00:31 512000 -- (-1402.589) [-1401.657] (-1405.497) (-1404.403) * [-1402.373] (-1401.517) (-1403.682) (-1404.113) -- 0:00:31 512500 -- [-1401.818] (-1403.867) (-1403.769) (-1403.280) * (-1402.181) (-1401.779) (-1403.683) [-1402.609] -- 0:00:31 513000 -- [-1404.707] (-1404.183) (-1405.990) (-1404.759) * [-1405.798] (-1402.479) (-1407.662) (-1401.055) -- 0:00:31 513500 -- (-1401.961) (-1401.531) (-1401.045) [-1404.682] * (-1405.153) (-1403.216) (-1403.208) [-1403.625] -- 0:00:31 514000 -- (-1402.559) (-1401.270) (-1403.782) [-1403.842] * (-1402.054) [-1403.009] (-1401.708) (-1402.819) -- 0:00:31 514500 -- (-1406.770) (-1402.212) (-1403.742) [-1401.258] * (-1403.135) (-1403.192) [-1402.212] (-1403.166) -- 0:00:31 515000 -- (-1404.954) (-1407.002) (-1402.708) [-1404.686] * (-1406.697) (-1408.440) [-1407.797] (-1402.856) -- 0:00:31 Average standard deviation of split frequencies: 0.009189 515500 -- [-1403.447] (-1402.203) (-1404.339) (-1403.811) * (-1405.738) (-1408.004) [-1407.028] (-1404.048) -- 0:00:31 516000 -- (-1403.477) [-1402.381] (-1401.506) (-1402.369) * (-1402.796) (-1401.944) [-1404.128] (-1402.427) -- 0:00:30 516500 -- (-1405.302) (-1401.613) [-1401.200] (-1402.267) * (-1405.909) [-1402.217] (-1402.094) (-1401.200) -- 0:00:30 517000 -- (-1401.684) [-1403.187] (-1400.917) (-1403.836) * (-1402.250) [-1402.326] (-1401.568) (-1405.086) -- 0:00:30 517500 -- (-1401.966) (-1405.153) (-1404.249) [-1404.083] * [-1401.139] (-1401.793) (-1405.417) (-1404.551) -- 0:00:30 518000 -- (-1403.777) (-1405.231) [-1401.106] (-1402.110) * (-1403.184) [-1403.491] (-1404.277) (-1402.155) -- 0:00:30 518500 -- (-1402.320) (-1404.981) (-1402.982) [-1400.699] * [-1402.114] (-1401.904) (-1401.395) (-1404.960) -- 0:00:30 519000 -- (-1400.834) (-1402.737) [-1401.338] (-1401.791) * (-1404.244) [-1402.111] (-1401.840) (-1401.807) -- 0:00:30 519500 -- (-1402.858) (-1401.546) (-1402.547) [-1401.825] * (-1404.898) (-1402.520) [-1404.333] (-1403.386) -- 0:00:30 520000 -- (-1401.878) (-1405.721) [-1403.177] (-1403.230) * (-1403.337) [-1400.558] (-1406.144) (-1402.185) -- 0:00:30 Average standard deviation of split frequencies: 0.009320 520500 -- [-1400.823] (-1403.867) (-1402.883) (-1404.738) * [-1402.415] (-1401.869) (-1403.190) (-1402.572) -- 0:00:30 521000 -- [-1402.679] (-1406.414) (-1404.846) (-1400.856) * [-1403.038] (-1401.025) (-1404.272) (-1403.560) -- 0:00:30 521500 -- [-1401.564] (-1405.234) (-1402.910) (-1401.023) * (-1405.877) (-1401.023) (-1403.419) [-1401.027] -- 0:00:30 522000 -- (-1403.802) (-1406.717) (-1402.052) [-1402.787] * (-1403.439) (-1402.558) [-1402.867] (-1401.027) -- 0:00:30 522500 -- [-1405.167] (-1408.763) (-1401.966) (-1403.930) * [-1402.398] (-1402.815) (-1402.462) (-1402.761) -- 0:00:30 523000 -- (-1407.731) [-1405.859] (-1401.146) (-1406.149) * [-1404.789] (-1404.349) (-1403.305) (-1407.819) -- 0:00:30 523500 -- (-1402.645) (-1402.753) (-1400.955) [-1406.533] * (-1401.312) (-1404.315) (-1411.786) [-1407.291] -- 0:00:30 524000 -- [-1407.785] (-1405.833) (-1404.562) (-1404.993) * [-1402.392] (-1402.487) (-1403.957) (-1404.315) -- 0:00:29 524500 -- (-1401.766) (-1407.805) [-1404.482] (-1409.181) * (-1402.136) (-1402.594) (-1401.480) [-1402.007] -- 0:00:29 525000 -- (-1402.622) [-1402.861] (-1405.434) (-1403.578) * [-1401.701] (-1401.012) (-1402.157) (-1401.560) -- 0:00:29 Average standard deviation of split frequencies: 0.008962 525500 -- [-1405.030] (-1402.767) (-1404.714) (-1401.622) * [-1402.596] (-1401.208) (-1406.131) (-1401.615) -- 0:00:29 526000 -- (-1403.567) (-1403.766) [-1402.880] (-1401.594) * (-1404.710) (-1401.774) [-1404.340] (-1405.792) -- 0:00:29 526500 -- (-1406.238) [-1403.205] (-1402.682) (-1405.416) * (-1403.633) [-1401.347] (-1404.528) (-1403.669) -- 0:00:29 527000 -- (-1405.552) [-1402.701] (-1402.010) (-1401.299) * (-1401.365) (-1402.058) (-1402.323) [-1400.674] -- 0:00:30 527500 -- (-1405.114) (-1402.780) [-1403.939] (-1402.040) * [-1403.085] (-1401.960) (-1403.681) (-1401.351) -- 0:00:30 528000 -- (-1404.446) (-1403.063) [-1403.121] (-1404.825) * [-1401.089] (-1401.647) (-1401.692) (-1402.332) -- 0:00:30 528500 -- [-1402.305] (-1408.411) (-1403.244) (-1405.280) * (-1401.491) (-1401.619) [-1402.262] (-1401.905) -- 0:00:30 529000 -- (-1401.797) (-1405.584) (-1403.401) [-1401.334] * (-1402.195) (-1401.056) (-1405.874) [-1401.325] -- 0:00:30 529500 -- (-1408.047) [-1402.687] (-1402.920) (-1401.388) * (-1406.255) (-1405.660) (-1402.898) [-1402.373] -- 0:00:30 530000 -- [-1401.372] (-1405.499) (-1401.972) (-1403.769) * [-1401.075] (-1404.163) (-1402.254) (-1402.372) -- 0:00:30 Average standard deviation of split frequencies: 0.009249 530500 -- (-1403.904) (-1401.027) [-1402.198] (-1403.048) * (-1404.176) (-1404.152) [-1403.430] (-1405.132) -- 0:00:30 531000 -- (-1404.713) (-1401.230) [-1401.714] (-1401.769) * [-1402.679] (-1403.239) (-1404.166) (-1402.640) -- 0:00:30 531500 -- [-1403.096] (-1401.964) (-1402.195) (-1401.444) * (-1404.458) (-1403.527) (-1403.731) [-1406.199] -- 0:00:29 532000 -- (-1407.802) [-1402.614] (-1408.344) (-1402.813) * (-1403.765) (-1401.527) [-1402.654] (-1401.409) -- 0:00:29 532500 -- (-1405.428) (-1403.669) (-1404.663) [-1403.077] * (-1407.311) [-1404.705] (-1401.914) (-1401.268) -- 0:00:29 533000 -- (-1401.722) [-1405.835] (-1405.132) (-1404.160) * (-1406.664) [-1403.515] (-1404.880) (-1401.146) -- 0:00:29 533500 -- [-1405.130] (-1401.773) (-1403.126) (-1401.933) * [-1404.976] (-1403.310) (-1401.181) (-1402.159) -- 0:00:29 534000 -- (-1402.298) (-1403.280) (-1406.508) [-1401.294] * (-1405.490) (-1404.650) [-1402.287] (-1404.511) -- 0:00:29 534500 -- (-1405.383) [-1401.296] (-1408.502) (-1401.623) * [-1402.586] (-1402.304) (-1406.716) (-1400.793) -- 0:00:29 535000 -- [-1403.551] (-1400.766) (-1403.817) (-1400.651) * (-1402.484) (-1403.100) (-1404.059) [-1400.920] -- 0:00:29 Average standard deviation of split frequencies: 0.008898 535500 -- (-1403.462) [-1403.512] (-1403.510) (-1400.742) * [-1405.855] (-1403.013) (-1405.765) (-1402.105) -- 0:00:29 536000 -- (-1406.755) (-1406.059) (-1403.354) [-1401.139] * [-1405.955] (-1408.497) (-1403.996) (-1403.273) -- 0:00:29 536500 -- (-1401.471) (-1406.643) [-1401.035] (-1401.907) * (-1407.887) (-1402.345) (-1401.810) [-1403.327] -- 0:00:29 537000 -- (-1403.344) (-1406.633) [-1401.249] (-1400.992) * (-1404.939) (-1405.101) (-1403.920) [-1404.065] -- 0:00:29 537500 -- [-1403.120] (-1407.658) (-1402.656) (-1401.605) * (-1404.870) [-1403.747] (-1403.666) (-1403.566) -- 0:00:29 538000 -- (-1404.776) [-1404.241] (-1402.894) (-1404.051) * (-1402.563) (-1408.229) [-1402.951] (-1402.926) -- 0:00:29 538500 -- (-1403.861) (-1404.201) [-1401.899] (-1404.346) * (-1403.428) (-1408.894) [-1407.252] (-1403.138) -- 0:00:29 539000 -- (-1401.414) (-1403.232) (-1401.271) [-1406.168] * (-1402.418) (-1402.570) (-1402.440) [-1401.243] -- 0:00:29 539500 -- (-1404.708) [-1402.340] (-1401.243) (-1401.324) * (-1401.388) (-1402.158) (-1402.170) [-1403.700] -- 0:00:29 540000 -- (-1407.925) (-1402.573) [-1401.877] (-1404.319) * (-1400.784) [-1400.955] (-1400.928) (-1402.616) -- 0:00:28 Average standard deviation of split frequencies: 0.008555 540500 -- (-1403.865) (-1407.134) (-1405.278) [-1401.916] * (-1401.900) [-1400.918] (-1408.469) (-1401.870) -- 0:00:28 541000 -- (-1404.642) (-1401.961) [-1401.862] (-1401.125) * (-1403.226) (-1405.966) (-1403.550) [-1402.647] -- 0:00:28 541500 -- (-1404.323) (-1401.888) [-1401.087] (-1402.316) * [-1405.349] (-1405.763) (-1403.382) (-1402.635) -- 0:00:28 542000 -- [-1403.893] (-1403.359) (-1401.134) (-1401.999) * (-1404.275) (-1403.179) (-1402.280) [-1402.210] -- 0:00:28 542500 -- (-1401.376) [-1405.436] (-1403.286) (-1404.707) * (-1400.825) (-1404.429) [-1402.793] (-1402.045) -- 0:00:28 543000 -- (-1401.447) (-1403.323) (-1403.085) [-1400.796] * [-1408.818] (-1403.865) (-1404.237) (-1400.652) -- 0:00:29 543500 -- [-1403.452] (-1404.876) (-1405.742) (-1407.142) * (-1404.191) (-1402.826) (-1404.236) [-1404.544] -- 0:00:29 544000 -- (-1401.042) (-1404.126) [-1406.398] (-1403.083) * (-1402.540) [-1402.245] (-1401.831) (-1408.991) -- 0:00:29 544500 -- (-1401.495) (-1401.425) [-1402.671] (-1403.378) * (-1403.033) [-1402.269] (-1401.831) (-1404.105) -- 0:00:29 545000 -- [-1401.438] (-1403.947) (-1402.013) (-1404.014) * (-1405.695) [-1405.615] (-1402.729) (-1404.456) -- 0:00:29 Average standard deviation of split frequencies: 0.008735 545500 -- (-1402.638) (-1405.777) [-1404.306] (-1401.542) * (-1403.636) (-1403.909) [-1404.292] (-1402.801) -- 0:00:29 546000 -- (-1405.859) (-1403.494) (-1403.449) [-1402.539] * (-1402.165) (-1403.269) (-1404.628) [-1402.480] -- 0:00:29 546500 -- [-1402.676] (-1404.392) (-1402.766) (-1400.923) * [-1402.648] (-1403.331) (-1403.640) (-1404.578) -- 0:00:29 547000 -- (-1404.008) (-1402.696) [-1400.902] (-1400.921) * (-1403.742) (-1402.038) (-1404.413) [-1402.590] -- 0:00:28 547500 -- [-1406.107] (-1403.545) (-1402.995) (-1402.260) * (-1406.781) (-1401.859) [-1401.712] (-1403.843) -- 0:00:28 548000 -- (-1404.243) (-1405.641) [-1404.346] (-1401.678) * [-1401.601] (-1406.469) (-1402.835) (-1402.977) -- 0:00:28 548500 -- (-1404.714) (-1403.802) [-1406.190] (-1401.572) * (-1404.007) [-1400.932] (-1406.272) (-1403.747) -- 0:00:28 549000 -- (-1402.259) (-1405.871) (-1403.524) [-1401.456] * (-1404.016) [-1403.180] (-1407.598) (-1405.389) -- 0:00:28 549500 -- [-1403.396] (-1401.036) (-1402.265) (-1404.533) * (-1405.998) [-1401.446] (-1407.132) (-1405.389) -- 0:00:28 550000 -- [-1400.759] (-1404.923) (-1402.612) (-1407.110) * (-1406.924) (-1402.146) [-1404.696] (-1403.013) -- 0:00:28 Average standard deviation of split frequencies: 0.008186 550500 -- [-1401.929] (-1403.485) (-1403.446) (-1402.726) * (-1407.386) [-1401.985] (-1402.065) (-1403.492) -- 0:00:28 551000 -- (-1403.161) (-1402.150) (-1402.675) [-1404.137] * (-1405.479) (-1402.032) [-1401.203] (-1402.052) -- 0:00:28 551500 -- [-1404.689] (-1405.662) (-1405.270) (-1403.090) * (-1401.569) (-1402.477) (-1402.923) [-1403.422] -- 0:00:28 552000 -- [-1404.972] (-1404.649) (-1404.553) (-1403.954) * (-1401.132) [-1403.186] (-1406.804) (-1401.788) -- 0:00:28 552500 -- (-1405.433) (-1404.570) [-1401.848] (-1401.390) * (-1401.624) (-1403.322) [-1402.370] (-1400.705) -- 0:00:28 553000 -- [-1405.173] (-1404.070) (-1402.334) (-1401.567) * (-1402.749) (-1402.344) [-1402.151] (-1402.936) -- 0:00:28 553500 -- [-1402.305] (-1403.608) (-1405.962) (-1401.522) * [-1401.260] (-1403.595) (-1402.585) (-1401.661) -- 0:00:28 554000 -- (-1404.277) (-1401.994) (-1402.852) [-1402.007] * [-1402.420] (-1403.477) (-1405.268) (-1402.830) -- 0:00:28 554500 -- (-1403.356) [-1402.677] (-1401.431) (-1402.341) * (-1405.988) [-1402.444] (-1406.958) (-1403.750) -- 0:00:28 555000 -- (-1402.803) (-1402.966) [-1401.349] (-1401.942) * (-1405.538) (-1408.924) (-1402.257) [-1403.237] -- 0:00:28 Average standard deviation of split frequencies: 0.007065 555500 -- (-1402.302) (-1402.662) (-1401.156) [-1401.602] * (-1402.030) (-1403.719) (-1401.852) [-1401.676] -- 0:00:28 556000 -- (-1400.898) [-1404.462] (-1401.783) (-1401.925) * (-1402.203) (-1405.951) [-1402.672] (-1401.092) -- 0:00:27 556500 -- (-1405.176) (-1401.478) (-1402.375) [-1402.396] * [-1402.500] (-1403.152) (-1404.537) (-1402.526) -- 0:00:27 557000 -- (-1402.517) (-1402.271) (-1401.917) [-1403.251] * (-1403.728) (-1402.046) [-1403.518] (-1402.870) -- 0:00:27 557500 -- (-1404.140) [-1401.075] (-1402.989) (-1401.694) * [-1404.005] (-1404.966) (-1405.722) (-1401.019) -- 0:00:27 558000 -- [-1405.653] (-1403.512) (-1405.440) (-1404.721) * (-1402.128) (-1403.734) [-1403.223] (-1404.787) -- 0:00:27 558500 -- (-1407.231) [-1401.227] (-1403.754) (-1407.416) * [-1400.628] (-1400.916) (-1407.256) (-1403.787) -- 0:00:27 559000 -- (-1404.679) (-1404.166) (-1404.809) [-1408.356] * [-1402.167] (-1404.078) (-1405.015) (-1403.608) -- 0:00:27 559500 -- (-1402.020) [-1402.815] (-1404.604) (-1403.196) * (-1402.623) (-1409.790) (-1404.631) [-1402.708] -- 0:00:28 560000 -- (-1404.619) [-1405.431] (-1404.749) (-1405.820) * (-1400.757) (-1404.663) (-1404.179) [-1402.201] -- 0:00:28 Average standard deviation of split frequencies: 0.007357 560500 -- [-1402.043] (-1404.978) (-1407.517) (-1401.368) * (-1403.388) (-1402.549) [-1401.747] (-1402.171) -- 0:00:28 561000 -- [-1404.003] (-1408.896) (-1402.532) (-1401.077) * (-1403.453) (-1400.984) [-1404.504] (-1404.303) -- 0:00:28 561500 -- [-1401.500] (-1409.848) (-1402.530) (-1404.597) * (-1402.543) (-1402.087) (-1404.470) [-1402.682] -- 0:00:28 562000 -- [-1403.432] (-1402.453) (-1401.933) (-1406.817) * (-1403.769) [-1401.981] (-1402.633) (-1402.321) -- 0:00:28 562500 -- [-1402.963] (-1402.471) (-1403.097) (-1403.843) * (-1403.922) (-1403.002) (-1401.873) [-1402.379] -- 0:00:28 563000 -- [-1402.154] (-1402.116) (-1405.296) (-1403.439) * [-1402.494] (-1402.975) (-1402.217) (-1404.330) -- 0:00:27 563500 -- (-1402.779) (-1403.844) [-1402.815] (-1400.767) * [-1402.800] (-1406.275) (-1402.074) (-1415.505) -- 0:00:27 564000 -- (-1402.244) (-1402.200) [-1404.113] (-1402.318) * (-1401.195) (-1402.239) [-1404.097] (-1413.689) -- 0:00:27 564500 -- [-1402.045] (-1401.774) (-1407.465) (-1402.328) * [-1402.745] (-1404.486) (-1406.205) (-1403.958) -- 0:00:27 565000 -- [-1402.045] (-1402.993) (-1404.586) (-1402.693) * (-1406.329) (-1403.189) (-1405.589) [-1401.311] -- 0:00:27 Average standard deviation of split frequencies: 0.007808 565500 -- (-1401.412) (-1405.004) (-1404.321) [-1402.566] * (-1403.059) [-1401.888] (-1403.493) (-1401.875) -- 0:00:27 566000 -- (-1404.202) (-1401.754) [-1404.546] (-1402.986) * (-1401.759) (-1405.142) [-1402.568] (-1405.760) -- 0:00:27 566500 -- (-1405.754) (-1404.671) [-1403.336] (-1402.706) * (-1403.945) (-1401.670) [-1402.456] (-1403.139) -- 0:00:27 567000 -- (-1402.672) (-1403.302) [-1401.656] (-1408.235) * (-1404.173) (-1406.276) (-1402.718) [-1403.815] -- 0:00:27 567500 -- (-1401.843) (-1401.890) (-1402.667) [-1403.391] * (-1403.952) (-1404.925) [-1402.987] (-1402.364) -- 0:00:27 568000 -- (-1402.295) [-1404.903] (-1402.490) (-1402.653) * [-1403.164] (-1404.276) (-1407.070) (-1402.798) -- 0:00:27 568500 -- (-1401.497) (-1405.997) (-1402.850) [-1402.966] * (-1402.603) (-1402.605) [-1409.603] (-1400.945) -- 0:00:27 569000 -- (-1404.936) (-1401.145) (-1403.522) [-1401.056] * [-1403.401] (-1406.315) (-1404.056) (-1401.612) -- 0:00:27 569500 -- (-1405.147) [-1402.866] (-1401.451) (-1402.325) * [-1401.956] (-1403.146) (-1403.809) (-1401.678) -- 0:00:27 570000 -- (-1402.109) (-1402.523) (-1402.256) [-1402.403] * [-1402.001] (-1405.047) (-1403.344) (-1403.003) -- 0:00:27 Average standard deviation of split frequencies: 0.008002 570500 -- (-1401.367) [-1402.229] (-1402.399) (-1401.509) * (-1401.912) (-1401.071) [-1401.948] (-1404.980) -- 0:00:27 571000 -- (-1401.167) (-1402.807) (-1404.928) [-1401.406] * (-1403.457) [-1401.312] (-1401.948) (-1402.075) -- 0:00:27 571500 -- [-1403.528] (-1404.438) (-1405.590) (-1403.992) * [-1401.719] (-1407.248) (-1401.013) (-1404.391) -- 0:00:26 572000 -- (-1404.265) [-1402.865] (-1405.651) (-1402.028) * (-1401.226) (-1401.076) [-1400.829] (-1403.134) -- 0:00:26 572500 -- [-1402.969] (-1404.310) (-1405.375) (-1401.245) * [-1401.216] (-1403.346) (-1405.790) (-1405.667) -- 0:00:26 573000 -- (-1402.469) [-1405.165] (-1402.417) (-1401.623) * (-1400.873) [-1402.697] (-1403.581) (-1409.283) -- 0:00:26 573500 -- (-1402.038) (-1401.237) [-1402.468] (-1403.978) * (-1401.143) (-1405.550) (-1402.285) [-1404.312] -- 0:00:26 574000 -- (-1402.469) (-1403.545) [-1406.343] (-1402.158) * (-1404.837) (-1401.407) (-1401.962) [-1403.335] -- 0:00:26 574500 -- [-1402.641] (-1403.773) (-1402.607) (-1403.573) * [-1401.717] (-1403.936) (-1406.041) (-1403.982) -- 0:00:26 575000 -- (-1404.190) [-1404.178] (-1400.934) (-1404.679) * [-1402.024] (-1403.156) (-1404.244) (-1401.544) -- 0:00:26 Average standard deviation of split frequencies: 0.007468 575500 -- (-1403.884) (-1404.698) (-1405.720) [-1401.044] * (-1406.178) [-1400.960] (-1401.675) (-1402.867) -- 0:00:27 576000 -- (-1403.427) [-1404.232] (-1404.130) (-1403.761) * (-1402.145) (-1402.050) (-1402.716) [-1403.894] -- 0:00:27 576500 -- [-1405.206] (-1404.452) (-1405.584) (-1408.076) * [-1403.206] (-1405.516) (-1401.428) (-1405.414) -- 0:00:27 577000 -- (-1405.885) (-1403.068) [-1401.458] (-1405.911) * (-1403.840) (-1402.253) (-1402.972) [-1405.592] -- 0:00:27 577500 -- (-1404.832) [-1402.539] (-1402.318) (-1407.885) * (-1401.265) (-1401.437) (-1403.014) [-1401.417] -- 0:00:27 578000 -- (-1401.319) [-1402.571] (-1404.249) (-1401.731) * (-1401.733) (-1401.191) (-1402.771) [-1403.384] -- 0:00:27 578500 -- [-1402.939] (-1405.026) (-1403.318) (-1401.270) * (-1406.539) (-1401.473) [-1402.713] (-1403.741) -- 0:00:26 579000 -- (-1403.126) (-1403.047) (-1401.332) [-1401.885] * (-1403.755) (-1403.459) [-1402.803] (-1403.352) -- 0:00:26 579500 -- (-1407.818) (-1403.224) [-1401.860] (-1403.537) * (-1405.507) [-1403.794] (-1401.358) (-1402.783) -- 0:00:26 580000 -- (-1406.942) (-1402.166) (-1404.621) [-1405.537] * (-1406.055) (-1401.613) [-1401.507] (-1401.217) -- 0:00:26 Average standard deviation of split frequencies: 0.007415 580500 -- (-1405.408) (-1406.121) (-1406.477) [-1402.713] * (-1404.700) [-1402.487] (-1401.488) (-1402.590) -- 0:00:26 581000 -- (-1404.485) [-1403.226] (-1403.603) (-1403.008) * (-1403.665) (-1403.100) (-1402.851) [-1405.876] -- 0:00:26 581500 -- (-1406.434) (-1401.334) [-1404.715] (-1402.040) * (-1406.629) [-1401.460] (-1405.770) (-1404.130) -- 0:00:26 582000 -- (-1404.547) [-1401.887] (-1403.256) (-1406.392) * (-1407.196) (-1401.540) [-1402.723] (-1405.699) -- 0:00:26 582500 -- [-1402.759] (-1402.440) (-1403.232) (-1402.885) * [-1402.217] (-1404.903) (-1401.455) (-1404.901) -- 0:00:26 583000 -- (-1402.784) (-1401.236) [-1401.696] (-1403.054) * (-1403.489) (-1403.108) (-1401.097) [-1403.612] -- 0:00:26 583500 -- (-1402.826) (-1401.345) (-1402.771) [-1401.927] * (-1403.110) (-1402.756) (-1403.751) [-1402.156] -- 0:00:26 584000 -- (-1404.469) [-1403.672] (-1401.919) (-1402.834) * (-1404.561) (-1402.902) (-1403.199) [-1401.401] -- 0:00:26 584500 -- (-1406.817) (-1403.625) [-1403.493] (-1404.714) * [-1403.423] (-1402.880) (-1401.278) (-1401.646) -- 0:00:26 585000 -- (-1404.411) (-1401.036) [-1401.543] (-1404.242) * (-1402.579) (-1403.140) [-1403.872] (-1403.279) -- 0:00:26 Average standard deviation of split frequencies: 0.006788 585500 -- (-1403.002) [-1403.252] (-1401.648) (-1403.485) * [-1402.780] (-1403.232) (-1401.160) (-1402.043) -- 0:00:26 586000 -- (-1401.046) [-1404.166] (-1401.270) (-1404.287) * (-1402.725) (-1406.681) (-1403.029) [-1400.955] -- 0:00:26 586500 -- (-1400.847) [-1402.014] (-1406.331) (-1402.673) * [-1404.333] (-1401.659) (-1404.093) (-1405.881) -- 0:00:26 587000 -- (-1403.327) (-1404.659) [-1404.471] (-1401.310) * (-1401.536) (-1403.651) (-1401.487) [-1404.919] -- 0:00:26 587500 -- (-1404.829) (-1405.101) [-1404.015] (-1404.244) * [-1401.753] (-1401.254) (-1401.429) (-1402.782) -- 0:00:25 588000 -- (-1404.031) (-1402.339) [-1402.852] (-1408.302) * [-1402.769] (-1401.686) (-1402.218) (-1406.400) -- 0:00:25 588500 -- (-1403.638) (-1402.569) [-1404.434] (-1401.675) * (-1403.097) [-1401.188] (-1404.135) (-1403.137) -- 0:00:25 589000 -- (-1403.040) (-1403.740) [-1402.320] (-1402.695) * (-1403.160) (-1402.405) [-1402.399] (-1405.979) -- 0:00:25 589500 -- [-1407.689] (-1404.245) (-1408.144) (-1403.546) * (-1407.996) (-1403.580) (-1406.922) [-1405.999] -- 0:00:25 590000 -- (-1404.674) (-1403.014) (-1405.378) [-1405.293] * [-1406.433] (-1404.718) (-1401.899) (-1404.553) -- 0:00:25 Average standard deviation of split frequencies: 0.006810 590500 -- [-1402.843] (-1401.928) (-1401.755) (-1406.467) * (-1402.144) (-1405.772) [-1402.309] (-1404.600) -- 0:00:25 591000 -- (-1401.821) (-1404.775) [-1405.178] (-1405.188) * (-1406.602) [-1406.506] (-1403.070) (-1403.774) -- 0:00:26 591500 -- (-1402.334) [-1403.564] (-1403.380) (-1408.639) * [-1405.127] (-1402.372) (-1402.775) (-1404.342) -- 0:00:26 592000 -- (-1404.522) (-1403.777) [-1403.250] (-1402.771) * (-1403.681) [-1405.750] (-1414.818) (-1403.777) -- 0:00:26 592500 -- (-1403.351) (-1405.962) (-1403.336) [-1401.987] * (-1407.924) [-1404.719] (-1406.507) (-1403.980) -- 0:00:26 593000 -- (-1403.468) (-1402.827) [-1404.856] (-1404.711) * (-1407.931) [-1401.382] (-1401.533) (-1402.105) -- 0:00:26 593500 -- (-1403.247) (-1402.460) [-1402.128] (-1402.246) * (-1403.570) [-1400.630] (-1400.941) (-1404.913) -- 0:00:26 594000 -- (-1403.256) (-1403.364) [-1407.947] (-1402.893) * (-1402.429) (-1403.018) [-1400.949] (-1402.614) -- 0:00:25 594500 -- [-1403.589] (-1403.934) (-1405.761) (-1403.901) * (-1405.957) (-1408.108) [-1400.855] (-1403.747) -- 0:00:25 595000 -- (-1404.940) [-1402.350] (-1402.605) (-1403.820) * (-1402.652) (-1402.588) (-1401.726) [-1401.941] -- 0:00:25 Average standard deviation of split frequencies: 0.006908 595500 -- (-1403.906) (-1404.714) (-1401.572) [-1401.496] * (-1401.083) (-1402.629) (-1404.168) [-1404.106] -- 0:00:25 596000 -- (-1401.935) (-1408.596) [-1403.603] (-1402.255) * [-1403.591] (-1401.885) (-1404.546) (-1402.867) -- 0:00:25 596500 -- (-1401.966) (-1403.655) (-1401.516) [-1402.791] * (-1403.797) (-1402.811) [-1401.521] (-1405.856) -- 0:00:25 597000 -- (-1404.021) [-1406.749] (-1403.046) (-1409.057) * (-1402.901) [-1403.785] (-1404.333) (-1406.859) -- 0:00:25 597500 -- (-1405.791) [-1404.013] (-1402.511) (-1403.838) * (-1402.026) (-1401.274) (-1404.581) [-1405.463] -- 0:00:25 598000 -- (-1403.834) (-1403.480) [-1402.705] (-1402.760) * (-1402.364) (-1403.134) (-1405.317) [-1404.513] -- 0:00:25 598500 -- (-1404.820) (-1403.492) [-1405.632] (-1401.557) * (-1402.364) (-1401.807) [-1403.936] (-1402.858) -- 0:00:25 599000 -- [-1405.773] (-1407.718) (-1407.437) (-1401.728) * (-1404.623) [-1403.859] (-1404.440) (-1402.934) -- 0:00:25 599500 -- (-1404.419) [-1404.257] (-1404.028) (-1403.283) * (-1404.502) (-1403.084) [-1401.957] (-1407.452) -- 0:00:25 600000 -- (-1405.584) (-1402.441) (-1405.133) [-1402.339] * [-1401.367] (-1403.610) (-1404.536) (-1401.742) -- 0:00:25 Average standard deviation of split frequencies: 0.007210 600500 -- (-1405.062) (-1402.306) [-1402.826] (-1401.133) * (-1401.944) (-1402.050) (-1400.837) [-1401.336] -- 0:00:25 601000 -- (-1402.892) [-1402.121] (-1407.229) (-1403.448) * (-1404.334) (-1401.894) [-1400.900] (-1402.125) -- 0:00:25 601500 -- [-1405.814] (-1404.577) (-1406.737) (-1405.089) * [-1404.513] (-1403.476) (-1403.427) (-1401.660) -- 0:00:25 602000 -- [-1404.500] (-1401.784) (-1404.025) (-1405.158) * (-1406.810) [-1403.474] (-1402.648) (-1402.516) -- 0:00:25 602500 -- [-1402.709] (-1402.547) (-1406.522) (-1403.507) * (-1407.861) (-1403.078) (-1403.246) [-1401.335] -- 0:00:25 603000 -- (-1401.662) (-1402.103) (-1407.821) [-1401.512] * (-1407.909) (-1402.279) (-1409.726) [-1406.422] -- 0:00:25 603500 -- [-1402.223] (-1401.431) (-1408.321) (-1403.451) * (-1406.997) (-1401.554) [-1404.166] (-1401.279) -- 0:00:24 604000 -- (-1401.237) (-1404.226) [-1405.252] (-1401.820) * (-1408.035) [-1404.029] (-1403.852) (-1401.535) -- 0:00:24 604500 -- (-1401.839) [-1402.559] (-1401.687) (-1401.638) * [-1403.848] (-1402.583) (-1402.830) (-1403.959) -- 0:00:24 605000 -- (-1401.948) (-1402.012) (-1403.880) [-1401.213] * (-1401.688) [-1406.488] (-1406.213) (-1404.022) -- 0:00:24 Average standard deviation of split frequencies: 0.007536 605500 -- [-1402.764] (-1403.645) (-1402.678) (-1404.141) * (-1402.114) [-1401.083] (-1407.332) (-1403.130) -- 0:00:24 606000 -- (-1403.283) (-1406.547) (-1403.139) [-1401.672] * [-1401.543] (-1406.183) (-1404.803) (-1402.043) -- 0:00:24 606500 -- [-1400.891] (-1406.196) (-1403.628) (-1402.470) * (-1401.715) (-1403.942) [-1403.374] (-1402.922) -- 0:00:25 607000 -- (-1401.605) (-1404.813) (-1403.757) [-1402.485] * (-1402.147) (-1404.874) (-1405.636) [-1403.468] -- 0:00:25 607500 -- (-1401.532) (-1402.778) (-1402.852) [-1404.553] * (-1401.303) [-1403.784] (-1403.113) (-1403.938) -- 0:00:25 608000 -- (-1401.614) [-1404.125] (-1402.847) (-1405.667) * [-1403.062] (-1401.117) (-1404.119) (-1401.256) -- 0:00:25 608500 -- [-1401.379] (-1405.230) (-1408.863) (-1403.147) * (-1403.214) [-1402.288] (-1404.121) (-1404.715) -- 0:00:25 609000 -- (-1401.053) [-1400.960] (-1403.023) (-1402.363) * (-1401.253) [-1401.803] (-1402.637) (-1403.806) -- 0:00:25 609500 -- (-1403.069) [-1401.222] (-1402.751) (-1402.427) * (-1401.365) [-1402.898] (-1404.143) (-1406.561) -- 0:00:24 610000 -- (-1401.997) [-1401.796] (-1401.880) (-1403.080) * [-1401.787] (-1402.547) (-1404.408) (-1406.061) -- 0:00:24 Average standard deviation of split frequencies: 0.006899 610500 -- (-1403.337) (-1401.882) (-1402.931) [-1401.432] * (-1402.347) (-1405.899) [-1401.837] (-1407.743) -- 0:00:24 611000 -- (-1404.726) [-1403.903] (-1407.726) (-1401.517) * (-1401.763) (-1402.444) (-1401.548) [-1406.627] -- 0:00:24 611500 -- (-1402.329) (-1402.577) (-1402.669) [-1401.726] * (-1405.517) [-1403.006] (-1401.301) (-1405.932) -- 0:00:24 612000 -- (-1402.811) (-1403.867) (-1403.131) [-1401.979] * (-1402.844) (-1401.915) (-1401.125) [-1405.259] -- 0:00:24 612500 -- (-1403.578) (-1403.876) (-1403.555) [-1401.292] * (-1401.452) [-1401.310] (-1401.140) (-1402.202) -- 0:00:24 613000 -- (-1405.076) (-1402.657) (-1409.138) [-1401.965] * (-1402.386) [-1402.529] (-1402.939) (-1402.341) -- 0:00:24 613500 -- (-1402.395) (-1402.430) [-1402.056] (-1401.834) * (-1403.294) (-1402.231) (-1402.510) [-1402.090] -- 0:00:24 614000 -- (-1401.395) (-1404.024) (-1404.570) [-1402.044] * [-1401.239] (-1403.024) (-1401.394) (-1405.660) -- 0:00:24 614500 -- (-1403.537) (-1401.348) (-1408.124) [-1401.284] * (-1403.647) [-1402.451] (-1403.356) (-1401.573) -- 0:00:24 615000 -- [-1403.565] (-1401.066) (-1403.532) (-1401.254) * [-1401.364] (-1401.105) (-1402.814) (-1401.589) -- 0:00:24 Average standard deviation of split frequencies: 0.006648 615500 -- (-1401.274) [-1401.248] (-1403.532) (-1405.293) * (-1401.146) (-1401.927) [-1402.394] (-1401.856) -- 0:00:24 616000 -- (-1403.539) (-1405.475) [-1400.904] (-1404.905) * (-1405.665) (-1402.822) [-1402.599] (-1402.316) -- 0:00:24 616500 -- [-1404.502] (-1405.873) (-1403.098) (-1405.993) * (-1403.791) (-1404.252) (-1403.452) [-1401.256] -- 0:00:24 617000 -- [-1403.200] (-1402.543) (-1404.426) (-1403.861) * [-1402.500] (-1402.038) (-1404.284) (-1403.534) -- 0:00:24 617500 -- (-1402.937) (-1401.190) [-1405.928] (-1404.154) * (-1404.340) [-1404.270] (-1402.692) (-1403.320) -- 0:00:24 618000 -- (-1404.474) (-1403.564) (-1404.876) [-1402.962] * (-1406.945) [-1401.109] (-1401.244) (-1402.896) -- 0:00:24 618500 -- (-1401.119) [-1402.199] (-1402.449) (-1404.068) * [-1406.357] (-1400.747) (-1400.768) (-1405.130) -- 0:00:24 619000 -- (-1402.332) [-1403.272] (-1403.559) (-1401.705) * [-1400.803] (-1400.736) (-1401.000) (-1403.017) -- 0:00:24 619500 -- [-1402.694] (-1406.445) (-1402.715) (-1404.589) * (-1400.887) (-1402.741) (-1401.247) [-1403.692] -- 0:00:23 620000 -- (-1402.673) (-1402.185) (-1401.833) [-1404.014] * [-1404.832] (-1402.896) (-1403.122) (-1409.124) -- 0:00:23 Average standard deviation of split frequencies: 0.006029 620500 -- (-1402.245) (-1402.388) (-1403.853) [-1402.863] * (-1402.353) (-1405.568) [-1402.266] (-1402.395) -- 0:00:23 621000 -- [-1402.079] (-1408.218) (-1403.149) (-1403.437) * (-1402.473) (-1405.196) (-1403.090) [-1403.667] -- 0:00:23 621500 -- (-1401.955) [-1402.255] (-1402.562) (-1405.310) * [-1402.012] (-1404.274) (-1403.332) (-1402.391) -- 0:00:23 622000 -- (-1402.114) (-1403.138) (-1402.610) [-1403.028] * (-1402.386) (-1404.724) [-1402.954] (-1403.228) -- 0:00:24 622500 -- (-1402.906) (-1404.221) (-1403.330) [-1402.770] * (-1402.366) [-1403.178] (-1402.798) (-1403.915) -- 0:00:24 623000 -- (-1406.285) (-1404.372) (-1406.528) [-1400.668] * (-1402.274) (-1402.769) [-1402.869] (-1406.056) -- 0:00:24 623500 -- (-1406.044) (-1402.360) (-1402.611) [-1402.195] * (-1401.057) [-1402.207] (-1405.252) (-1402.025) -- 0:00:24 624000 -- (-1401.076) [-1401.361] (-1407.086) (-1401.978) * (-1401.090) (-1402.781) [-1405.159] (-1403.066) -- 0:00:24 624500 -- (-1401.491) (-1405.671) (-1413.257) [-1402.110] * (-1401.082) [-1401.588] (-1403.240) (-1404.407) -- 0:00:24 625000 -- (-1401.763) (-1401.848) [-1408.715] (-1405.766) * (-1401.086) (-1401.897) (-1403.653) [-1404.617] -- 0:00:24 Average standard deviation of split frequencies: 0.006495 625500 -- [-1405.550] (-1403.852) (-1403.114) (-1404.459) * [-1400.561] (-1403.640) (-1406.348) (-1401.693) -- 0:00:23 626000 -- (-1405.313) (-1404.476) [-1402.627] (-1404.674) * (-1400.560) [-1404.055] (-1400.881) (-1407.092) -- 0:00:23 626500 -- (-1401.169) (-1406.930) [-1402.318] (-1404.523) * (-1406.048) [-1401.657] (-1401.432) (-1414.495) -- 0:00:23 627000 -- (-1401.199) (-1407.856) (-1404.336) [-1402.963] * (-1407.300) [-1406.414] (-1401.892) (-1401.832) -- 0:00:23 627500 -- (-1405.703) [-1403.534] (-1407.430) (-1402.201) * [-1402.863] (-1404.075) (-1405.677) (-1401.709) -- 0:00:23 628000 -- [-1405.612] (-1403.239) (-1408.438) (-1403.105) * [-1403.260] (-1401.888) (-1407.493) (-1402.388) -- 0:00:23 628500 -- [-1402.675] (-1402.424) (-1402.627) (-1401.127) * (-1402.877) (-1402.225) [-1406.281] (-1402.174) -- 0:00:23 629000 -- (-1402.424) (-1402.435) (-1402.632) [-1401.122] * (-1404.362) (-1402.336) [-1404.132] (-1403.128) -- 0:00:23 629500 -- (-1401.458) (-1405.438) (-1402.740) [-1401.083] * (-1402.871) (-1402.571) [-1401.250] (-1403.401) -- 0:00:23 630000 -- (-1403.291) (-1401.989) [-1402.688] (-1400.822) * (-1401.795) (-1402.496) [-1401.035] (-1403.173) -- 0:00:23 Average standard deviation of split frequencies: 0.006867 630500 -- (-1402.837) [-1406.217] (-1404.400) (-1401.581) * (-1404.216) (-1401.888) (-1404.302) [-1403.818] -- 0:00:23 631000 -- (-1402.751) (-1402.704) [-1401.436] (-1402.024) * (-1404.057) (-1403.690) (-1403.136) [-1403.198] -- 0:00:23 631500 -- (-1403.654) [-1402.289] (-1404.016) (-1402.919) * [-1403.372] (-1401.475) (-1405.713) (-1407.563) -- 0:00:23 632000 -- (-1402.654) (-1403.776) (-1403.120) [-1401.513] * (-1401.776) [-1402.162] (-1405.947) (-1410.888) -- 0:00:23 632500 -- (-1404.108) (-1401.157) (-1403.520) [-1401.256] * [-1402.533] (-1400.947) (-1404.636) (-1402.533) -- 0:00:23 633000 -- [-1403.814] (-1401.054) (-1404.395) (-1401.164) * (-1401.065) (-1402.275) (-1404.817) [-1401.464] -- 0:00:23 633500 -- [-1403.029] (-1403.357) (-1402.392) (-1400.953) * (-1401.452) (-1403.512) (-1402.440) [-1401.410] -- 0:00:23 634000 -- [-1406.491] (-1407.636) (-1401.593) (-1400.946) * (-1401.286) (-1405.012) [-1404.441] (-1401.464) -- 0:00:23 634500 -- (-1406.738) (-1407.440) (-1404.536) [-1400.987] * (-1401.450) (-1401.425) [-1401.999] (-1401.443) -- 0:00:23 635000 -- (-1405.585) (-1402.052) [-1401.506] (-1405.161) * [-1402.408] (-1405.280) (-1402.360) (-1402.854) -- 0:00:22 Average standard deviation of split frequencies: 0.006717 635500 -- (-1402.045) (-1402.148) [-1402.210] (-1403.753) * (-1403.691) [-1401.717] (-1402.321) (-1404.421) -- 0:00:22 636000 -- [-1402.111] (-1403.284) (-1401.664) (-1406.217) * [-1403.498] (-1403.786) (-1403.197) (-1402.710) -- 0:00:22 636500 -- (-1405.189) (-1403.030) (-1405.722) [-1409.890] * [-1401.811] (-1401.426) (-1404.337) (-1404.490) -- 0:00:22 637000 -- (-1402.723) (-1401.879) [-1406.163] (-1407.798) * [-1402.785] (-1401.321) (-1402.775) (-1402.569) -- 0:00:22 637500 -- (-1402.307) (-1402.247) [-1402.808] (-1401.703) * (-1403.002) (-1404.833) (-1403.644) [-1402.195] -- 0:00:23 638000 -- (-1403.488) [-1402.116] (-1402.439) (-1403.695) * (-1402.037) (-1404.210) [-1403.084] (-1403.797) -- 0:00:23 638500 -- (-1403.177) [-1401.810] (-1405.074) (-1401.777) * [-1401.664] (-1402.712) (-1402.257) (-1404.070) -- 0:00:23 639000 -- (-1405.481) (-1401.733) [-1402.629] (-1402.002) * (-1402.220) [-1401.866] (-1401.563) (-1402.886) -- 0:00:23 639500 -- (-1404.371) [-1407.320] (-1401.638) (-1409.100) * [-1401.812] (-1405.005) (-1403.140) (-1405.101) -- 0:00:23 640000 -- (-1402.813) (-1403.841) [-1402.940] (-1414.130) * (-1402.610) (-1404.462) [-1400.866] (-1406.131) -- 0:00:23 Average standard deviation of split frequencies: 0.006760 640500 -- [-1404.030] (-1402.448) (-1401.490) (-1410.049) * [-1400.735] (-1404.199) (-1407.179) (-1405.619) -- 0:00:23 641000 -- (-1403.158) [-1402.216] (-1401.430) (-1408.638) * (-1400.736) (-1408.062) [-1402.603] (-1402.429) -- 0:00:22 641500 -- (-1402.491) (-1403.371) [-1401.402] (-1403.193) * [-1401.747] (-1407.052) (-1402.878) (-1402.046) -- 0:00:22 642000 -- (-1401.591) (-1404.072) [-1403.530] (-1402.398) * (-1404.048) (-1402.918) [-1402.874] (-1404.783) -- 0:00:22 642500 -- (-1402.552) (-1404.072) (-1403.835) [-1402.495] * (-1404.601) (-1404.100) [-1400.928] (-1404.462) -- 0:00:22 643000 -- [-1403.557] (-1401.363) (-1402.809) (-1403.801) * [-1404.902] (-1402.198) (-1404.521) (-1403.860) -- 0:00:22 643500 -- (-1402.240) (-1401.990) (-1402.398) [-1401.655] * (-1406.898) [-1401.453] (-1403.115) (-1402.650) -- 0:00:22 644000 -- (-1402.261) [-1402.408] (-1405.042) (-1402.034) * (-1404.447) (-1402.518) [-1402.051] (-1403.261) -- 0:00:22 644500 -- (-1406.153) [-1403.223] (-1404.380) (-1404.005) * (-1403.622) [-1404.509] (-1402.420) (-1403.047) -- 0:00:22 645000 -- (-1404.233) [-1403.145] (-1406.551) (-1402.114) * [-1402.140] (-1403.360) (-1403.225) (-1402.672) -- 0:00:22 Average standard deviation of split frequencies: 0.006659 645500 -- (-1402.751) [-1402.101] (-1410.842) (-1402.019) * (-1401.574) (-1403.403) (-1402.840) [-1403.379] -- 0:00:22 646000 -- [-1405.868] (-1401.986) (-1401.407) (-1402.373) * (-1401.771) (-1404.192) (-1402.372) [-1403.317] -- 0:00:22 646500 -- (-1405.638) (-1401.978) [-1401.736] (-1403.297) * (-1400.801) [-1402.385] (-1402.898) (-1410.044) -- 0:00:22 647000 -- (-1402.699) (-1401.572) (-1402.530) [-1404.088] * (-1404.803) (-1405.326) [-1403.497] (-1403.528) -- 0:00:22 647500 -- [-1402.561] (-1403.597) (-1402.703) (-1404.114) * (-1403.690) [-1404.373] (-1401.579) (-1403.309) -- 0:00:22 648000 -- (-1406.000) (-1402.993) (-1404.577) [-1401.802] * [-1402.582] (-1404.420) (-1403.568) (-1403.802) -- 0:00:22 648500 -- [-1406.396] (-1405.139) (-1402.475) (-1402.437) * (-1403.202) (-1401.614) [-1404.483] (-1402.256) -- 0:00:22 649000 -- [-1405.332] (-1402.236) (-1400.721) (-1401.648) * [-1403.427] (-1402.511) (-1403.175) (-1404.488) -- 0:00:22 649500 -- (-1401.355) [-1401.273] (-1404.930) (-1404.153) * (-1404.731) (-1403.455) (-1403.447) [-1401.600] -- 0:00:22 650000 -- [-1404.217] (-1401.706) (-1403.902) (-1402.967) * (-1406.307) (-1402.893) (-1403.155) [-1401.295] -- 0:00:22 Average standard deviation of split frequencies: 0.006762 650500 -- [-1402.153] (-1403.025) (-1402.813) (-1402.330) * [-1406.085] (-1402.809) (-1403.154) (-1404.057) -- 0:00:22 651000 -- (-1405.392) (-1402.300) [-1403.311] (-1403.239) * (-1403.996) (-1402.178) [-1402.977] (-1405.787) -- 0:00:21 651500 -- (-1403.240) (-1402.747) [-1402.434] (-1401.691) * (-1401.707) (-1403.115) [-1404.887] (-1404.106) -- 0:00:21 652000 -- (-1405.208) (-1409.204) (-1403.113) [-1401.972] * [-1401.945] (-1402.353) (-1402.864) (-1403.746) -- 0:00:21 652500 -- (-1404.345) (-1404.467) [-1404.874] (-1401.717) * (-1402.361) (-1407.738) (-1401.438) [-1403.379] -- 0:00:21 653000 -- (-1401.584) (-1402.714) (-1404.327) [-1401.818] * (-1403.310) (-1405.564) [-1403.026] (-1402.037) -- 0:00:21 653500 -- (-1404.041) (-1403.704) [-1406.419] (-1401.614) * (-1403.271) [-1402.910] (-1402.949) (-1404.239) -- 0:00:22 654000 -- (-1402.076) [-1401.543] (-1402.737) (-1405.095) * [-1401.520] (-1403.239) (-1403.504) (-1404.570) -- 0:00:22 654500 -- (-1404.042) (-1401.772) (-1401.784) [-1406.205] * (-1404.055) (-1401.446) (-1404.286) [-1401.078] -- 0:00:22 655000 -- (-1402.788) [-1402.409] (-1402.663) (-1406.364) * (-1404.395) (-1401.254) (-1404.618) [-1401.927] -- 0:00:22 Average standard deviation of split frequencies: 0.006557 655500 -- (-1401.473) (-1403.173) (-1405.700) [-1407.277] * (-1404.105) [-1401.582] (-1403.819) (-1404.329) -- 0:00:22 656000 -- (-1403.539) (-1402.702) [-1402.627] (-1406.897) * [-1400.812] (-1401.626) (-1406.752) (-1401.045) -- 0:00:22 656500 -- [-1404.106] (-1403.243) (-1406.747) (-1406.652) * [-1402.653] (-1404.574) (-1413.752) (-1402.726) -- 0:00:21 657000 -- (-1402.916) [-1402.043] (-1403.548) (-1403.160) * (-1401.939) (-1401.938) (-1413.197) [-1403.263] -- 0:00:21 657500 -- (-1404.756) (-1405.562) [-1401.432] (-1402.441) * [-1401.824] (-1402.564) (-1407.574) (-1406.615) -- 0:00:21 658000 -- [-1402.651] (-1402.233) (-1401.352) (-1402.410) * [-1404.150] (-1404.811) (-1410.734) (-1406.347) -- 0:00:21 658500 -- [-1402.225] (-1401.940) (-1402.807) (-1402.651) * (-1404.089) (-1402.358) (-1404.473) [-1403.119] -- 0:00:21 659000 -- (-1401.421) (-1405.280) [-1401.426] (-1406.400) * (-1403.298) [-1402.191] (-1404.128) (-1402.539) -- 0:00:21 659500 -- (-1401.828) [-1404.167] (-1405.761) (-1404.666) * [-1403.260] (-1401.340) (-1404.828) (-1406.078) -- 0:00:21 660000 -- (-1404.292) [-1403.036] (-1405.127) (-1403.252) * [-1402.010] (-1402.796) (-1404.648) (-1407.029) -- 0:00:21 Average standard deviation of split frequencies: 0.007278 660500 -- (-1401.252) (-1403.934) [-1403.832] (-1402.763) * [-1402.270] (-1401.193) (-1404.296) (-1406.338) -- 0:00:21 661000 -- (-1402.594) (-1402.216) (-1406.407) [-1402.560] * (-1401.406) (-1401.131) (-1402.897) [-1405.348] -- 0:00:21 661500 -- [-1401.984] (-1401.127) (-1403.250) (-1401.149) * (-1401.616) [-1401.432] (-1401.317) (-1406.211) -- 0:00:21 662000 -- (-1401.647) [-1401.354] (-1402.038) (-1404.384) * (-1401.433) (-1402.070) (-1402.451) [-1404.692] -- 0:00:21 662500 -- (-1401.142) (-1401.181) [-1402.000] (-1405.361) * (-1401.464) [-1401.521] (-1404.210) (-1401.510) -- 0:00:21 663000 -- [-1403.145] (-1402.830) (-1405.169) (-1406.467) * (-1401.802) [-1406.313] (-1404.941) (-1402.489) -- 0:00:21 663500 -- (-1402.850) [-1404.561] (-1406.736) (-1402.876) * (-1401.260) (-1402.324) (-1404.612) [-1400.699] -- 0:00:21 664000 -- (-1401.786) [-1402.107] (-1405.632) (-1401.416) * (-1406.130) [-1404.795] (-1408.587) (-1402.002) -- 0:00:21 664500 -- [-1402.732] (-1404.717) (-1405.243) (-1409.964) * (-1403.416) (-1405.803) (-1406.931) [-1401.218] -- 0:00:21 665000 -- (-1402.474) (-1404.071) [-1403.379] (-1409.271) * (-1402.419) [-1401.788] (-1402.828) (-1402.424) -- 0:00:21 Average standard deviation of split frequencies: 0.007220 665500 -- (-1401.989) (-1407.473) [-1401.665] (-1404.594) * [-1403.223] (-1402.042) (-1405.474) (-1404.353) -- 0:00:21 666000 -- [-1405.022] (-1401.684) (-1401.519) (-1402.654) * (-1402.352) (-1403.264) (-1408.154) [-1403.948] -- 0:00:21 666500 -- (-1408.199) (-1401.775) [-1401.417] (-1402.457) * (-1402.753) [-1403.891] (-1402.099) (-1403.651) -- 0:00:21 667000 -- (-1403.025) [-1403.384] (-1402.808) (-1403.507) * (-1401.565) (-1403.121) [-1402.609] (-1406.232) -- 0:00:20 667500 -- (-1402.118) [-1403.407] (-1403.261) (-1408.165) * (-1401.751) [-1403.773] (-1402.355) (-1403.604) -- 0:00:20 668000 -- [-1401.325] (-1401.400) (-1402.631) (-1402.667) * (-1400.937) (-1403.223) [-1403.076] (-1405.296) -- 0:00:20 668500 -- (-1405.608) (-1401.458) [-1401.463] (-1402.822) * (-1400.936) (-1403.525) (-1402.945) [-1405.823] -- 0:00:20 669000 -- (-1405.625) (-1400.773) (-1403.100) [-1402.976] * (-1403.931) (-1407.018) [-1403.405] (-1403.405) -- 0:00:20 669500 -- (-1402.025) [-1401.898] (-1406.376) (-1401.967) * (-1401.785) [-1403.394] (-1402.948) (-1402.259) -- 0:00:21 670000 -- (-1402.889) (-1401.531) [-1402.119] (-1402.403) * (-1404.431) (-1404.053) (-1403.419) [-1402.514] -- 0:00:21 Average standard deviation of split frequencies: 0.007497 670500 -- (-1402.526) (-1401.864) (-1403.559) [-1402.261] * (-1402.859) (-1403.808) [-1404.635] (-1402.579) -- 0:00:21 671000 -- [-1402.106] (-1401.839) (-1403.193) (-1401.886) * (-1402.903) [-1402.404] (-1406.186) (-1401.984) -- 0:00:21 671500 -- (-1401.531) (-1403.750) (-1405.880) [-1401.639] * [-1403.697] (-1402.630) (-1406.597) (-1402.066) -- 0:00:21 672000 -- (-1401.522) (-1402.006) [-1402.662] (-1402.342) * (-1405.060) (-1402.155) [-1402.861] (-1403.308) -- 0:00:20 672500 -- (-1401.718) [-1403.009] (-1404.579) (-1402.033) * (-1402.867) (-1403.113) (-1402.479) [-1403.126] -- 0:00:20 673000 -- (-1401.736) (-1403.857) [-1402.070] (-1404.263) * (-1402.417) [-1403.365] (-1401.795) (-1400.644) -- 0:00:20 673500 -- (-1401.830) [-1403.556] (-1406.768) (-1402.239) * (-1402.628) [-1408.074] (-1403.239) (-1401.998) -- 0:00:20 674000 -- (-1403.083) [-1403.785] (-1402.316) (-1403.318) * [-1402.671] (-1407.908) (-1403.336) (-1401.687) -- 0:00:20 674500 -- (-1402.552) (-1405.089) (-1403.025) [-1402.960] * (-1402.541) (-1403.441) (-1406.660) [-1401.250] -- 0:00:20 675000 -- (-1404.270) (-1403.163) [-1403.028] (-1405.048) * (-1407.422) [-1405.862] (-1409.770) (-1402.043) -- 0:00:20 Average standard deviation of split frequencies: 0.007531 675500 -- (-1402.175) (-1406.633) [-1403.687] (-1407.172) * (-1406.665) [-1402.446] (-1405.228) (-1402.084) -- 0:00:20 676000 -- (-1400.935) (-1403.098) [-1403.686] (-1404.703) * (-1406.818) (-1403.888) (-1403.181) [-1402.653] -- 0:00:20 676500 -- [-1400.920] (-1403.593) (-1402.437) (-1404.835) * (-1408.036) (-1401.298) [-1403.185] (-1401.151) -- 0:00:20 677000 -- (-1405.593) (-1401.921) (-1402.879) [-1401.227] * (-1406.763) (-1402.178) (-1403.157) [-1402.342] -- 0:00:20 677500 -- [-1403.218] (-1402.789) (-1406.015) (-1401.996) * [-1403.439] (-1402.793) (-1402.910) (-1403.268) -- 0:00:20 678000 -- (-1403.600) [-1401.561] (-1401.611) (-1401.441) * (-1403.072) [-1401.316] (-1409.459) (-1403.723) -- 0:00:20 678500 -- (-1403.772) (-1405.337) (-1402.244) [-1402.236] * [-1401.976] (-1401.864) (-1402.546) (-1403.777) -- 0:00:20 679000 -- (-1403.355) (-1404.923) [-1401.578] (-1401.063) * (-1403.893) (-1402.124) (-1401.765) [-1401.692] -- 0:00:20 679500 -- [-1404.570] (-1401.441) (-1403.864) (-1401.591) * [-1403.605] (-1403.017) (-1401.104) (-1409.699) -- 0:00:20 680000 -- (-1403.211) (-1402.596) [-1402.266] (-1402.191) * [-1401.864] (-1406.898) (-1403.234) (-1404.550) -- 0:00:20 Average standard deviation of split frequencies: 0.007526 680500 -- (-1403.947) (-1400.814) (-1402.898) [-1403.077] * [-1401.805] (-1402.569) (-1403.248) (-1401.694) -- 0:00:20 681000 -- (-1402.174) (-1403.290) [-1402.394] (-1409.574) * (-1405.409) [-1402.731] (-1401.346) (-1408.381) -- 0:00:20 681500 -- (-1402.854) (-1404.442) [-1402.974] (-1405.521) * (-1401.841) [-1403.887] (-1404.754) (-1404.266) -- 0:00:20 682000 -- [-1410.981] (-1404.824) (-1406.171) (-1405.464) * (-1402.695) (-1402.933) (-1402.469) [-1402.363] -- 0:00:20 682500 -- (-1402.518) (-1402.261) (-1408.225) [-1402.635] * (-1401.831) (-1403.326) (-1403.811) [-1402.081] -- 0:00:20 683000 -- (-1405.440) (-1403.797) [-1403.687] (-1403.197) * (-1403.754) (-1402.588) (-1404.107) [-1402.091] -- 0:00:19 683500 -- (-1405.259) (-1405.006) [-1401.902] (-1404.599) * (-1403.660) (-1403.962) (-1402.188) [-1403.230] -- 0:00:19 684000 -- (-1402.170) [-1403.353] (-1403.185) (-1405.038) * (-1405.469) [-1405.378] (-1402.052) (-1401.730) -- 0:00:19 684500 -- (-1402.824) [-1400.718] (-1405.361) (-1403.920) * [-1402.637] (-1404.778) (-1401.887) (-1401.694) -- 0:00:19 685000 -- (-1402.858) (-1402.846) (-1403.689) [-1402.825] * (-1403.244) (-1402.202) [-1401.920] (-1404.287) -- 0:00:19 Average standard deviation of split frequencies: 0.007422 685500 -- (-1404.406) (-1403.407) [-1401.332] (-1402.362) * (-1401.052) (-1401.648) [-1403.567] (-1407.976) -- 0:00:20 686000 -- (-1402.252) (-1403.166) (-1403.067) [-1402.272] * (-1402.987) [-1401.745] (-1403.302) (-1401.878) -- 0:00:20 686500 -- [-1403.736] (-1411.055) (-1406.201) (-1404.270) * [-1404.085] (-1403.899) (-1403.950) (-1401.445) -- 0:00:20 687000 -- (-1402.632) (-1402.403) (-1404.637) [-1403.935] * (-1405.094) (-1402.853) (-1401.259) [-1404.591] -- 0:00:20 687500 -- (-1403.206) (-1401.472) (-1403.098) [-1405.541] * [-1405.105] (-1405.675) (-1402.663) (-1406.095) -- 0:00:20 688000 -- (-1406.547) (-1403.171) (-1402.703) [-1406.150] * (-1403.245) (-1402.719) (-1402.585) [-1403.335] -- 0:00:19 688500 -- (-1405.064) [-1404.509] (-1402.144) (-1403.872) * (-1401.716) [-1406.435] (-1404.098) (-1402.842) -- 0:00:19 689000 -- [-1403.932] (-1405.775) (-1400.939) (-1402.184) * (-1402.802) (-1405.324) (-1402.359) [-1402.691] -- 0:00:19 689500 -- (-1405.515) (-1403.845) (-1400.939) [-1402.012] * (-1403.535) [-1403.823] (-1402.902) (-1401.837) -- 0:00:19 690000 -- (-1402.084) (-1404.926) (-1401.717) [-1400.704] * (-1404.437) (-1401.569) (-1405.457) [-1401.913] -- 0:00:19 Average standard deviation of split frequencies: 0.007007 690500 -- (-1403.173) (-1403.420) [-1402.684] (-1404.477) * (-1404.061) (-1402.759) (-1403.391) [-1403.608] -- 0:00:19 691000 -- (-1402.806) [-1401.914] (-1402.867) (-1404.627) * (-1404.079) (-1406.293) [-1401.270] (-1401.520) -- 0:00:19 691500 -- [-1400.992] (-1401.971) (-1402.583) (-1404.406) * [-1405.263] (-1404.133) (-1402.038) (-1402.337) -- 0:00:19 692000 -- (-1401.555) (-1410.609) [-1403.140] (-1401.266) * (-1401.788) (-1402.234) (-1403.357) [-1402.479] -- 0:00:19 692500 -- [-1401.529] (-1406.511) (-1401.813) (-1402.252) * (-1401.952) [-1401.575] (-1401.730) (-1403.239) -- 0:00:19 693000 -- (-1403.568) (-1404.868) (-1400.961) [-1404.385] * (-1401.879) [-1408.026] (-1405.982) (-1401.715) -- 0:00:19 693500 -- (-1406.325) [-1403.194] (-1401.138) (-1403.461) * [-1402.137] (-1404.519) (-1402.904) (-1402.875) -- 0:00:19 694000 -- [-1400.807] (-1405.898) (-1406.572) (-1401.367) * (-1404.424) [-1403.409] (-1402.316) (-1402.155) -- 0:00:19 694500 -- (-1402.465) [-1401.062] (-1408.463) (-1408.808) * (-1401.037) [-1405.220] (-1400.928) (-1403.509) -- 0:00:19 695000 -- (-1405.647) (-1401.277) [-1405.723] (-1403.269) * (-1400.891) (-1401.972) [-1405.478] (-1402.397) -- 0:00:19 Average standard deviation of split frequencies: 0.007089 695500 -- (-1404.076) (-1401.797) [-1402.532] (-1403.413) * (-1402.072) [-1403.194] (-1402.897) (-1403.406) -- 0:00:19 696000 -- [-1405.584] (-1402.101) (-1401.878) (-1403.137) * [-1404.487] (-1403.004) (-1401.346) (-1404.027) -- 0:00:19 696500 -- (-1403.032) (-1402.719) [-1403.715] (-1405.928) * (-1402.729) (-1402.811) [-1401.407] (-1403.975) -- 0:00:19 697000 -- (-1401.805) [-1402.839] (-1403.614) (-1403.742) * (-1403.472) (-1404.656) (-1404.276) [-1402.036] -- 0:00:19 697500 -- [-1402.978] (-1401.056) (-1406.386) (-1403.816) * [-1403.674] (-1405.873) (-1401.758) (-1403.729) -- 0:00:19 698000 -- (-1405.031) [-1401.629] (-1401.645) (-1405.898) * (-1404.246) (-1403.997) [-1403.031] (-1402.898) -- 0:00:19 698500 -- [-1404.463] (-1401.803) (-1404.001) (-1404.155) * (-1401.318) (-1402.565) (-1403.441) [-1402.544] -- 0:00:18 699000 -- (-1403.411) (-1403.686) [-1403.580] (-1403.969) * (-1403.748) (-1402.866) (-1402.682) [-1404.207] -- 0:00:18 699500 -- (-1402.549) [-1404.577] (-1403.444) (-1405.626) * (-1402.365) (-1402.461) [-1402.008] (-1403.322) -- 0:00:18 700000 -- [-1402.491] (-1403.299) (-1404.006) (-1402.592) * (-1405.491) (-1404.500) [-1401.481] (-1401.923) -- 0:00:18 Average standard deviation of split frequencies: 0.006907 700500 -- (-1401.974) (-1402.817) (-1403.035) [-1401.698] * [-1401.382] (-1402.338) (-1401.300) (-1402.098) -- 0:00:18 701000 -- [-1401.363] (-1402.402) (-1403.591) (-1402.037) * (-1404.960) (-1402.228) (-1403.163) [-1404.261] -- 0:00:19 701500 -- (-1401.363) (-1403.343) (-1405.815) [-1402.114] * (-1408.932) (-1404.510) (-1405.590) [-1407.225] -- 0:00:19 702000 -- (-1402.429) [-1402.137] (-1404.622) (-1401.685) * (-1401.483) (-1402.081) [-1403.203] (-1404.096) -- 0:00:19 702500 -- [-1405.907] (-1403.632) (-1402.560) (-1402.513) * (-1401.840) (-1404.734) (-1403.278) [-1401.699] -- 0:00:19 703000 -- [-1403.166] (-1403.188) (-1404.649) (-1402.557) * (-1403.087) [-1402.099] (-1401.935) (-1404.083) -- 0:00:19 703500 -- (-1403.547) [-1401.711] (-1404.971) (-1402.522) * [-1401.389] (-1403.855) (-1401.802) (-1407.532) -- 0:00:18 704000 -- [-1401.960] (-1401.337) (-1402.379) (-1404.312) * (-1402.132) [-1403.432] (-1402.425) (-1405.028) -- 0:00:18 704500 -- (-1402.014) (-1403.576) [-1404.414] (-1402.975) * [-1402.376] (-1404.086) (-1404.378) (-1403.110) -- 0:00:18 705000 -- (-1402.426) (-1407.039) (-1406.672) [-1403.332] * (-1403.952) (-1401.309) (-1408.167) [-1402.744] -- 0:00:18 Average standard deviation of split frequencies: 0.007345 705500 -- (-1403.254) (-1405.991) [-1402.649] (-1401.259) * (-1402.312) [-1401.016] (-1402.481) (-1403.532) -- 0:00:18 706000 -- (-1404.701) (-1402.175) (-1401.917) [-1402.037] * (-1402.016) [-1402.030] (-1401.863) (-1402.917) -- 0:00:18 706500 -- (-1402.600) (-1401.498) [-1403.463] (-1401.766) * (-1401.288) (-1405.029) [-1401.594] (-1402.400) -- 0:00:18 707000 -- (-1403.065) (-1404.004) (-1402.637) [-1402.818] * (-1403.596) (-1404.081) [-1401.100] (-1403.113) -- 0:00:18 707500 -- (-1405.626) [-1402.274] (-1401.343) (-1401.713) * (-1401.351) (-1402.371) [-1401.986] (-1402.738) -- 0:00:18 708000 -- (-1406.225) [-1402.267] (-1401.579) (-1401.262) * (-1401.727) (-1401.306) [-1401.466] (-1401.547) -- 0:00:18 708500 -- (-1404.254) (-1402.038) (-1403.200) [-1401.046] * (-1405.801) (-1401.770) (-1401.961) [-1402.536] -- 0:00:18 709000 -- (-1403.340) (-1401.862) (-1401.988) [-1401.753] * (-1406.006) (-1402.047) [-1403.554] (-1404.016) -- 0:00:18 709500 -- (-1403.583) [-1403.724] (-1402.146) (-1403.015) * (-1403.639) [-1401.947] (-1402.244) (-1402.870) -- 0:00:18 710000 -- (-1404.277) (-1403.523) (-1401.958) [-1406.649] * (-1403.606) [-1401.131] (-1403.616) (-1403.435) -- 0:00:18 Average standard deviation of split frequencies: 0.006545 710500 -- (-1403.887) [-1402.789] (-1402.600) (-1404.162) * (-1402.312) [-1402.138] (-1414.217) (-1403.230) -- 0:00:18 711000 -- [-1401.686] (-1403.453) (-1403.026) (-1404.596) * [-1404.252] (-1401.483) (-1404.165) (-1401.521) -- 0:00:18 711500 -- (-1401.946) (-1403.591) [-1403.180] (-1408.740) * (-1404.938) (-1407.542) (-1402.394) [-1402.199] -- 0:00:18 712000 -- (-1401.428) (-1401.862) (-1402.583) [-1404.451] * (-1403.967) [-1402.857] (-1402.158) (-1403.893) -- 0:00:18 712500 -- (-1403.363) [-1402.334] (-1409.255) (-1403.131) * [-1403.028] (-1405.796) (-1402.158) (-1400.935) -- 0:00:18 713000 -- (-1402.958) (-1402.520) [-1406.549] (-1402.787) * [-1402.276] (-1405.950) (-1405.814) (-1405.784) -- 0:00:18 713500 -- (-1401.771) [-1402.378] (-1402.067) (-1402.994) * (-1403.725) (-1405.603) [-1403.259] (-1407.437) -- 0:00:18 714000 -- (-1401.623) [-1405.133] (-1403.059) (-1402.497) * (-1402.290) (-1402.295) [-1403.492] (-1407.160) -- 0:00:18 714500 -- [-1401.713] (-1402.726) (-1404.056) (-1403.615) * (-1401.614) [-1401.913] (-1402.673) (-1404.069) -- 0:00:17 715000 -- [-1402.691] (-1400.620) (-1406.418) (-1401.930) * [-1403.161] (-1401.844) (-1404.853) (-1404.201) -- 0:00:17 Average standard deviation of split frequencies: 0.006759 715500 -- (-1403.429) (-1401.649) [-1408.964] (-1401.612) * (-1403.082) (-1403.372) (-1403.084) [-1402.467] -- 0:00:17 716000 -- (-1404.173) (-1402.026) (-1411.507) [-1402.006] * (-1402.385) [-1403.899] (-1401.677) (-1405.769) -- 0:00:17 716500 -- [-1402.278] (-1403.551) (-1402.212) (-1401.788) * (-1402.867) [-1402.214] (-1402.507) (-1408.163) -- 0:00:17 717000 -- (-1405.370) [-1407.474] (-1401.965) (-1401.075) * [-1404.592] (-1404.021) (-1402.139) (-1406.413) -- 0:00:18 717500 -- (-1401.811) (-1406.664) (-1402.406) [-1404.862] * [-1401.391] (-1403.607) (-1400.760) (-1405.023) -- 0:00:18 718000 -- [-1404.689] (-1403.463) (-1401.887) (-1403.245) * (-1406.454) [-1400.870] (-1404.118) (-1404.448) -- 0:00:18 718500 -- (-1403.870) (-1402.947) [-1404.373] (-1401.866) * (-1403.371) (-1403.007) [-1403.839] (-1402.202) -- 0:00:18 719000 -- (-1401.931) (-1408.362) [-1401.548] (-1400.724) * (-1404.018) (-1402.374) (-1403.076) [-1402.821] -- 0:00:17 719500 -- (-1403.062) (-1403.618) [-1403.374] (-1405.199) * (-1403.340) (-1401.318) [-1401.251] (-1401.590) -- 0:00:17 720000 -- (-1401.372) [-1403.619] (-1401.592) (-1401.307) * (-1404.088) (-1403.089) (-1401.925) [-1401.596] -- 0:00:17 Average standard deviation of split frequencies: 0.006541 720500 -- (-1404.388) [-1402.970] (-1404.999) (-1402.606) * (-1401.359) [-1402.722] (-1401.329) (-1401.890) -- 0:00:17 721000 -- [-1404.056] (-1402.480) (-1401.390) (-1403.922) * [-1403.405] (-1403.766) (-1401.902) (-1401.914) -- 0:00:17 721500 -- [-1402.551] (-1401.376) (-1403.123) (-1407.498) * [-1403.561] (-1407.539) (-1401.229) (-1401.645) -- 0:00:17 722000 -- (-1404.380) (-1403.053) (-1403.389) [-1406.777] * (-1405.698) (-1406.894) [-1401.256] (-1402.486) -- 0:00:17 722500 -- (-1403.037) [-1401.223] (-1406.147) (-1404.501) * [-1405.614] (-1402.926) (-1407.343) (-1402.075) -- 0:00:17 723000 -- (-1403.086) [-1402.654] (-1402.303) (-1401.786) * (-1401.861) (-1402.609) (-1401.759) [-1404.278] -- 0:00:17 723500 -- (-1402.753) (-1402.944) [-1403.336] (-1404.028) * [-1405.466] (-1403.704) (-1401.780) (-1401.513) -- 0:00:17 724000 -- (-1403.985) [-1402.940] (-1401.622) (-1404.537) * [-1401.716] (-1402.242) (-1401.521) (-1404.215) -- 0:00:17 724500 -- (-1401.142) (-1402.692) [-1401.872] (-1402.717) * (-1401.705) (-1408.327) [-1401.088] (-1408.710) -- 0:00:17 725000 -- (-1402.603) (-1403.014) (-1402.687) [-1405.377] * [-1402.988] (-1406.414) (-1401.443) (-1403.638) -- 0:00:17 Average standard deviation of split frequencies: 0.006493 725500 -- [-1402.586] (-1402.943) (-1403.600) (-1401.757) * [-1406.002] (-1404.374) (-1400.695) (-1402.687) -- 0:00:17 726000 -- (-1403.171) (-1403.019) (-1404.221) [-1404.073] * (-1406.455) [-1405.549] (-1401.795) (-1404.497) -- 0:00:17 726500 -- (-1403.171) (-1401.100) [-1404.366] (-1405.086) * (-1401.532) (-1407.214) (-1401.946) [-1403.397] -- 0:00:17 727000 -- (-1403.527) [-1401.227] (-1402.132) (-1401.866) * [-1404.498] (-1405.958) (-1401.938) (-1403.214) -- 0:00:17 727500 -- (-1406.409) [-1402.061] (-1402.215) (-1405.823) * (-1402.584) [-1403.160] (-1405.924) (-1401.967) -- 0:00:17 728000 -- (-1402.737) (-1402.307) [-1402.770] (-1405.381) * (-1405.199) (-1403.188) [-1403.485] (-1404.498) -- 0:00:17 728500 -- (-1406.542) (-1401.910) [-1403.848] (-1404.758) * (-1404.704) (-1401.290) (-1404.183) [-1402.239] -- 0:00:17 729000 -- [-1403.767] (-1401.526) (-1401.531) (-1404.055) * [-1403.382] (-1401.033) (-1407.900) (-1403.792) -- 0:00:17 729500 -- [-1405.529] (-1404.140) (-1402.976) (-1405.296) * (-1406.602) [-1402.205] (-1407.207) (-1402.104) -- 0:00:17 730000 -- [-1403.619] (-1401.402) (-1404.337) (-1402.425) * [-1402.569] (-1402.975) (-1406.626) (-1403.467) -- 0:00:17 Average standard deviation of split frequencies: 0.006323 730500 -- (-1409.975) (-1409.284) [-1401.853] (-1404.885) * (-1402.300) (-1405.288) (-1403.017) [-1405.599] -- 0:00:16 731000 -- (-1403.738) (-1407.614) [-1402.960] (-1403.340) * (-1402.246) (-1401.472) [-1404.866] (-1404.545) -- 0:00:16 731500 -- (-1409.550) (-1407.421) [-1402.549] (-1402.080) * (-1401.179) [-1403.474] (-1403.523) (-1405.251) -- 0:00:16 732000 -- (-1405.501) (-1405.650) [-1402.497] (-1404.964) * [-1400.941] (-1403.264) (-1402.499) (-1403.480) -- 0:00:16 732500 -- (-1404.119) [-1403.438] (-1405.291) (-1402.770) * (-1402.579) (-1402.228) (-1403.740) [-1401.694] -- 0:00:17 733000 -- (-1404.785) (-1404.252) [-1402.286] (-1402.962) * [-1401.595] (-1401.533) (-1402.653) (-1403.595) -- 0:00:17 733500 -- [-1403.930] (-1411.333) (-1402.925) (-1401.894) * [-1401.929] (-1407.498) (-1401.790) (-1402.909) -- 0:00:17 734000 -- (-1409.666) (-1401.774) (-1402.861) [-1401.827] * (-1405.111) (-1406.215) (-1401.861) [-1404.102] -- 0:00:17 734500 -- (-1402.836) (-1405.498) (-1402.116) [-1402.525] * [-1401.839] (-1404.121) (-1401.075) (-1401.590) -- 0:00:16 735000 -- [-1402.865] (-1405.640) (-1402.928) (-1402.283) * (-1410.067) (-1401.733) [-1401.987] (-1403.000) -- 0:00:16 Average standard deviation of split frequencies: 0.006106 735500 -- (-1402.362) (-1404.004) [-1402.279] (-1403.990) * [-1403.576] (-1408.013) (-1404.785) (-1403.388) -- 0:00:16 736000 -- [-1402.317] (-1402.710) (-1402.481) (-1408.984) * (-1401.029) (-1402.671) (-1404.125) [-1402.157] -- 0:00:16 736500 -- (-1402.810) [-1402.786] (-1403.048) (-1404.276) * (-1400.923) (-1403.540) [-1402.212] (-1402.604) -- 0:00:16 737000 -- (-1405.954) (-1402.612) [-1401.606] (-1403.718) * (-1402.409) (-1407.189) (-1404.135) [-1402.499] -- 0:00:16 737500 -- [-1403.077] (-1405.504) (-1405.473) (-1403.268) * (-1403.843) (-1400.804) (-1401.533) [-1403.262] -- 0:00:16 738000 -- [-1402.933] (-1402.938) (-1401.643) (-1401.927) * (-1403.774) (-1402.154) [-1404.149] (-1401.969) -- 0:00:16 738500 -- (-1401.198) (-1404.231) [-1401.969] (-1401.658) * (-1405.083) (-1403.226) (-1403.640) [-1400.844] -- 0:00:16 739000 -- [-1403.064] (-1406.347) (-1405.925) (-1403.832) * (-1401.890) (-1401.863) (-1401.880) [-1402.711] -- 0:00:16 739500 -- [-1402.645] (-1402.759) (-1404.503) (-1404.266) * (-1406.588) (-1404.347) [-1400.969] (-1407.036) -- 0:00:16 740000 -- [-1403.113] (-1402.872) (-1405.085) (-1402.278) * (-1407.002) (-1402.996) (-1400.895) [-1402.720] -- 0:00:16 Average standard deviation of split frequencies: 0.006322 740500 -- (-1403.988) [-1401.668] (-1405.201) (-1403.340) * (-1402.824) [-1405.589] (-1401.324) (-1407.518) -- 0:00:16 741000 -- [-1404.203] (-1401.175) (-1407.129) (-1403.029) * (-1402.167) (-1402.197) [-1401.962] (-1402.834) -- 0:00:16 741500 -- (-1402.728) [-1402.617] (-1404.181) (-1402.396) * (-1405.598) [-1404.592] (-1402.478) (-1402.105) -- 0:00:16 742000 -- [-1402.945] (-1403.999) (-1403.381) (-1400.783) * (-1401.517) [-1404.746] (-1402.478) (-1403.894) -- 0:00:16 742500 -- (-1401.178) (-1402.359) (-1402.533) [-1400.873] * [-1402.955] (-1407.567) (-1402.283) (-1406.867) -- 0:00:16 743000 -- (-1403.643) (-1405.393) (-1405.471) [-1402.446] * [-1403.781] (-1405.426) (-1402.478) (-1402.555) -- 0:00:16 743500 -- (-1403.517) (-1401.483) [-1403.526] (-1403.688) * (-1403.389) (-1406.254) (-1403.210) [-1402.543] -- 0:00:16 744000 -- (-1401.947) [-1403.707] (-1401.906) (-1402.218) * (-1402.310) [-1402.540] (-1404.283) (-1403.931) -- 0:00:16 744500 -- (-1401.757) [-1404.234] (-1403.263) (-1402.359) * (-1401.537) (-1404.160) (-1401.949) [-1404.309] -- 0:00:16 745000 -- (-1401.344) [-1402.157] (-1402.227) (-1405.039) * (-1401.873) (-1406.051) [-1403.437] (-1402.616) -- 0:00:16 Average standard deviation of split frequencies: 0.006361 745500 -- (-1401.288) (-1402.833) [-1404.246] (-1402.948) * (-1402.267) (-1407.064) (-1403.339) [-1402.180] -- 0:00:16 746000 -- (-1403.100) (-1404.155) (-1405.389) [-1402.378] * (-1402.447) [-1403.986] (-1405.098) (-1402.611) -- 0:00:16 746500 -- (-1402.617) (-1407.048) [-1405.514] (-1403.286) * (-1402.905) [-1402.856] (-1401.961) (-1403.416) -- 0:00:15 747000 -- [-1403.088] (-1405.383) (-1403.798) (-1401.798) * [-1403.693] (-1401.334) (-1402.860) (-1401.508) -- 0:00:15 747500 -- (-1400.966) [-1403.629] (-1404.041) (-1402.241) * (-1400.781) (-1402.230) [-1403.918] (-1402.206) -- 0:00:15 748000 -- (-1402.481) (-1407.679) [-1402.982] (-1402.542) * [-1402.476] (-1402.224) (-1402.591) (-1402.956) -- 0:00:16 748500 -- (-1401.923) (-1408.871) (-1401.239) [-1403.235] * (-1404.209) (-1401.840) [-1405.246] (-1404.030) -- 0:00:16 749000 -- (-1401.765) [-1402.577] (-1403.635) (-1402.518) * (-1403.179) [-1403.880] (-1401.055) (-1401.359) -- 0:00:16 749500 -- (-1403.542) [-1401.635] (-1401.665) (-1402.492) * (-1404.728) (-1403.024) [-1401.492] (-1401.465) -- 0:00:16 750000 -- (-1404.622) [-1401.059] (-1401.143) (-1402.134) * (-1404.727) (-1405.306) [-1401.406] (-1401.862) -- 0:00:16 Average standard deviation of split frequencies: 0.006489 750500 -- [-1404.779] (-1401.907) (-1403.127) (-1401.826) * (-1403.308) [-1405.666] (-1402.241) (-1401.044) -- 0:00:15 751000 -- (-1404.767) (-1400.866) (-1408.726) [-1404.021] * [-1401.451] (-1403.762) (-1403.874) (-1404.971) -- 0:00:15 751500 -- (-1407.675) (-1401.107) [-1404.541] (-1402.866) * (-1405.074) [-1403.240] (-1405.408) (-1402.861) -- 0:00:15 752000 -- [-1402.701] (-1401.183) (-1404.286) (-1400.940) * [-1403.911] (-1401.882) (-1405.539) (-1402.084) -- 0:00:15 752500 -- (-1401.733) (-1401.945) [-1402.093] (-1406.419) * [-1404.529] (-1402.943) (-1403.046) (-1401.582) -- 0:00:15 753000 -- (-1403.637) (-1408.792) [-1402.278] (-1405.997) * (-1404.885) (-1401.001) [-1403.855] (-1405.688) -- 0:00:15 753500 -- (-1402.866) (-1402.484) (-1404.860) [-1406.638] * (-1403.239) (-1404.311) [-1401.608] (-1404.273) -- 0:00:15 754000 -- (-1401.944) [-1402.907] (-1403.491) (-1405.922) * (-1402.866) [-1403.769] (-1402.201) (-1402.525) -- 0:00:15 754500 -- (-1401.647) [-1403.243] (-1400.677) (-1402.150) * (-1405.464) [-1401.943] (-1404.880) (-1403.021) -- 0:00:15 755000 -- [-1401.617] (-1403.090) (-1404.526) (-1402.987) * [-1401.612] (-1405.867) (-1402.527) (-1401.531) -- 0:00:15 Average standard deviation of split frequencies: 0.006526 755500 -- (-1404.588) (-1401.821) [-1402.982] (-1401.510) * (-1402.559) (-1406.053) (-1402.357) [-1402.672] -- 0:00:15 756000 -- (-1401.843) [-1402.528] (-1406.413) (-1401.193) * (-1406.337) (-1405.346) [-1405.315] (-1405.295) -- 0:00:15 756500 -- (-1403.318) (-1401.009) [-1403.825] (-1401.677) * (-1403.813) [-1400.915] (-1402.520) (-1402.541) -- 0:00:15 757000 -- (-1403.650) [-1401.543] (-1407.913) (-1402.254) * (-1402.697) [-1401.836] (-1405.150) (-1403.183) -- 0:00:15 757500 -- (-1403.724) (-1403.992) (-1402.950) [-1402.125] * (-1404.817) (-1405.677) (-1405.515) [-1402.281] -- 0:00:15 758000 -- (-1402.337) (-1403.741) (-1403.225) [-1402.703] * (-1402.238) [-1410.575] (-1401.175) (-1403.420) -- 0:00:15 758500 -- (-1403.539) (-1402.878) (-1403.979) [-1401.906] * [-1401.106] (-1403.955) (-1405.789) (-1403.049) -- 0:00:15 759000 -- (-1403.393) [-1403.752] (-1407.337) (-1401.664) * (-1403.006) [-1404.204] (-1401.258) (-1404.751) -- 0:00:15 759500 -- (-1403.124) (-1403.999) [-1401.551] (-1401.606) * (-1403.197) (-1404.123) [-1401.334] (-1402.024) -- 0:00:15 760000 -- [-1403.622] (-1403.478) (-1402.933) (-1404.549) * (-1400.922) (-1403.167) (-1402.182) [-1401.274] -- 0:00:15 Average standard deviation of split frequencies: 0.006652 760500 -- [-1402.381] (-1404.098) (-1403.525) (-1402.323) * (-1402.485) [-1402.155] (-1402.794) (-1403.437) -- 0:00:15 761000 -- (-1403.396) (-1409.380) [-1402.011] (-1401.948) * (-1402.266) (-1402.170) [-1401.608] (-1400.596) -- 0:00:15 761500 -- (-1402.463) (-1402.682) [-1401.605] (-1402.902) * [-1402.457] (-1403.055) (-1403.779) (-1400.840) -- 0:00:15 762000 -- (-1403.298) (-1402.375) [-1402.389] (-1402.977) * [-1401.919] (-1403.434) (-1405.032) (-1403.017) -- 0:00:14 762500 -- (-1403.580) (-1401.802) (-1406.268) [-1407.707] * (-1403.385) [-1403.720] (-1406.061) (-1401.730) -- 0:00:14 763000 -- (-1404.565) (-1402.743) (-1404.567) [-1404.172] * (-1402.720) (-1403.237) (-1402.481) [-1401.342] -- 0:00:14 763500 -- (-1409.405) (-1403.007) (-1402.724) [-1404.507] * [-1405.299] (-1402.001) (-1404.359) (-1401.073) -- 0:00:14 764000 -- (-1405.015) [-1402.258] (-1402.174) (-1404.195) * (-1403.079) (-1405.760) [-1402.374] (-1406.177) -- 0:00:15 764500 -- [-1402.717] (-1404.659) (-1406.695) (-1402.202) * (-1404.127) (-1405.102) [-1401.878] (-1402.606) -- 0:00:15 765000 -- [-1402.699] (-1401.223) (-1402.592) (-1402.173) * (-1404.326) (-1404.431) (-1404.114) [-1404.030] -- 0:00:15 Average standard deviation of split frequencies: 0.006195 765500 -- (-1403.829) (-1402.771) [-1404.099] (-1404.665) * (-1403.245) (-1402.013) [-1401.369] (-1405.771) -- 0:00:15 766000 -- [-1402.526] (-1404.819) (-1401.767) (-1402.466) * [-1401.059] (-1401.696) (-1403.031) (-1405.262) -- 0:00:14 766500 -- [-1401.855] (-1403.656) (-1402.202) (-1403.192) * (-1403.272) (-1405.102) [-1402.035] (-1405.240) -- 0:00:14 767000 -- [-1401.209] (-1401.340) (-1403.108) (-1402.927) * [-1403.054] (-1404.507) (-1403.872) (-1406.821) -- 0:00:14 767500 -- (-1405.054) (-1401.519) (-1402.562) [-1403.267] * (-1402.732) (-1406.510) (-1403.464) [-1405.104] -- 0:00:14 768000 -- (-1404.058) (-1405.176) (-1405.184) [-1401.920] * (-1401.728) (-1404.782) [-1404.410] (-1402.154) -- 0:00:14 768500 -- (-1401.886) [-1403.571] (-1406.024) (-1402.169) * (-1406.788) (-1404.937) [-1405.280] (-1402.508) -- 0:00:14 769000 -- (-1404.062) (-1404.873) (-1402.668) [-1403.958] * (-1402.201) (-1404.920) [-1404.869] (-1404.359) -- 0:00:14 769500 -- [-1401.707] (-1402.839) (-1402.522) (-1403.366) * (-1401.696) [-1401.329] (-1404.871) (-1403.523) -- 0:00:14 770000 -- [-1403.666] (-1402.772) (-1402.119) (-1401.157) * (-1402.988) (-1401.334) [-1405.552] (-1402.217) -- 0:00:14 Average standard deviation of split frequencies: 0.006117 770500 -- (-1402.270) (-1405.153) (-1401.972) [-1401.854] * [-1401.169] (-1402.866) (-1402.444) (-1400.794) -- 0:00:14 771000 -- (-1401.848) (-1402.694) (-1401.666) [-1401.542] * [-1400.993] (-1404.729) (-1404.369) (-1402.224) -- 0:00:14 771500 -- [-1401.048] (-1402.841) (-1403.095) (-1401.172) * (-1402.487) (-1401.764) [-1401.962] (-1406.639) -- 0:00:14 772000 -- [-1403.105] (-1404.212) (-1404.717) (-1401.420) * (-1403.365) [-1406.052] (-1405.781) (-1404.670) -- 0:00:14 772500 -- [-1401.047] (-1402.170) (-1403.741) (-1402.907) * (-1402.171) [-1405.227] (-1408.724) (-1405.442) -- 0:00:14 773000 -- [-1406.255] (-1404.772) (-1406.848) (-1406.910) * [-1405.224] (-1402.827) (-1406.665) (-1405.093) -- 0:00:14 773500 -- (-1402.286) [-1402.500] (-1402.150) (-1409.470) * (-1402.502) [-1402.747] (-1408.609) (-1401.559) -- 0:00:14 774000 -- (-1400.931) (-1403.976) (-1403.053) [-1407.856] * [-1403.437] (-1401.536) (-1404.716) (-1401.422) -- 0:00:14 774500 -- (-1401.163) [-1401.424] (-1403.525) (-1405.486) * (-1402.428) (-1402.862) [-1402.193] (-1403.929) -- 0:00:14 775000 -- (-1403.793) [-1405.915] (-1401.616) (-1405.546) * (-1402.416) [-1402.570] (-1405.196) (-1404.534) -- 0:00:14 Average standard deviation of split frequencies: 0.006196 775500 -- (-1401.063) (-1407.740) [-1404.914] (-1405.524) * [-1405.049] (-1403.064) (-1401.507) (-1403.263) -- 0:00:14 776000 -- (-1401.008) (-1406.327) (-1410.818) [-1405.207] * (-1404.592) (-1404.061) [-1402.533] (-1403.357) -- 0:00:14 776500 -- [-1402.136] (-1401.548) (-1403.324) (-1404.967) * (-1401.176) (-1401.959) [-1401.207] (-1402.167) -- 0:00:14 777000 -- (-1404.315) (-1402.841) [-1402.489] (-1403.431) * [-1402.234] (-1401.754) (-1404.034) (-1404.280) -- 0:00:14 777500 -- (-1406.675) (-1401.917) (-1406.334) [-1401.952] * (-1401.728) (-1404.112) [-1404.201] (-1413.182) -- 0:00:14 778000 -- (-1402.061) (-1402.995) [-1404.408] (-1400.875) * (-1404.786) (-1404.409) [-1403.587] (-1406.565) -- 0:00:13 778500 -- (-1403.013) (-1401.927) (-1403.026) [-1402.799] * (-1403.656) (-1403.110) (-1402.985) [-1403.063] -- 0:00:13 779000 -- (-1404.178) (-1401.421) (-1402.352) [-1402.863] * (-1401.837) (-1407.152) [-1402.100] (-1408.273) -- 0:00:13 779500 -- (-1402.720) [-1401.029] (-1403.266) (-1404.201) * (-1403.927) (-1407.384) [-1402.199] (-1404.102) -- 0:00:14 780000 -- (-1402.328) [-1405.289] (-1403.257) (-1404.388) * (-1405.919) (-1403.407) [-1406.125] (-1401.970) -- 0:00:14 Average standard deviation of split frequencies: 0.006522 780500 -- (-1401.923) [-1405.934] (-1404.115) (-1403.317) * (-1403.077) (-1405.493) (-1403.161) [-1402.245] -- 0:00:14 781000 -- (-1402.376) [-1406.893] (-1403.332) (-1403.398) * (-1401.961) (-1401.795) (-1402.738) [-1407.080] -- 0:00:14 781500 -- [-1400.788] (-1401.351) (-1406.155) (-1403.645) * (-1402.193) (-1401.411) [-1404.351] (-1409.705) -- 0:00:13 782000 -- (-1404.219) (-1402.136) (-1401.429) [-1403.166] * (-1401.079) (-1404.490) (-1403.575) [-1404.375] -- 0:00:13 782500 -- [-1402.731] (-1403.020) (-1402.683) (-1403.824) * (-1402.381) (-1405.183) (-1404.398) [-1401.191] -- 0:00:13 783000 -- (-1402.164) (-1401.999) (-1403.842) [-1402.670] * (-1403.001) (-1401.453) [-1406.014] (-1403.727) -- 0:00:13 783500 -- (-1402.170) (-1402.950) (-1403.293) [-1402.602] * [-1404.607] (-1407.571) (-1403.076) (-1404.007) -- 0:00:13 784000 -- (-1402.408) [-1401.898] (-1404.661) (-1402.988) * [-1404.257] (-1404.306) (-1403.839) (-1403.300) -- 0:00:13 784500 -- [-1401.017] (-1401.428) (-1405.172) (-1403.836) * (-1405.452) [-1401.019] (-1401.602) (-1404.698) -- 0:00:13 785000 -- (-1402.718) [-1401.626] (-1404.462) (-1402.884) * [-1404.325] (-1400.884) (-1403.105) (-1409.532) -- 0:00:13 Average standard deviation of split frequencies: 0.006637 785500 -- (-1402.723) [-1402.593] (-1404.908) (-1403.504) * (-1402.898) (-1403.355) [-1404.102] (-1401.651) -- 0:00:13 786000 -- (-1402.952) (-1405.420) (-1403.897) [-1401.622] * (-1401.731) [-1402.442] (-1401.637) (-1402.830) -- 0:00:13 786500 -- [-1401.840] (-1402.527) (-1402.871) (-1401.566) * (-1406.790) (-1402.843) [-1402.764] (-1402.703) -- 0:00:13 787000 -- (-1404.503) [-1402.037] (-1406.799) (-1405.181) * (-1403.707) (-1403.824) [-1402.990] (-1403.007) -- 0:00:13 787500 -- (-1403.649) (-1405.915) [-1403.665] (-1405.110) * [-1403.594] (-1404.061) (-1401.363) (-1403.151) -- 0:00:13 788000 -- [-1400.897] (-1404.261) (-1402.342) (-1404.129) * (-1403.269) (-1402.231) (-1403.944) [-1402.472] -- 0:00:13 788500 -- (-1400.939) [-1404.119] (-1404.341) (-1401.693) * (-1403.139) (-1402.194) [-1401.343] (-1402.784) -- 0:00:13 789000 -- (-1401.834) (-1403.330) [-1405.994] (-1403.058) * (-1401.861) (-1405.627) [-1404.907] (-1403.799) -- 0:00:13 789500 -- [-1402.740] (-1405.331) (-1402.964) (-1401.736) * (-1403.262) [-1402.964] (-1402.931) (-1400.916) -- 0:00:13 790000 -- (-1401.955) (-1402.216) (-1404.794) [-1402.098] * (-1403.314) (-1403.342) [-1403.373] (-1402.388) -- 0:00:13 Average standard deviation of split frequencies: 0.006558 790500 -- (-1402.451) (-1402.720) (-1406.029) [-1403.888] * (-1404.402) (-1401.635) (-1402.273) [-1400.798] -- 0:00:13 791000 -- (-1403.342) [-1402.829] (-1400.982) (-1401.990) * (-1408.887) (-1402.543) (-1403.055) [-1401.939] -- 0:00:13 791500 -- (-1404.891) (-1403.255) [-1404.163] (-1405.847) * (-1404.057) [-1401.586] (-1403.484) (-1407.579) -- 0:00:13 792000 -- (-1400.899) (-1403.056) (-1400.646) [-1403.019] * (-1403.974) (-1404.046) [-1402.103] (-1405.292) -- 0:00:13 792500 -- (-1402.405) (-1401.152) [-1401.780] (-1406.249) * (-1403.273) (-1402.079) (-1404.411) [-1405.625] -- 0:00:13 793000 -- (-1404.007) (-1401.623) [-1402.091] (-1405.504) * (-1400.822) [-1403.500] (-1402.733) (-1407.673) -- 0:00:13 793500 -- (-1405.407) (-1401.062) [-1401.562] (-1405.507) * [-1401.875] (-1404.400) (-1403.166) (-1401.417) -- 0:00:13 794000 -- (-1404.080) (-1404.710) (-1402.277) [-1402.409] * (-1403.603) (-1404.852) (-1405.214) [-1404.123] -- 0:00:12 794500 -- (-1402.432) (-1402.112) [-1401.759] (-1401.713) * (-1401.983) (-1404.465) (-1402.526) [-1405.692] -- 0:00:12 795000 -- (-1404.469) (-1402.850) [-1404.364] (-1401.676) * (-1401.404) [-1401.420] (-1404.896) (-1404.418) -- 0:00:12 Average standard deviation of split frequencies: 0.006593 795500 -- [-1403.660] (-1406.521) (-1402.667) (-1401.306) * [-1401.325] (-1402.301) (-1403.084) (-1403.857) -- 0:00:13 796000 -- (-1403.942) (-1408.229) (-1403.908) [-1401.743] * (-1406.942) (-1402.382) [-1402.149] (-1401.949) -- 0:00:13 796500 -- (-1402.118) (-1401.737) (-1402.387) [-1401.283] * (-1403.658) (-1404.739) [-1401.400] (-1407.264) -- 0:00:13 797000 -- (-1404.238) [-1401.945] (-1408.059) (-1401.283) * [-1401.072] (-1403.955) (-1404.070) (-1405.954) -- 0:00:12 797500 -- (-1406.562) [-1401.799] (-1403.812) (-1401.157) * (-1405.141) [-1401.184] (-1401.549) (-1404.467) -- 0:00:12 798000 -- [-1402.690] (-1405.474) (-1402.179) (-1401.165) * (-1403.743) (-1401.227) [-1401.360] (-1402.552) -- 0:00:12 798500 -- (-1407.509) (-1401.977) (-1405.760) [-1402.359] * [-1405.645] (-1402.044) (-1405.190) (-1402.800) -- 0:00:12 799000 -- (-1403.923) (-1404.291) (-1402.066) [-1402.856] * (-1402.777) (-1402.974) (-1404.815) [-1402.411] -- 0:00:12 799500 -- (-1403.598) (-1405.511) (-1400.784) [-1406.060] * (-1405.597) (-1401.030) (-1404.851) [-1402.650] -- 0:00:12 800000 -- (-1401.821) (-1406.044) (-1402.458) [-1402.279] * (-1408.528) (-1402.633) [-1403.694] (-1403.033) -- 0:00:12 Average standard deviation of split frequencies: 0.007026 800500 -- (-1403.169) (-1402.865) (-1401.048) [-1405.492] * (-1406.974) (-1406.198) [-1403.280] (-1402.712) -- 0:00:12 801000 -- (-1403.055) (-1403.484) (-1402.400) [-1403.550] * (-1408.433) (-1402.909) (-1402.021) [-1402.757] -- 0:00:12 801500 -- (-1402.617) [-1401.944] (-1402.487) (-1402.039) * [-1402.140] (-1401.184) (-1404.288) (-1402.800) -- 0:00:12 802000 -- (-1401.750) [-1402.188] (-1404.681) (-1402.304) * (-1402.432) (-1402.837) (-1402.622) [-1402.757] -- 0:00:12 802500 -- [-1403.171] (-1401.730) (-1402.574) (-1408.250) * (-1401.802) (-1403.739) (-1401.656) [-1402.914] -- 0:00:12 803000 -- (-1402.381) (-1403.599) (-1402.034) [-1406.007] * (-1405.316) (-1404.569) [-1401.269] (-1401.426) -- 0:00:12 803500 -- (-1403.165) (-1404.719) (-1401.743) [-1402.032] * (-1401.740) (-1404.796) (-1402.215) [-1402.146] -- 0:00:12 804000 -- (-1401.267) (-1401.929) (-1402.315) [-1400.818] * (-1404.909) (-1401.550) (-1401.515) [-1402.393] -- 0:00:12 804500 -- (-1400.915) (-1402.836) (-1402.304) [-1402.217] * (-1401.190) (-1403.607) (-1403.125) [-1401.469] -- 0:00:12 805000 -- [-1402.214] (-1403.032) (-1405.609) (-1405.328) * (-1401.349) (-1405.540) (-1403.921) [-1404.488] -- 0:00:12 Average standard deviation of split frequencies: 0.007096 805500 -- (-1406.688) [-1402.903] (-1404.104) (-1401.885) * (-1401.712) (-1405.740) (-1405.455) [-1403.306] -- 0:00:12 806000 -- (-1403.882) [-1402.559] (-1403.409) (-1407.089) * (-1403.832) (-1401.456) (-1402.981) [-1402.228] -- 0:00:12 806500 -- (-1408.759) (-1406.606) [-1401.083] (-1404.433) * (-1405.402) (-1400.999) (-1404.939) [-1401.460] -- 0:00:12 807000 -- (-1402.750) [-1404.520] (-1400.694) (-1402.539) * (-1403.236) (-1402.346) (-1403.318) [-1403.068] -- 0:00:12 807500 -- [-1403.076] (-1404.823) (-1402.176) (-1403.647) * (-1406.848) [-1404.486] (-1403.864) (-1402.543) -- 0:00:12 808000 -- (-1403.706) (-1401.679) [-1404.831] (-1403.930) * (-1404.403) (-1401.465) (-1405.503) [-1403.488] -- 0:00:12 808500 -- (-1404.069) (-1403.292) [-1407.266] (-1403.279) * (-1402.115) [-1401.162] (-1403.059) (-1402.979) -- 0:00:12 809000 -- (-1403.203) (-1404.834) (-1402.725) [-1401.815] * (-1401.679) (-1403.772) [-1403.138] (-1406.276) -- 0:00:12 809500 -- (-1409.284) (-1405.795) [-1402.375] (-1405.788) * (-1401.425) (-1402.003) (-1401.965) [-1405.976] -- 0:00:12 810000 -- (-1402.776) (-1403.551) (-1402.484) [-1406.203] * (-1409.930) [-1404.417] (-1400.892) (-1403.771) -- 0:00:11 Average standard deviation of split frequencies: 0.006552 810500 -- (-1401.670) (-1402.118) (-1402.346) [-1407.490] * (-1407.070) (-1402.516) [-1402.037] (-1406.223) -- 0:00:12 811000 -- [-1404.372] (-1403.771) (-1403.468) (-1403.085) * [-1403.674] (-1406.973) (-1403.543) (-1403.447) -- 0:00:12 811500 -- (-1402.092) (-1404.553) (-1403.411) [-1401.726] * [-1407.430] (-1402.423) (-1403.045) (-1404.437) -- 0:00:12 812000 -- (-1402.272) (-1407.558) (-1402.599) [-1401.410] * (-1404.986) [-1402.561] (-1404.730) (-1403.146) -- 0:00:12 812500 -- (-1402.543) [-1401.242] (-1404.227) (-1401.701) * (-1410.652) [-1402.413] (-1401.143) (-1407.275) -- 0:00:12 813000 -- (-1402.369) (-1407.652) [-1406.012] (-1401.841) * (-1402.257) [-1402.540] (-1401.793) (-1403.387) -- 0:00:11 813500 -- (-1401.457) (-1407.330) (-1402.255) [-1402.598] * (-1403.535) [-1402.039] (-1402.664) (-1402.298) -- 0:00:11 814000 -- (-1404.511) (-1405.097) (-1405.672) [-1403.405] * (-1404.866) (-1403.505) [-1404.003] (-1400.726) -- 0:00:11 814500 -- (-1402.517) (-1401.530) (-1402.501) [-1407.561] * (-1402.773) [-1405.196] (-1402.339) (-1401.811) -- 0:00:11 815000 -- (-1404.796) (-1402.130) [-1403.796] (-1405.415) * [-1401.405] (-1401.618) (-1405.108) (-1402.397) -- 0:00:11 Average standard deviation of split frequencies: 0.006817 815500 -- (-1402.743) (-1404.437) [-1403.931] (-1401.889) * (-1406.336) (-1402.666) (-1405.797) [-1401.986] -- 0:00:11 816000 -- (-1402.504) (-1404.246) [-1403.369] (-1401.538) * (-1405.345) (-1403.509) (-1406.994) [-1403.602] -- 0:00:11 816500 -- [-1403.679] (-1403.249) (-1401.558) (-1401.723) * (-1403.937) (-1402.748) (-1406.014) [-1401.782] -- 0:00:11 817000 -- (-1404.068) (-1403.631) [-1401.378] (-1403.346) * (-1408.578) [-1404.374] (-1402.106) (-1402.591) -- 0:00:11 817500 -- (-1404.290) [-1403.858] (-1401.328) (-1402.182) * (-1403.305) [-1403.130] (-1402.994) (-1401.388) -- 0:00:11 818000 -- [-1401.761] (-1404.690) (-1402.384) (-1402.112) * (-1404.962) (-1403.353) (-1400.898) [-1403.169] -- 0:00:11 818500 -- (-1409.306) [-1406.389] (-1403.130) (-1403.219) * (-1406.404) [-1403.185] (-1404.725) (-1404.071) -- 0:00:11 819000 -- (-1404.130) (-1405.713) (-1401.875) [-1404.522] * [-1403.171] (-1402.155) (-1402.032) (-1406.233) -- 0:00:11 819500 -- (-1401.703) [-1409.193] (-1407.175) (-1403.546) * [-1404.107] (-1403.376) (-1403.949) (-1405.583) -- 0:00:11 820000 -- (-1405.288) (-1403.684) (-1402.728) [-1402.018] * [-1402.044] (-1404.620) (-1403.782) (-1406.541) -- 0:00:11 Average standard deviation of split frequencies: 0.007046 820500 -- (-1406.545) (-1402.789) (-1402.858) [-1401.412] * (-1401.805) (-1406.671) (-1406.542) [-1407.559] -- 0:00:11 821000 -- (-1401.826) (-1402.348) [-1401.680] (-1403.252) * [-1403.871] (-1403.198) (-1401.315) (-1405.076) -- 0:00:11 821500 -- (-1402.604) [-1403.013] (-1403.807) (-1403.734) * [-1402.741] (-1404.463) (-1403.831) (-1402.623) -- 0:00:11 822000 -- (-1403.489) [-1405.188] (-1404.258) (-1402.711) * (-1402.742) (-1405.106) [-1401.016] (-1406.693) -- 0:00:11 822500 -- (-1405.903) [-1404.531] (-1402.868) (-1403.892) * (-1401.663) (-1402.319) [-1401.220] (-1403.597) -- 0:00:11 823000 -- (-1401.961) [-1403.292] (-1402.855) (-1403.522) * [-1404.716] (-1401.798) (-1402.188) (-1402.026) -- 0:00:11 823500 -- (-1405.813) [-1404.644] (-1404.376) (-1402.535) * (-1405.350) (-1401.160) (-1404.443) [-1405.055] -- 0:00:11 824000 -- (-1409.128) (-1405.877) [-1402.979] (-1402.581) * [-1403.488] (-1404.501) (-1403.338) (-1401.862) -- 0:00:11 824500 -- (-1410.575) (-1402.739) [-1400.953] (-1404.028) * (-1402.138) [-1402.991] (-1404.596) (-1401.468) -- 0:00:11 825000 -- [-1407.135] (-1401.878) (-1401.375) (-1401.767) * (-1403.764) [-1400.737] (-1402.346) (-1403.983) -- 0:00:11 Average standard deviation of split frequencies: 0.007001 825500 -- (-1406.111) (-1403.645) (-1404.095) [-1402.181] * (-1403.982) (-1401.693) [-1404.777] (-1402.153) -- 0:00:11 826000 -- [-1402.495] (-1406.611) (-1402.779) (-1405.817) * [-1402.130] (-1403.917) (-1404.341) (-1405.989) -- 0:00:11 826500 -- (-1406.576) (-1406.041) (-1404.921) [-1404.713] * (-1402.550) (-1402.004) (-1402.727) [-1402.459] -- 0:00:11 827000 -- [-1401.374] (-1407.948) (-1402.563) (-1402.790) * (-1402.618) (-1403.243) [-1404.378] (-1404.814) -- 0:00:11 827500 -- (-1404.207) [-1406.193] (-1402.798) (-1402.428) * (-1404.782) (-1403.606) [-1402.023] (-1406.226) -- 0:00:11 828000 -- (-1403.515) (-1401.243) (-1402.275) [-1403.777] * (-1405.535) [-1402.630] (-1402.814) (-1400.836) -- 0:00:11 828500 -- (-1403.724) (-1401.579) (-1402.137) [-1404.783] * (-1407.007) (-1410.422) [-1402.182] (-1400.836) -- 0:00:10 829000 -- (-1401.973) [-1401.306] (-1400.933) (-1400.670) * (-1405.423) [-1405.464] (-1406.032) (-1400.836) -- 0:00:10 829500 -- (-1401.217) [-1403.272] (-1402.793) (-1402.675) * (-1401.966) (-1404.497) [-1403.017] (-1402.389) -- 0:00:10 830000 -- [-1402.479] (-1402.993) (-1409.551) (-1401.095) * [-1403.068] (-1404.506) (-1403.903) (-1402.608) -- 0:00:10 Average standard deviation of split frequencies: 0.006848 830500 -- (-1402.881) (-1408.023) [-1404.661] (-1402.655) * [-1401.671] (-1401.751) (-1407.585) (-1400.879) -- 0:00:10 831000 -- (-1401.094) (-1406.036) [-1402.926] (-1402.909) * (-1402.159) [-1401.004] (-1403.997) (-1402.518) -- 0:00:10 831500 -- (-1402.646) [-1404.514] (-1403.305) (-1401.857) * (-1401.472) (-1404.081) (-1404.984) [-1403.317] -- 0:00:10 832000 -- [-1402.020] (-1404.919) (-1405.986) (-1404.898) * (-1404.270) [-1402.807] (-1406.119) (-1406.149) -- 0:00:10 832500 -- (-1401.365) (-1403.677) (-1402.358) [-1402.678] * (-1404.464) (-1402.901) (-1404.615) [-1405.361] -- 0:00:10 833000 -- (-1404.890) (-1401.578) (-1401.641) [-1402.922] * (-1403.975) (-1402.383) [-1406.665] (-1402.076) -- 0:00:10 833500 -- [-1405.937] (-1402.454) (-1405.748) (-1401.379) * [-1401.329] (-1402.712) (-1408.186) (-1401.648) -- 0:00:10 834000 -- (-1401.100) [-1404.023] (-1403.490) (-1405.186) * (-1400.631) [-1403.852] (-1403.381) (-1401.668) -- 0:00:10 834500 -- (-1403.776) (-1402.843) (-1402.271) [-1401.637] * [-1404.062] (-1401.394) (-1402.765) (-1401.984) -- 0:00:10 835000 -- [-1403.558] (-1402.197) (-1406.955) (-1403.347) * [-1405.546] (-1401.040) (-1404.027) (-1404.474) -- 0:00:10 Average standard deviation of split frequencies: 0.007105 835500 -- (-1405.672) [-1401.810] (-1407.330) (-1402.066) * (-1403.809) (-1401.878) (-1402.989) [-1406.458] -- 0:00:10 836000 -- (-1405.646) [-1401.811] (-1405.476) (-1404.727) * (-1409.019) (-1401.685) [-1403.414] (-1402.922) -- 0:00:10 836500 -- [-1402.101] (-1402.051) (-1406.011) (-1402.993) * [-1410.024] (-1404.924) (-1404.057) (-1401.248) -- 0:00:10 837000 -- (-1401.643) (-1401.579) (-1404.942) [-1406.039] * [-1402.985] (-1408.676) (-1403.464) (-1403.161) -- 0:00:10 837500 -- (-1403.769) (-1401.727) [-1403.030] (-1404.623) * (-1408.067) [-1405.679] (-1405.213) (-1407.008) -- 0:00:10 838000 -- [-1403.696] (-1401.984) (-1402.802) (-1402.648) * (-1406.037) [-1401.489] (-1405.280) (-1405.077) -- 0:00:10 838500 -- [-1403.995] (-1402.699) (-1403.600) (-1403.981) * [-1406.377] (-1402.023) (-1401.482) (-1402.988) -- 0:00:10 839000 -- (-1401.737) (-1402.835) [-1405.528] (-1403.486) * [-1401.001] (-1404.648) (-1403.122) (-1402.014) -- 0:00:10 839500 -- [-1406.519] (-1402.790) (-1402.066) (-1402.959) * (-1402.240) (-1402.792) [-1401.013] (-1403.465) -- 0:00:10 840000 -- (-1406.581) [-1401.703] (-1403.008) (-1404.386) * (-1403.568) (-1401.731) [-1401.093] (-1404.878) -- 0:00:10 Average standard deviation of split frequencies: 0.006766 840500 -- (-1405.545) (-1402.479) (-1402.949) [-1401.926] * [-1403.727] (-1404.793) (-1401.108) (-1404.781) -- 0:00:10 841000 -- [-1403.692] (-1403.584) (-1402.207) (-1402.023) * (-1403.210) [-1402.492] (-1401.055) (-1401.619) -- 0:00:10 841500 -- (-1402.059) (-1402.529) (-1402.528) [-1401.881] * (-1405.927) [-1405.829] (-1404.096) (-1405.082) -- 0:00:10 842000 -- (-1401.554) (-1408.183) (-1406.016) [-1404.025] * (-1403.652) [-1402.588] (-1402.777) (-1403.791) -- 0:00:10 842500 -- (-1403.175) [-1405.863] (-1405.109) (-1401.431) * (-1400.984) [-1403.673] (-1403.332) (-1403.217) -- 0:00:10 843000 -- (-1407.036) (-1405.784) [-1403.856] (-1401.464) * (-1405.649) (-1401.353) [-1404.519] (-1406.818) -- 0:00:10 843500 -- [-1402.842] (-1403.628) (-1403.327) (-1401.158) * (-1405.232) (-1404.217) (-1404.743) [-1404.308] -- 0:00:10 844000 -- (-1403.218) [-1408.413] (-1404.045) (-1401.386) * (-1402.033) [-1401.270] (-1403.083) (-1401.817) -- 0:00:09 844500 -- (-1402.964) (-1407.299) (-1401.408) [-1401.101] * (-1402.255) (-1403.488) [-1403.238] (-1401.563) -- 0:00:09 845000 -- (-1407.883) [-1403.582] (-1403.242) (-1403.407) * (-1402.088) (-1404.487) (-1403.547) [-1402.716] -- 0:00:09 Average standard deviation of split frequencies: 0.006947 845500 -- (-1404.554) [-1402.667] (-1406.322) (-1407.414) * [-1402.733] (-1403.622) (-1402.899) (-1402.646) -- 0:00:09 846000 -- (-1407.829) [-1402.350] (-1406.326) (-1404.784) * (-1403.913) [-1404.562] (-1402.814) (-1403.291) -- 0:00:09 846500 -- (-1410.163) (-1402.206) (-1407.429) [-1405.108] * (-1406.233) (-1405.276) [-1401.705] (-1403.408) -- 0:00:09 847000 -- (-1409.397) (-1402.237) (-1405.484) [-1404.703] * (-1401.545) (-1407.338) [-1403.878] (-1402.476) -- 0:00:09 847500 -- [-1402.104] (-1403.307) (-1402.434) (-1402.113) * (-1401.008) [-1402.575] (-1403.345) (-1405.708) -- 0:00:09 848000 -- (-1402.355) [-1401.901] (-1402.192) (-1402.625) * (-1401.199) (-1402.367) (-1402.894) [-1402.452] -- 0:00:09 848500 -- [-1401.859] (-1401.927) (-1404.664) (-1403.296) * (-1401.384) (-1403.982) [-1403.318] (-1403.196) -- 0:00:09 849000 -- (-1404.049) (-1401.935) (-1401.941) [-1402.096] * [-1405.099] (-1404.015) (-1404.022) (-1403.131) -- 0:00:09 849500 -- (-1402.845) [-1400.718] (-1401.644) (-1401.576) * (-1402.322) (-1403.100) [-1401.688] (-1404.355) -- 0:00:09 850000 -- [-1402.559] (-1401.056) (-1402.157) (-1401.590) * (-1402.000) [-1402.012] (-1401.884) (-1407.709) -- 0:00:09 Average standard deviation of split frequencies: 0.006724 850500 -- (-1402.554) [-1401.437] (-1403.476) (-1406.406) * (-1402.353) (-1402.111) (-1402.845) [-1404.741] -- 0:00:09 851000 -- (-1403.952) (-1404.656) [-1401.283] (-1404.406) * (-1401.498) (-1404.671) (-1408.827) [-1405.789] -- 0:00:09 851500 -- (-1403.826) [-1400.966] (-1400.936) (-1406.760) * (-1404.880) (-1401.737) (-1404.388) [-1403.548] -- 0:00:09 852000 -- (-1403.874) (-1405.052) (-1402.590) [-1403.776] * [-1404.454] (-1402.500) (-1402.231) (-1403.268) -- 0:00:09 852500 -- (-1406.310) (-1403.885) [-1403.722] (-1406.642) * [-1402.278] (-1407.349) (-1402.800) (-1405.830) -- 0:00:09 853000 -- (-1402.398) (-1404.825) (-1404.192) [-1409.000] * (-1401.650) (-1408.425) [-1401.681] (-1401.101) -- 0:00:09 853500 -- (-1402.863) (-1404.599) (-1402.099) [-1405.393] * (-1403.109) (-1405.346) (-1404.557) [-1402.788] -- 0:00:09 854000 -- (-1409.429) (-1405.267) [-1401.915] (-1405.462) * (-1400.946) (-1404.706) [-1401.940] (-1402.540) -- 0:00:09 854500 -- (-1405.580) (-1402.487) (-1404.041) [-1404.808] * (-1403.277) (-1405.522) [-1401.031] (-1401.242) -- 0:00:09 855000 -- (-1402.938) (-1401.171) (-1402.758) [-1401.902] * (-1402.778) (-1402.950) (-1401.521) [-1402.555] -- 0:00:09 Average standard deviation of split frequencies: 0.006315 855500 -- (-1401.822) (-1403.369) (-1403.885) [-1402.982] * (-1405.891) (-1404.533) [-1401.696] (-1404.977) -- 0:00:09 856000 -- (-1401.440) [-1404.474] (-1402.260) (-1407.123) * (-1404.539) [-1401.484] (-1401.347) (-1403.650) -- 0:00:09 856500 -- (-1403.300) (-1404.611) (-1402.236) [-1402.874] * [-1403.342] (-1406.535) (-1401.452) (-1403.482) -- 0:00:09 857000 -- (-1402.509) (-1404.028) (-1402.099) [-1403.222] * (-1405.487) (-1409.947) (-1403.302) [-1402.587] -- 0:00:09 857500 -- (-1401.238) (-1403.404) [-1403.413] (-1403.167) * (-1405.051) [-1403.158] (-1402.219) (-1403.812) -- 0:00:09 858000 -- (-1406.276) [-1404.259] (-1409.854) (-1402.747) * (-1406.587) (-1403.597) (-1402.875) [-1405.866] -- 0:00:09 858500 -- [-1403.007] (-1402.864) (-1405.237) (-1402.412) * (-1405.251) [-1404.057] (-1400.790) (-1402.098) -- 0:00:09 859000 -- (-1406.158) (-1408.822) (-1404.504) [-1403.208] * (-1404.951) [-1401.873] (-1401.197) (-1402.321) -- 0:00:09 859500 -- (-1403.193) (-1401.665) (-1402.621) [-1402.521] * (-1401.949) [-1401.682] (-1405.000) (-1401.439) -- 0:00:08 860000 -- (-1401.899) (-1405.105) [-1401.095] (-1401.662) * [-1401.682] (-1401.755) (-1402.556) (-1400.952) -- 0:00:08 Average standard deviation of split frequencies: 0.006390 860500 -- (-1402.081) (-1407.059) [-1405.379] (-1401.388) * [-1402.529] (-1403.030) (-1401.894) (-1401.722) -- 0:00:08 861000 -- (-1402.736) (-1404.584) (-1406.114) [-1402.392] * (-1401.891) (-1401.443) (-1406.062) [-1402.620] -- 0:00:08 861500 -- (-1406.710) (-1406.341) [-1403.310] (-1401.111) * [-1402.437] (-1402.741) (-1401.993) (-1404.083) -- 0:00:08 862000 -- (-1403.727) (-1409.571) [-1402.052] (-1405.090) * (-1405.635) (-1404.168) [-1402.788] (-1402.054) -- 0:00:08 862500 -- (-1403.281) [-1405.061] (-1403.647) (-1403.001) * (-1402.679) [-1402.450] (-1403.077) (-1401.700) -- 0:00:08 863000 -- (-1401.782) (-1402.010) (-1404.382) [-1402.845] * (-1405.263) (-1405.938) (-1403.127) [-1401.976] -- 0:00:08 863500 -- [-1400.800] (-1405.596) (-1406.787) (-1401.847) * (-1402.122) (-1406.207) [-1402.093] (-1402.239) -- 0:00:08 864000 -- [-1403.641] (-1404.046) (-1401.507) (-1401.197) * [-1403.432] (-1404.553) (-1404.709) (-1402.445) -- 0:00:08 864500 -- (-1403.424) [-1404.655] (-1405.667) (-1407.474) * [-1408.441] (-1402.879) (-1404.026) (-1402.257) -- 0:00:08 865000 -- (-1403.424) [-1405.890] (-1401.916) (-1407.677) * (-1406.873) (-1401.953) (-1402.090) [-1401.892] -- 0:00:08 Average standard deviation of split frequencies: 0.006605 865500 -- (-1403.376) (-1403.209) (-1403.157) [-1403.385] * (-1408.076) (-1402.240) (-1401.942) [-1401.447] -- 0:00:08 866000 -- (-1402.241) (-1406.461) [-1401.599] (-1402.333) * (-1403.029) (-1401.440) [-1402.976] (-1402.526) -- 0:00:08 866500 -- (-1401.779) [-1404.288] (-1409.688) (-1405.790) * [-1402.618] (-1408.779) (-1401.725) (-1403.985) -- 0:00:08 867000 -- (-1402.424) (-1401.768) (-1404.150) [-1409.033] * [-1402.675] (-1404.574) (-1401.809) (-1405.983) -- 0:00:08 867500 -- (-1402.183) [-1403.290] (-1403.443) (-1403.942) * (-1403.718) (-1401.981) (-1403.280) [-1403.923] -- 0:00:08 868000 -- [-1401.809] (-1403.448) (-1401.232) (-1401.804) * (-1402.668) (-1401.886) (-1405.675) [-1402.313] -- 0:00:08 868500 -- (-1403.204) (-1403.536) [-1404.459] (-1403.015) * (-1405.287) [-1403.978] (-1403.017) (-1402.975) -- 0:00:08 869000 -- (-1402.582) (-1406.501) [-1402.421] (-1403.372) * (-1403.018) (-1403.217) [-1401.505] (-1402.378) -- 0:00:08 869500 -- (-1403.456) (-1404.092) [-1401.641] (-1402.081) * (-1403.462) [-1403.376] (-1403.528) (-1404.453) -- 0:00:08 870000 -- (-1403.585) (-1404.018) (-1402.167) [-1405.521] * (-1402.680) [-1401.795] (-1401.949) (-1401.733) -- 0:00:08 Average standard deviation of split frequencies: 0.006461 870500 -- [-1402.273] (-1404.696) (-1401.588) (-1403.893) * (-1401.061) [-1402.366] (-1402.239) (-1401.355) -- 0:00:08 871000 -- [-1402.389] (-1405.138) (-1402.497) (-1401.570) * [-1402.888] (-1405.784) (-1402.431) (-1403.845) -- 0:00:08 871500 -- (-1402.035) (-1407.772) (-1402.878) [-1401.841] * (-1401.919) [-1401.952] (-1401.333) (-1401.249) -- 0:00:08 872000 -- (-1402.179) (-1403.283) [-1401.756] (-1403.322) * (-1401.495) [-1402.982] (-1401.592) (-1404.840) -- 0:00:08 872500 -- [-1404.388] (-1401.441) (-1403.279) (-1404.467) * (-1404.073) [-1401.886] (-1407.300) (-1402.883) -- 0:00:08 873000 -- [-1404.435] (-1401.131) (-1401.615) (-1405.066) * [-1400.841] (-1401.135) (-1405.442) (-1402.385) -- 0:00:08 873500 -- [-1404.259] (-1403.035) (-1401.661) (-1404.061) * (-1401.488) (-1402.233) [-1402.003] (-1402.166) -- 0:00:08 874000 -- (-1404.021) [-1403.081] (-1403.560) (-1403.400) * (-1404.005) (-1401.692) (-1402.771) [-1404.217] -- 0:00:08 874500 -- (-1403.915) (-1401.967) [-1402.458] (-1408.986) * (-1404.900) (-1401.056) [-1401.713] (-1401.985) -- 0:00:08 875000 -- [-1406.147] (-1403.863) (-1402.466) (-1403.287) * (-1403.647) [-1404.023] (-1402.572) (-1403.855) -- 0:00:08 Average standard deviation of split frequencies: 0.006350 875500 -- [-1401.542] (-1407.473) (-1403.406) (-1401.225) * (-1407.924) [-1402.490] (-1402.254) (-1403.824) -- 0:00:07 876000 -- [-1402.956] (-1406.370) (-1404.921) (-1401.987) * (-1404.167) [-1402.541] (-1404.071) (-1404.310) -- 0:00:07 876500 -- (-1407.368) [-1402.922] (-1403.603) (-1403.411) * (-1402.865) (-1407.682) (-1403.861) [-1401.308] -- 0:00:07 877000 -- (-1401.564) [-1401.106] (-1402.209) (-1402.820) * [-1402.361] (-1401.638) (-1401.886) (-1401.403) -- 0:00:07 877500 -- (-1401.167) (-1403.968) [-1401.777] (-1403.618) * (-1402.789) (-1402.971) (-1401.036) [-1402.887] -- 0:00:07 878000 -- (-1403.119) (-1402.843) [-1401.920] (-1405.712) * (-1402.088) (-1401.199) (-1403.043) [-1403.475] -- 0:00:07 878500 -- (-1403.164) (-1403.672) [-1404.423] (-1406.041) * (-1405.358) [-1401.720] (-1401.197) (-1406.655) -- 0:00:07 879000 -- (-1406.381) [-1404.742] (-1402.629) (-1403.559) * (-1403.294) (-1402.327) (-1401.359) [-1402.457] -- 0:00:07 879500 -- (-1403.752) (-1405.342) (-1401.796) [-1402.844] * (-1403.816) [-1401.842] (-1403.056) (-1404.993) -- 0:00:07 880000 -- [-1403.018] (-1404.525) (-1402.348) (-1401.513) * (-1403.078) [-1404.871] (-1403.098) (-1408.903) -- 0:00:07 Average standard deviation of split frequencies: 0.006423 880500 -- (-1403.725) (-1404.448) (-1401.802) [-1402.443] * (-1401.645) (-1404.157) (-1407.462) [-1401.094] -- 0:00:07 881000 -- (-1401.344) [-1401.633] (-1401.812) (-1405.006) * (-1402.250) [-1401.488] (-1405.195) (-1404.413) -- 0:00:07 881500 -- [-1405.809] (-1404.422) (-1406.266) (-1409.067) * (-1405.992) [-1403.223] (-1405.769) (-1412.659) -- 0:00:07 882000 -- (-1405.339) [-1402.160] (-1402.367) (-1406.211) * (-1407.642) (-1403.719) [-1404.621] (-1405.557) -- 0:00:07 882500 -- (-1402.891) (-1401.882) (-1404.879) [-1409.567] * [-1405.358] (-1404.590) (-1406.041) (-1402.417) -- 0:00:07 883000 -- (-1404.249) [-1402.565] (-1402.711) (-1405.956) * (-1401.722) [-1403.551] (-1402.648) (-1401.676) -- 0:00:07 883500 -- (-1402.359) [-1401.984] (-1401.984) (-1404.816) * [-1402.351] (-1402.790) (-1404.216) (-1402.346) -- 0:00:07 884000 -- (-1405.274) (-1402.846) (-1402.167) [-1403.361] * [-1402.307] (-1402.984) (-1402.218) (-1405.340) -- 0:00:07 884500 -- [-1403.466] (-1403.766) (-1405.592) (-1402.591) * (-1401.323) [-1401.196] (-1409.605) (-1401.236) -- 0:00:07 885000 -- [-1400.950] (-1405.922) (-1402.395) (-1402.399) * [-1401.911] (-1401.584) (-1402.534) (-1401.685) -- 0:00:07 Average standard deviation of split frequencies: 0.006633 885500 -- [-1404.501] (-1403.701) (-1401.099) (-1404.289) * [-1400.974] (-1406.023) (-1402.016) (-1401.683) -- 0:00:07 886000 -- (-1406.238) [-1402.938] (-1401.480) (-1401.139) * (-1402.299) [-1401.236] (-1405.005) (-1403.564) -- 0:00:07 886500 -- [-1402.431] (-1403.197) (-1401.511) (-1404.430) * (-1404.631) (-1402.189) (-1403.323) [-1403.809] -- 0:00:07 887000 -- (-1402.611) (-1405.375) (-1402.412) [-1402.352] * (-1402.927) [-1402.427] (-1403.455) (-1402.813) -- 0:00:07 887500 -- (-1404.329) (-1404.055) (-1407.061) [-1402.044] * (-1403.488) [-1402.071] (-1404.214) (-1404.063) -- 0:00:07 888000 -- [-1404.389] (-1402.479) (-1407.973) (-1403.237) * (-1403.061) (-1401.895) (-1401.364) [-1403.408] -- 0:00:07 888500 -- (-1405.032) [-1401.979] (-1406.174) (-1402.930) * (-1404.486) [-1402.949] (-1401.588) (-1403.559) -- 0:00:07 889000 -- (-1402.802) [-1400.971] (-1401.457) (-1403.877) * (-1404.183) (-1402.321) [-1402.662] (-1402.634) -- 0:00:07 889500 -- (-1402.762) [-1401.080] (-1404.189) (-1402.677) * (-1402.874) [-1401.656] (-1402.405) (-1409.331) -- 0:00:07 890000 -- (-1401.577) [-1403.116] (-1407.262) (-1403.399) * (-1404.961) (-1401.624) (-1403.381) [-1406.418] -- 0:00:07 Average standard deviation of split frequencies: 0.006845 890500 -- [-1404.418] (-1405.410) (-1402.446) (-1403.953) * (-1403.171) (-1404.582) (-1401.515) [-1402.635] -- 0:00:07 891000 -- (-1403.732) (-1402.242) (-1403.024) [-1403.165] * (-1402.528) [-1404.167] (-1401.404) (-1401.372) -- 0:00:06 891500 -- (-1408.723) (-1404.381) [-1405.860] (-1403.218) * [-1405.172] (-1401.892) (-1408.069) (-1402.475) -- 0:00:06 892000 -- (-1402.669) (-1402.345) (-1406.545) [-1401.100] * [-1401.856] (-1402.885) (-1409.427) (-1401.106) -- 0:00:06 892500 -- (-1403.230) (-1406.158) (-1407.630) [-1403.396] * (-1403.507) [-1402.493] (-1407.045) (-1402.389) -- 0:00:06 893000 -- (-1401.352) (-1404.322) [-1406.209] (-1402.015) * (-1404.075) (-1402.291) [-1401.969] (-1402.386) -- 0:00:06 893500 -- (-1402.035) (-1402.864) [-1403.496] (-1401.709) * [-1401.624] (-1405.158) (-1408.309) (-1401.635) -- 0:00:06 894000 -- (-1405.054) [-1403.168] (-1401.594) (-1402.924) * (-1403.325) (-1402.721) [-1401.871] (-1401.467) -- 0:00:06 894500 -- (-1404.346) (-1402.671) (-1402.282) [-1402.175] * (-1405.152) (-1403.875) [-1403.694] (-1401.110) -- 0:00:06 895000 -- (-1403.644) (-1403.587) [-1402.014] (-1403.447) * (-1400.815) [-1402.730] (-1405.048) (-1401.769) -- 0:00:06 Average standard deviation of split frequencies: 0.006454 895500 -- (-1405.155) (-1403.568) (-1404.726) [-1401.622] * (-1404.953) (-1402.805) (-1401.510) [-1404.099] -- 0:00:06 896000 -- [-1402.964] (-1403.983) (-1401.616) (-1403.372) * (-1401.849) [-1403.294] (-1405.963) (-1402.623) -- 0:00:06 896500 -- [-1404.429] (-1405.000) (-1402.280) (-1401.264) * (-1401.529) [-1403.064] (-1404.827) (-1401.645) -- 0:00:06 897000 -- [-1402.899] (-1402.822) (-1401.648) (-1403.697) * (-1402.902) (-1401.995) (-1405.926) [-1402.849] -- 0:00:06 897500 -- (-1401.723) [-1409.726] (-1402.220) (-1402.468) * (-1403.255) [-1401.516] (-1402.362) (-1403.990) -- 0:00:06 898000 -- (-1403.723) (-1401.117) [-1403.018] (-1402.772) * (-1403.775) [-1401.994] (-1403.421) (-1403.652) -- 0:00:06 898500 -- (-1406.653) (-1400.934) [-1401.930] (-1403.093) * (-1408.321) [-1400.811] (-1400.720) (-1403.526) -- 0:00:06 899000 -- (-1402.712) [-1405.284] (-1401.883) (-1403.736) * (-1405.067) (-1404.748) [-1402.566] (-1407.081) -- 0:00:06 899500 -- (-1401.310) (-1402.405) [-1400.991] (-1405.103) * (-1406.700) (-1403.648) [-1402.718] (-1412.024) -- 0:00:06 900000 -- [-1401.218] (-1403.683) (-1400.921) (-1402.381) * [-1405.085] (-1402.312) (-1401.772) (-1409.765) -- 0:00:06 Average standard deviation of split frequencies: 0.006211 900500 -- [-1402.869] (-1402.598) (-1400.941) (-1404.678) * (-1402.118) [-1404.336] (-1402.485) (-1403.116) -- 0:00:06 901000 -- (-1402.074) (-1402.662) [-1402.953] (-1400.892) * (-1403.475) [-1402.695] (-1404.020) (-1403.738) -- 0:00:06 901500 -- [-1402.264] (-1403.375) (-1404.246) (-1402.653) * [-1403.880] (-1401.881) (-1404.071) (-1406.414) -- 0:00:06 902000 -- [-1401.207] (-1403.846) (-1401.836) (-1403.343) * (-1402.378) (-1401.616) (-1405.804) [-1402.397] -- 0:00:06 902500 -- (-1401.344) (-1404.876) [-1401.410] (-1402.154) * (-1401.838) (-1405.731) (-1406.205) [-1401.201] -- 0:00:06 903000 -- (-1401.465) (-1402.869) (-1403.583) [-1402.706] * [-1402.392] (-1407.818) (-1402.602) (-1401.141) -- 0:00:06 903500 -- (-1402.586) (-1407.949) (-1404.348) [-1402.483] * [-1406.040] (-1404.447) (-1408.068) (-1403.729) -- 0:00:06 904000 -- [-1402.670] (-1405.718) (-1402.890) (-1401.763) * (-1402.006) [-1402.775] (-1408.900) (-1405.088) -- 0:00:06 904500 -- (-1404.482) (-1404.695) (-1402.864) [-1403.615] * (-1402.792) (-1402.301) (-1406.565) [-1405.725] -- 0:00:06 905000 -- [-1405.189] (-1409.153) (-1403.591) (-1405.848) * [-1403.083] (-1403.072) (-1403.431) (-1406.177) -- 0:00:06 Average standard deviation of split frequencies: 0.006244 905500 -- (-1404.164) (-1403.046) [-1403.901] (-1403.355) * (-1401.198) [-1402.539] (-1402.508) (-1404.173) -- 0:00:06 906000 -- (-1401.574) [-1401.774] (-1401.539) (-1402.634) * (-1402.710) (-1401.692) (-1402.611) [-1400.900] -- 0:00:06 906500 -- (-1402.564) (-1401.815) (-1400.955) [-1402.388] * [-1402.030] (-1402.757) (-1401.948) (-1405.989) -- 0:00:05 907000 -- (-1405.013) (-1404.620) (-1402.654) [-1401.993] * (-1404.463) (-1402.875) [-1401.214] (-1404.193) -- 0:00:05 907500 -- (-1402.760) (-1402.192) (-1404.314) [-1402.013] * (-1402.728) (-1403.329) [-1402.092] (-1401.679) -- 0:00:05 908000 -- (-1401.527) (-1402.841) (-1405.486) [-1403.677] * (-1405.565) (-1402.079) (-1402.251) [-1401.168] -- 0:00:05 908500 -- [-1402.150] (-1403.379) (-1401.971) (-1403.936) * [-1402.331] (-1404.723) (-1402.506) (-1402.876) -- 0:00:05 909000 -- [-1402.328] (-1402.390) (-1403.144) (-1401.532) * (-1403.677) [-1402.098] (-1402.069) (-1403.142) -- 0:00:05 909500 -- [-1401.570] (-1402.341) (-1402.696) (-1403.575) * (-1402.212) [-1403.600] (-1401.306) (-1406.467) -- 0:00:05 910000 -- (-1405.205) (-1402.134) [-1402.005] (-1403.571) * (-1408.661) (-1405.447) (-1402.240) [-1404.670] -- 0:00:05 Average standard deviation of split frequencies: 0.007005 910500 -- [-1402.850] (-1401.566) (-1409.111) (-1405.199) * (-1403.170) [-1406.476] (-1403.188) (-1404.184) -- 0:00:05 911000 -- [-1405.682] (-1402.390) (-1403.927) (-1402.598) * (-1402.578) (-1407.396) [-1401.488] (-1405.919) -- 0:00:05 911500 -- (-1405.728) [-1403.055] (-1405.442) (-1401.128) * (-1404.887) (-1407.083) [-1404.482] (-1402.202) -- 0:00:05 912000 -- [-1404.777] (-1403.568) (-1404.042) (-1402.570) * (-1401.692) [-1402.615] (-1404.757) (-1402.839) -- 0:00:05 912500 -- [-1406.483] (-1402.818) (-1401.391) (-1401.481) * (-1402.763) (-1402.742) [-1402.335] (-1404.002) -- 0:00:05 913000 -- (-1404.995) (-1401.940) (-1402.776) [-1401.746] * (-1403.755) (-1402.054) (-1402.025) [-1406.351] -- 0:00:05 913500 -- (-1403.847) (-1402.382) (-1401.875) [-1401.818] * [-1403.123] (-1402.214) (-1401.283) (-1402.927) -- 0:00:05 914000 -- [-1402.484] (-1404.232) (-1406.153) (-1401.577) * (-1400.798) (-1402.111) [-1403.847] (-1406.591) -- 0:00:05 914500 -- [-1402.437] (-1402.074) (-1404.488) (-1401.451) * (-1403.849) (-1402.344) (-1404.109) [-1401.890] -- 0:00:05 915000 -- (-1401.161) [-1402.435] (-1401.731) (-1402.137) * (-1402.202) [-1403.321] (-1404.312) (-1401.156) -- 0:00:05 Average standard deviation of split frequencies: 0.006965 915500 -- (-1401.161) (-1403.246) (-1401.518) [-1401.868] * (-1402.893) [-1404.939] (-1403.506) (-1401.765) -- 0:00:05 916000 -- (-1403.126) (-1401.612) [-1401.670] (-1404.504) * [-1404.545] (-1403.450) (-1401.737) (-1402.338) -- 0:00:05 916500 -- (-1404.291) (-1409.158) (-1404.853) [-1403.700] * (-1401.144) (-1407.096) (-1401.652) [-1401.911] -- 0:00:05 917000 -- (-1405.632) [-1403.114] (-1406.051) (-1402.599) * (-1402.682) (-1401.153) (-1401.765) [-1401.400] -- 0:00:05 917500 -- (-1403.870) [-1404.294] (-1405.463) (-1403.247) * (-1404.086) (-1404.382) [-1402.219] (-1402.086) -- 0:00:05 918000 -- (-1403.329) (-1403.726) (-1404.551) [-1402.006] * (-1405.775) (-1401.038) [-1401.180] (-1401.840) -- 0:00:05 918500 -- [-1401.789] (-1404.593) (-1406.106) (-1402.905) * (-1402.701) [-1403.384] (-1401.310) (-1401.521) -- 0:00:05 919000 -- (-1402.350) [-1401.717] (-1403.807) (-1401.600) * [-1404.181] (-1401.923) (-1401.429) (-1401.532) -- 0:00:05 919500 -- (-1402.350) (-1402.341) [-1403.447] (-1401.972) * (-1407.515) (-1406.829) (-1407.704) [-1403.954] -- 0:00:05 920000 -- (-1402.262) [-1405.750] (-1401.437) (-1401.953) * (-1403.493) (-1408.019) (-1404.392) [-1403.851] -- 0:00:05 Average standard deviation of split frequencies: 0.007407 920500 -- (-1402.528) (-1401.627) [-1401.492] (-1403.435) * (-1402.189) (-1403.149) (-1402.070) [-1402.196] -- 0:00:05 921000 -- (-1402.397) (-1411.231) (-1402.772) [-1402.734] * (-1403.028) (-1403.150) [-1404.507] (-1402.088) -- 0:00:05 921500 -- (-1404.400) [-1402.603] (-1404.577) (-1403.695) * (-1400.882) (-1404.009) (-1407.108) [-1403.408] -- 0:00:05 922000 -- [-1402.476] (-1402.569) (-1402.711) (-1402.822) * (-1401.161) (-1404.158) (-1403.759) [-1404.015] -- 0:00:04 922500 -- (-1405.568) (-1401.706) [-1402.623] (-1402.856) * (-1402.244) (-1403.177) [-1407.427] (-1402.709) -- 0:00:04 923000 -- (-1404.511) (-1401.973) (-1404.102) [-1403.277] * [-1402.633] (-1406.228) (-1405.297) (-1403.380) -- 0:00:04 923500 -- (-1402.242) (-1401.742) (-1402.745) [-1403.625] * (-1401.275) (-1402.033) [-1402.465] (-1401.502) -- 0:00:04 924000 -- (-1402.752) (-1403.118) [-1401.808] (-1402.252) * (-1402.760) (-1403.339) [-1404.323] (-1402.934) -- 0:00:04 924500 -- [-1402.342] (-1404.551) (-1401.936) (-1403.266) * (-1401.922) [-1403.179] (-1402.822) (-1401.916) -- 0:00:04 925000 -- (-1401.563) [-1402.343] (-1406.171) (-1407.056) * (-1404.681) (-1404.827) (-1402.097) [-1404.470] -- 0:00:04 Average standard deviation of split frequencies: 0.007399 925500 -- (-1405.240) (-1403.641) (-1411.161) [-1401.414] * (-1403.232) (-1402.945) [-1403.071] (-1404.456) -- 0:00:04 926000 -- (-1404.906) (-1402.565) [-1405.293] (-1401.147) * (-1402.768) (-1403.106) (-1401.316) [-1402.466] -- 0:00:04 926500 -- (-1404.322) [-1403.089] (-1405.500) (-1404.917) * [-1403.385] (-1407.793) (-1401.499) (-1401.569) -- 0:00:04 927000 -- (-1403.150) (-1403.641) (-1401.985) [-1402.871] * (-1403.570) (-1406.959) [-1401.718] (-1403.431) -- 0:00:04 927500 -- (-1407.449) (-1401.601) [-1402.272] (-1404.606) * [-1402.851] (-1401.204) (-1401.513) (-1401.396) -- 0:00:04 928000 -- [-1406.558] (-1401.804) (-1403.259) (-1406.136) * (-1405.646) [-1403.080] (-1403.459) (-1401.836) -- 0:00:04 928500 -- [-1403.821] (-1403.089) (-1403.649) (-1404.057) * (-1401.424) [-1405.534] (-1403.180) (-1402.161) -- 0:00:04 929000 -- (-1402.556) (-1403.828) [-1405.738] (-1404.053) * (-1403.195) [-1402.203] (-1401.724) (-1402.039) -- 0:00:04 929500 -- (-1401.346) (-1401.238) (-1402.363) [-1405.564] * (-1403.250) (-1402.585) [-1404.607] (-1409.169) -- 0:00:04 930000 -- (-1403.430) [-1400.994] (-1402.617) (-1403.462) * [-1408.029] (-1401.435) (-1402.412) (-1404.192) -- 0:00:04 Average standard deviation of split frequencies: 0.007226 930500 -- (-1402.989) (-1402.199) (-1405.446) [-1401.782] * [-1401.100] (-1402.391) (-1402.071) (-1401.546) -- 0:00:04 931000 -- [-1402.367] (-1404.329) (-1403.923) (-1404.651) * [-1401.662] (-1401.876) (-1404.857) (-1402.181) -- 0:00:04 931500 -- (-1402.508) (-1408.494) [-1401.540] (-1402.795) * (-1402.867) (-1401.032) [-1402.076] (-1404.808) -- 0:00:04 932000 -- [-1403.870] (-1401.374) (-1402.631) (-1402.448) * (-1401.273) (-1402.740) [-1405.391] (-1401.529) -- 0:00:04 932500 -- (-1401.833) (-1401.570) [-1401.551] (-1403.586) * [-1404.023] (-1407.053) (-1401.988) (-1406.171) -- 0:00:04 933000 -- [-1404.537] (-1402.149) (-1401.695) (-1403.527) * (-1401.845) (-1404.849) [-1402.365] (-1401.592) -- 0:00:04 933500 -- (-1402.916) (-1402.803) [-1403.011] (-1402.342) * (-1401.775) (-1405.235) [-1404.126] (-1401.246) -- 0:00:04 934000 -- (-1406.743) [-1402.079] (-1405.913) (-1402.081) * (-1402.612) (-1403.103) (-1403.725) [-1400.887] -- 0:00:04 934500 -- [-1407.687] (-1403.141) (-1405.222) (-1403.546) * (-1403.089) (-1403.588) (-1401.546) [-1402.090] -- 0:00:04 935000 -- [-1404.724] (-1407.819) (-1403.588) (-1401.413) * (-1402.389) [-1403.280] (-1402.874) (-1402.530) -- 0:00:04 Average standard deviation of split frequencies: 0.006883 935500 -- (-1402.309) (-1402.982) [-1401.594] (-1400.928) * (-1404.886) (-1402.059) (-1402.655) [-1406.155] -- 0:00:04 936000 -- [-1402.085] (-1401.999) (-1402.547) (-1401.928) * (-1402.541) [-1401.378] (-1403.818) (-1405.038) -- 0:00:04 936500 -- (-1401.696) (-1401.849) (-1401.862) [-1401.644] * (-1402.048) (-1402.607) (-1402.018) [-1405.023] -- 0:00:04 937000 -- (-1402.449) (-1403.943) [-1404.757] (-1402.601) * (-1401.672) (-1402.291) [-1401.706] (-1402.091) -- 0:00:04 937500 -- (-1402.094) [-1405.514] (-1402.972) (-1403.177) * [-1402.543] (-1404.701) (-1403.176) (-1402.445) -- 0:00:04 938000 -- (-1403.834) (-1404.346) (-1402.849) [-1405.074] * [-1402.140] (-1402.801) (-1402.051) (-1404.253) -- 0:00:03 938500 -- [-1405.554] (-1402.470) (-1406.346) (-1404.550) * [-1403.674] (-1401.965) (-1406.028) (-1402.396) -- 0:00:03 939000 -- (-1402.355) [-1402.065] (-1403.782) (-1404.233) * (-1404.227) (-1401.844) [-1403.832] (-1401.945) -- 0:00:03 939500 -- (-1401.241) (-1404.909) (-1404.446) [-1402.597] * [-1401.667] (-1403.614) (-1402.485) (-1401.646) -- 0:00:03 940000 -- [-1403.191] (-1406.949) (-1402.259) (-1401.967) * [-1401.556] (-1403.606) (-1402.062) (-1402.123) -- 0:00:03 Average standard deviation of split frequencies: 0.006782 940500 -- (-1402.555) (-1402.219) (-1403.858) [-1405.575] * (-1401.973) [-1402.640] (-1403.096) (-1403.162) -- 0:00:03 941000 -- (-1403.096) (-1404.642) (-1402.489) [-1402.761] * (-1403.410) (-1404.150) [-1401.869] (-1402.130) -- 0:00:03 941500 -- [-1403.477] (-1401.809) (-1406.608) (-1404.440) * (-1401.297) (-1400.896) [-1403.113] (-1401.704) -- 0:00:03 942000 -- (-1402.889) [-1401.378] (-1402.629) (-1403.112) * (-1402.759) [-1402.023] (-1403.221) (-1401.463) -- 0:00:03 942500 -- [-1401.894] (-1403.877) (-1405.649) (-1404.515) * [-1404.703] (-1403.645) (-1402.130) (-1401.286) -- 0:00:03 943000 -- (-1404.618) (-1401.269) [-1403.910] (-1403.011) * [-1405.214] (-1402.442) (-1403.756) (-1401.466) -- 0:00:03 943500 -- (-1401.974) [-1401.788] (-1407.129) (-1402.846) * (-1409.327) (-1403.685) (-1400.980) [-1402.034] -- 0:00:03 944000 -- (-1403.541) (-1406.644) (-1403.607) [-1402.069] * (-1401.699) (-1406.255) [-1401.194] (-1403.250) -- 0:00:03 944500 -- (-1402.972) (-1405.347) (-1401.448) [-1403.254] * [-1404.298] (-1402.529) (-1401.780) (-1403.995) -- 0:00:03 945000 -- (-1404.842) [-1403.401] (-1404.487) (-1401.560) * (-1402.259) (-1404.853) [-1401.573] (-1401.979) -- 0:00:03 Average standard deviation of split frequencies: 0.007109 945500 -- (-1404.611) (-1403.064) [-1401.481] (-1402.928) * (-1404.394) (-1401.232) (-1404.044) [-1401.807] -- 0:00:03 946000 -- [-1402.359] (-1405.050) (-1404.139) (-1402.302) * (-1405.018) (-1401.804) [-1404.068] (-1402.047) -- 0:00:03 946500 -- [-1402.313] (-1403.539) (-1405.139) (-1402.272) * (-1402.913) (-1401.351) [-1403.930] (-1402.945) -- 0:00:03 947000 -- (-1402.976) [-1402.158] (-1403.996) (-1402.489) * [-1402.563] (-1401.456) (-1406.068) (-1404.102) -- 0:00:03 947500 -- (-1406.093) (-1406.227) (-1405.542) [-1402.894] * (-1402.334) (-1402.500) (-1402.382) [-1404.761] -- 0:00:03 948000 -- [-1402.807] (-1403.986) (-1402.402) (-1401.529) * (-1404.928) (-1406.043) (-1403.937) [-1402.879] -- 0:00:03 948500 -- (-1405.242) (-1403.634) (-1404.521) [-1401.755] * (-1403.963) [-1402.745] (-1401.991) (-1402.410) -- 0:00:03 949000 -- (-1403.749) (-1403.499) [-1404.006] (-1401.316) * (-1403.804) (-1405.286) [-1405.486] (-1401.517) -- 0:00:03 949500 -- (-1403.819) (-1402.874) [-1402.890] (-1403.465) * (-1404.568) (-1403.660) (-1405.283) [-1401.518] -- 0:00:03 950000 -- (-1405.641) [-1403.361] (-1401.661) (-1404.965) * (-1406.036) (-1404.904) (-1405.928) [-1401.138] -- 0:00:03 Average standard deviation of split frequencies: 0.007306 950500 -- (-1405.078) [-1403.996] (-1407.012) (-1403.571) * (-1404.194) (-1406.203) (-1403.958) [-1402.051] -- 0:00:03 951000 -- (-1402.507) (-1406.585) [-1402.117] (-1404.782) * (-1408.157) (-1401.222) [-1402.765] (-1409.547) -- 0:00:03 951500 -- (-1402.639) [-1402.468] (-1403.889) (-1404.299) * (-1404.816) (-1410.598) [-1401.978] (-1404.270) -- 0:00:03 952000 -- (-1403.421) (-1402.492) (-1404.345) [-1403.554] * [-1403.340] (-1401.728) (-1404.172) (-1402.988) -- 0:00:03 952500 -- [-1403.691] (-1404.535) (-1409.556) (-1402.760) * (-1401.487) (-1402.248) (-1406.210) [-1403.564] -- 0:00:03 953000 -- (-1403.417) (-1403.815) (-1403.337) [-1402.761] * (-1406.392) [-1404.931] (-1404.733) (-1401.648) -- 0:00:03 953500 -- (-1404.442) (-1404.680) [-1404.827] (-1401.201) * (-1405.371) (-1404.281) (-1403.743) [-1402.134] -- 0:00:02 954000 -- [-1402.544] (-1402.845) (-1406.118) (-1405.902) * (-1403.414) (-1402.226) (-1405.465) [-1401.824] -- 0:00:02 954500 -- (-1402.372) (-1407.267) [-1401.251] (-1402.864) * (-1403.031) (-1402.913) [-1403.401] (-1405.716) -- 0:00:02 955000 -- (-1401.522) (-1405.726) [-1403.749] (-1401.296) * (-1403.004) [-1404.610] (-1402.998) (-1402.819) -- 0:00:02 Average standard deviation of split frequencies: 0.007199 955500 -- (-1404.029) (-1401.535) [-1402.990] (-1402.890) * (-1403.190) [-1402.072] (-1404.774) (-1404.063) -- 0:00:02 956000 -- [-1405.242] (-1401.537) (-1402.254) (-1401.885) * [-1401.940] (-1404.978) (-1402.439) (-1405.212) -- 0:00:02 956500 -- (-1403.505) [-1401.888] (-1401.428) (-1404.478) * (-1401.660) (-1404.745) (-1403.888) [-1403.399] -- 0:00:02 957000 -- (-1403.329) [-1402.690] (-1401.105) (-1402.847) * (-1401.209) (-1402.163) [-1402.513] (-1402.927) -- 0:00:02 957500 -- [-1401.445] (-1404.600) (-1403.442) (-1402.660) * (-1401.946) (-1403.298) [-1403.307] (-1401.687) -- 0:00:02 958000 -- (-1402.772) (-1402.244) (-1401.182) [-1404.496] * (-1404.276) [-1402.409] (-1401.599) (-1404.938) -- 0:00:02 958500 -- (-1402.897) (-1402.307) (-1402.784) [-1403.968] * (-1404.595) (-1401.799) [-1404.780] (-1402.244) -- 0:00:02 959000 -- (-1403.678) (-1401.552) (-1401.336) [-1401.317] * (-1405.972) [-1400.961] (-1402.519) (-1402.613) -- 0:00:02 959500 -- (-1403.316) [-1403.113] (-1401.884) (-1404.131) * (-1404.112) [-1402.065] (-1400.661) (-1403.337) -- 0:00:02 960000 -- (-1404.101) (-1403.606) [-1400.932] (-1402.311) * [-1403.043] (-1402.258) (-1401.211) (-1401.308) -- 0:00:02 Average standard deviation of split frequencies: 0.007033 960500 -- (-1408.499) (-1403.490) [-1400.695] (-1402.403) * (-1402.605) (-1400.692) [-1401.221] (-1402.101) -- 0:00:02 961000 -- (-1403.615) (-1402.605) (-1401.386) [-1402.290] * (-1405.599) [-1403.380] (-1400.901) (-1404.554) -- 0:00:02 961500 -- (-1402.196) (-1401.950) (-1402.264) [-1403.107] * [-1406.247] (-1401.656) (-1400.931) (-1402.757) -- 0:00:02 962000 -- (-1401.479) (-1402.483) (-1401.756) [-1403.205] * (-1405.112) (-1403.635) (-1402.957) [-1405.082] -- 0:00:02 962500 -- (-1404.362) (-1405.770) (-1404.033) [-1402.184] * (-1403.557) (-1401.840) (-1402.356) [-1406.769] -- 0:00:02 963000 -- (-1401.446) (-1401.484) (-1402.918) [-1404.408] * (-1401.557) [-1402.047] (-1401.774) (-1407.542) -- 0:00:02 963500 -- [-1401.158] (-1402.533) (-1403.957) (-1402.684) * (-1403.201) (-1401.428) (-1402.185) [-1403.354] -- 0:00:02 964000 -- (-1405.214) (-1402.076) (-1402.073) [-1403.418] * (-1401.638) (-1404.170) (-1401.836) [-1402.552] -- 0:00:02 964500 -- (-1406.326) (-1405.780) (-1403.944) [-1402.666] * [-1402.814] (-1406.244) (-1403.104) (-1400.911) -- 0:00:02 965000 -- [-1403.111] (-1403.088) (-1402.990) (-1404.149) * [-1400.741] (-1409.349) (-1401.682) (-1401.528) -- 0:00:02 Average standard deviation of split frequencies: 0.007027 965500 -- (-1403.581) (-1403.883) [-1401.184] (-1401.541) * [-1400.971] (-1402.452) (-1402.312) (-1401.592) -- 0:00:02 966000 -- (-1402.664) (-1401.547) (-1402.909) [-1401.275] * (-1403.324) (-1402.021) (-1402.783) [-1402.818] -- 0:00:02 966500 -- (-1404.224) (-1401.795) (-1402.208) [-1401.626] * (-1403.457) (-1401.770) [-1402.447] (-1403.994) -- 0:00:02 967000 -- (-1401.182) (-1403.186) (-1402.239) [-1401.257] * (-1401.922) [-1403.780] (-1405.478) (-1403.095) -- 0:00:02 967500 -- (-1403.934) (-1402.554) [-1402.945] (-1404.431) * [-1402.094] (-1406.447) (-1401.278) (-1401.717) -- 0:00:02 968000 -- (-1403.301) (-1401.378) [-1403.808] (-1404.029) * (-1402.129) (-1405.884) (-1402.083) [-1401.802] -- 0:00:02 968500 -- [-1403.851] (-1401.544) (-1405.889) (-1402.214) * (-1402.030) (-1404.554) [-1403.762] (-1404.386) -- 0:00:02 969000 -- (-1402.714) (-1403.825) (-1406.490) [-1402.665] * [-1404.655] (-1403.364) (-1401.719) (-1405.531) -- 0:00:01 969500 -- (-1403.329) (-1409.536) [-1401.645] (-1402.614) * [-1403.585] (-1400.754) (-1402.728) (-1400.904) -- 0:00:01 970000 -- [-1402.215] (-1401.925) (-1405.222) (-1402.230) * [-1402.045] (-1403.324) (-1404.181) (-1401.304) -- 0:00:01 Average standard deviation of split frequencies: 0.007123 970500 -- (-1401.574) (-1400.945) [-1403.893] (-1407.312) * [-1400.984] (-1402.477) (-1403.492) (-1403.350) -- 0:00:01 971000 -- [-1402.287] (-1401.034) (-1409.094) (-1405.574) * [-1401.550] (-1405.570) (-1405.119) (-1402.127) -- 0:00:01 971500 -- (-1403.152) [-1401.463] (-1407.195) (-1402.346) * (-1403.733) (-1401.470) (-1402.067) [-1400.790] -- 0:00:01 972000 -- (-1404.506) (-1404.121) [-1402.483] (-1401.758) * (-1403.130) (-1402.360) [-1401.898] (-1404.482) -- 0:00:01 972500 -- [-1401.530] (-1407.822) (-1405.126) (-1401.265) * [-1400.927] (-1401.583) (-1401.937) (-1402.818) -- 0:00:01 973000 -- (-1402.534) [-1401.831] (-1402.694) (-1400.952) * (-1401.173) (-1403.185) (-1401.591) [-1404.300] -- 0:00:01 973500 -- (-1402.827) (-1402.707) (-1401.893) [-1402.745] * (-1401.798) [-1403.317] (-1402.118) (-1406.783) -- 0:00:01 974000 -- (-1401.622) [-1403.516] (-1400.665) (-1401.486) * (-1401.884) (-1402.437) (-1401.145) [-1403.862] -- 0:00:01 974500 -- [-1402.997] (-1405.172) (-1403.094) (-1404.299) * (-1401.462) (-1404.740) [-1400.856] (-1403.578) -- 0:00:01 975000 -- [-1403.125] (-1403.257) (-1403.726) (-1404.087) * (-1406.867) [-1402.536] (-1401.369) (-1410.563) -- 0:00:01 Average standard deviation of split frequencies: 0.006859 975500 -- (-1403.652) (-1404.538) (-1401.838) [-1406.090] * [-1404.478] (-1402.457) (-1403.970) (-1404.844) -- 0:00:01 976000 -- (-1403.270) (-1401.414) [-1401.005] (-1401.694) * (-1402.288) [-1403.870] (-1403.146) (-1404.033) -- 0:00:01 976500 -- (-1401.723) (-1400.966) [-1401.493] (-1401.991) * (-1402.415) (-1402.528) (-1402.006) [-1402.867] -- 0:00:01 977000 -- (-1401.751) [-1402.944] (-1402.964) (-1402.644) * (-1403.126) [-1401.885] (-1401.841) (-1404.405) -- 0:00:01 977500 -- (-1401.533) (-1402.745) (-1402.358) [-1401.299] * (-1402.865) (-1405.595) (-1402.406) [-1402.096] -- 0:00:01 978000 -- (-1405.227) [-1401.763] (-1402.309) (-1401.850) * (-1404.078) (-1403.093) (-1402.716) [-1404.714] -- 0:00:01 978500 -- (-1404.387) [-1404.860] (-1408.897) (-1401.944) * (-1402.977) (-1404.318) [-1402.611] (-1405.566) -- 0:00:01 979000 -- (-1404.683) (-1403.084) [-1404.647] (-1403.368) * (-1401.050) (-1407.045) (-1406.984) [-1405.642] -- 0:00:01 979500 -- [-1402.131] (-1403.371) (-1404.287) (-1400.945) * (-1404.667) (-1404.350) (-1403.958) [-1401.990] -- 0:00:01 980000 -- [-1402.092] (-1405.481) (-1402.448) (-1404.043) * (-1402.713) (-1404.422) (-1402.697) [-1402.767] -- 0:00:01 Average standard deviation of split frequencies: 0.006698 980500 -- [-1402.513] (-1404.463) (-1402.526) (-1401.230) * (-1401.720) [-1407.100] (-1402.302) (-1402.379) -- 0:00:01 981000 -- (-1403.255) (-1410.411) [-1403.443] (-1413.404) * (-1401.572) [-1406.957] (-1403.643) (-1402.816) -- 0:00:01 981500 -- (-1406.686) [-1403.341] (-1402.095) (-1406.454) * (-1401.850) [-1406.020] (-1405.563) (-1403.372) -- 0:00:01 982000 -- (-1402.902) (-1403.338) [-1403.929] (-1404.794) * [-1401.496] (-1405.076) (-1407.505) (-1407.114) -- 0:00:01 982500 -- (-1402.441) (-1401.334) (-1401.773) [-1401.598] * (-1403.225) (-1404.585) [-1404.215] (-1403.513) -- 0:00:01 983000 -- (-1401.758) [-1401.967] (-1402.460) (-1402.516) * (-1405.258) (-1401.296) (-1402.619) [-1403.753] -- 0:00:01 983500 -- (-1401.762) (-1401.879) [-1402.699] (-1402.365) * [-1402.700] (-1402.979) (-1403.002) (-1403.391) -- 0:00:01 984000 -- [-1403.353] (-1405.324) (-1400.872) (-1401.228) * (-1401.767) [-1403.490] (-1402.834) (-1403.795) -- 0:00:01 984500 -- (-1402.380) (-1405.130) (-1401.090) [-1401.856] * [-1402.781] (-1401.920) (-1402.221) (-1404.074) -- 0:00:00 985000 -- [-1405.780] (-1402.881) (-1402.190) (-1404.212) * (-1402.705) (-1401.494) [-1402.277] (-1405.408) -- 0:00:00 Average standard deviation of split frequencies: 0.006916 985500 -- (-1403.987) (-1401.408) [-1404.021] (-1403.856) * (-1401.530) (-1406.210) (-1401.202) [-1401.834] -- 0:00:00 986000 -- (-1405.726) [-1401.773] (-1402.962) (-1404.792) * [-1402.325] (-1403.995) (-1401.958) (-1402.150) -- 0:00:00 986500 -- [-1402.650] (-1403.833) (-1403.277) (-1410.598) * (-1403.353) (-1403.045) (-1401.244) [-1402.945] -- 0:00:00 987000 -- [-1402.561] (-1404.325) (-1410.281) (-1404.140) * [-1403.880] (-1402.521) (-1401.507) (-1401.194) -- 0:00:00 987500 -- (-1401.346) [-1403.099] (-1407.838) (-1404.909) * [-1401.747] (-1405.399) (-1401.112) (-1403.659) -- 0:00:00 988000 -- (-1410.177) (-1400.968) [-1402.199] (-1403.201) * (-1403.666) (-1406.726) (-1401.742) [-1402.255] -- 0:00:00 988500 -- (-1401.948) (-1401.421) [-1401.617] (-1403.661) * [-1402.858] (-1404.254) (-1403.868) (-1402.358) -- 0:00:00 989000 -- (-1406.066) (-1401.862) (-1402.393) [-1401.263] * (-1401.721) [-1404.931] (-1403.617) (-1402.355) -- 0:00:00 989500 -- (-1404.309) [-1402.135] (-1401.889) (-1402.490) * (-1401.557) (-1409.720) [-1403.911] (-1401.808) -- 0:00:00 990000 -- (-1401.497) (-1405.104) [-1401.842] (-1405.232) * (-1401.619) (-1409.235) [-1401.445] (-1402.497) -- 0:00:00 Average standard deviation of split frequencies: 0.006662 990500 -- (-1403.191) (-1406.205) [-1402.201] (-1405.008) * (-1402.611) [-1402.710] (-1401.602) (-1402.969) -- 0:00:00 991000 -- (-1402.812) (-1403.087) [-1404.474] (-1405.435) * (-1404.591) (-1404.266) [-1400.689] (-1404.110) -- 0:00:00 991500 -- (-1402.815) [-1403.054] (-1410.158) (-1406.051) * (-1403.984) (-1402.973) (-1401.864) [-1403.608] -- 0:00:00 992000 -- (-1403.929) (-1402.708) (-1402.053) [-1401.770] * (-1402.960) [-1403.686] (-1402.172) (-1402.210) -- 0:00:00 992500 -- (-1402.091) (-1404.370) (-1402.960) [-1404.360] * (-1404.094) (-1403.668) (-1408.222) [-1402.372] -- 0:00:00 993000 -- [-1401.855] (-1402.916) (-1402.056) (-1406.845) * (-1404.794) (-1402.727) (-1401.969) [-1402.352] -- 0:00:00 993500 -- (-1401.777) (-1403.268) [-1403.333] (-1401.107) * (-1404.054) (-1402.456) [-1403.137] (-1403.415) -- 0:00:00 994000 -- (-1402.001) (-1408.923) (-1403.989) [-1404.374] * (-1403.970) [-1401.248] (-1404.760) (-1405.058) -- 0:00:00 994500 -- (-1403.457) (-1403.320) (-1402.755) [-1402.753] * [-1406.486] (-1401.398) (-1401.277) (-1403.172) -- 0:00:00 995000 -- (-1402.908) [-1404.232] (-1404.762) (-1409.330) * (-1404.294) (-1401.870) [-1400.604] (-1403.604) -- 0:00:00 Average standard deviation of split frequencies: 0.006879 995500 -- [-1401.450] (-1402.893) (-1401.793) (-1402.976) * (-1404.264) [-1401.899] (-1401.034) (-1405.233) -- 0:00:00 996000 -- [-1402.769] (-1403.187) (-1401.585) (-1403.376) * [-1402.841] (-1401.597) (-1401.937) (-1402.530) -- 0:00:00 996500 -- (-1401.026) (-1401.082) (-1407.183) [-1402.625] * (-1404.472) (-1401.842) (-1402.840) [-1403.335] -- 0:00:00 997000 -- (-1403.513) (-1403.294) (-1408.118) [-1403.298] * (-1402.616) [-1404.406] (-1401.383) (-1403.095) -- 0:00:00 997500 -- [-1401.113] (-1404.297) (-1404.470) (-1402.497) * [-1401.304] (-1403.103) (-1405.500) (-1402.367) -- 0:00:00 998000 -- [-1402.259] (-1403.291) (-1403.577) (-1404.351) * [-1402.205] (-1407.690) (-1403.419) (-1401.335) -- 0:00:00 998500 -- [-1401.544] (-1404.312) (-1401.884) (-1402.898) * (-1402.166) (-1403.541) (-1403.392) [-1401.290] -- 0:00:00 999000 -- (-1403.475) [-1401.704] (-1405.603) (-1409.284) * (-1402.253) (-1402.725) [-1401.848] (-1402.209) -- 0:00:00 999500 -- (-1403.877) [-1401.581] (-1404.179) (-1404.336) * (-1405.406) [-1409.905] (-1402.413) (-1402.327) -- 0:00:00 1000000 -- (-1403.147) (-1402.208) [-1409.086] (-1402.184) * (-1402.036) (-1404.918) [-1402.582] (-1403.624) -- 0:00:00 Average standard deviation of split frequencies: 0.006564 Analysis completed in 1 mins 4 seconds Analysis used 62.67 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1400.54 Likelihood of best state for "cold" chain of run 2 was -1400.54 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.2 % ( 63 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.5 % ( 26 %) Dirichlet(Pi{all}) 27.5 % ( 27 %) Slider(Pi{all}) 79.2 % ( 52 %) Multiplier(Alpha{1,2}) 77.4 % ( 54 %) Multiplier(Alpha{3}) 17.2 % ( 27 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 34 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.3 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 76.3 % ( 69 %) Dirichlet(Revmat{all}) 99.9 % ( 99 %) Slider(Revmat{all}) 25.2 % ( 17 %) Dirichlet(Pi{all}) 26.8 % ( 24 %) Slider(Pi{all}) 78.9 % ( 48 %) Multiplier(Alpha{1,2}) 77.8 % ( 51 %) Multiplier(Alpha{3}) 16.0 % ( 26 %) Slider(Pinvar{all}) 98.7 % (100 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 60 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 29 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.2 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166364 0.82 0.67 3 | 166955 166263 0.84 4 | 166315 167424 166679 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166061 0.82 0.67 3 | 167019 166708 0.84 4 | 166488 167085 166639 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1402.24 | 2 | | 1 2 2 1 | | 2 1 2 11 2 2 2 | | 2 112 1 2 1 2 2 | | 1 2 1 2 2 12 1 1 2 211 1 1| |2 21 1 1 1 2 1 2 * 2 * 112 22 12| |1 1 1 2 2 1 2 2 1 1 2 1 2 2 1 | | * 221 2 1 11 2 1 1 2 1 2 21 11 | | 2 12 2 2 2 2 2 1 * | | * 1 2 11 1 2 2 | | 1 1 2 | | 1 12 | | | | | | 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1404.16 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1402.30 -1405.75 2 -1402.26 -1405.19 -------------------------------------- TOTAL -1402.28 -1405.51 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.888920 0.088882 0.354249 1.444268 0.849925 1443.34 1472.17 1.000 r(A<->C){all} 0.165280 0.020034 0.000043 0.444490 0.126385 219.66 226.12 1.003 r(A<->G){all} 0.170404 0.020937 0.000016 0.459428 0.132482 163.92 219.12 1.000 r(A<->T){all} 0.158926 0.018329 0.000186 0.436666 0.121455 147.44 180.06 1.002 r(C<->G){all} 0.183281 0.021618 0.000066 0.476269 0.145225 197.41 221.28 1.005 r(C<->T){all} 0.156803 0.018551 0.000010 0.440722 0.118362 196.79 199.80 1.003 r(G<->T){all} 0.165306 0.018622 0.000116 0.441913 0.132096 169.33 237.49 1.000 pi(A){all} 0.214751 0.000158 0.190110 0.238381 0.214340 1022.73 1200.53 1.000 pi(C){all} 0.360880 0.000233 0.331977 0.392046 0.360725 878.07 982.44 1.000 pi(G){all} 0.267373 0.000189 0.241124 0.294506 0.267190 966.37 1231.92 1.000 pi(T){all} 0.156996 0.000133 0.134111 0.178420 0.156739 1128.22 1181.36 1.000 alpha{1,2} 0.424729 0.213631 0.000225 1.366127 0.263298 1305.41 1397.54 1.000 alpha{3} 0.474269 0.249006 0.000438 1.511573 0.313063 1221.45 1262.40 1.000 pinvar{all} 0.998630 0.000003 0.995710 1.000000 0.999097 1056.49 1125.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*...* 8 -- ..*.*. 9 -- .***.* 10 -- .*..*. 11 -- ...*.* 12 -- ..**** 13 -- ..**.. 14 -- ...**. 15 -- .**... 16 -- .*.*.. 17 -- .****. 18 -- .**.** 19 -- .*.*** 20 -- ..*..* 21 -- ....** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 482 0.160560 0.000942 0.159893 0.161226 2 8 472 0.157229 0.001884 0.155896 0.158561 2 9 457 0.152232 0.013662 0.142572 0.161892 2 10 447 0.148901 0.012719 0.139907 0.157895 2 11 444 0.147901 0.004711 0.144570 0.151233 2 12 438 0.145903 0.007537 0.140573 0.151233 2 13 434 0.144570 0.003769 0.141905 0.147235 2 14 422 0.140573 0.008480 0.134577 0.146569 2 15 420 0.139907 0.008480 0.133911 0.145903 2 16 417 0.138907 0.015546 0.127915 0.149900 2 17 417 0.138907 0.006124 0.134577 0.143238 2 18 417 0.138907 0.000471 0.138574 0.139241 2 19 415 0.138241 0.008951 0.131912 0.144570 2 20 406 0.135243 0.000942 0.134577 0.135909 2 21 369 0.122918 0.004240 0.119920 0.125916 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.096287 0.009062 0.000027 0.291446 0.066820 1.000 2 length{all}[2] 0.099675 0.009146 0.000022 0.288148 0.070192 1.001 2 length{all}[3] 0.098113 0.009451 0.000045 0.289991 0.069042 1.000 2 length{all}[4] 0.098132 0.009477 0.000062 0.288364 0.070049 1.000 2 length{all}[5] 0.102003 0.009664 0.000052 0.298834 0.073228 1.000 2 length{all}[6] 0.098901 0.009546 0.000119 0.284034 0.069596 1.000 2 length{all}[7] 0.098253 0.009737 0.000085 0.291350 0.072199 1.001 2 length{all}[8] 0.100252 0.012126 0.000592 0.306360 0.056745 1.008 2 length{all}[9] 0.095131 0.008754 0.000356 0.293416 0.066755 0.998 2 length{all}[10] 0.091832 0.009474 0.000286 0.294827 0.062606 0.999 2 length{all}[11] 0.105439 0.012037 0.000052 0.305861 0.079977 0.998 2 length{all}[12] 0.094212 0.008786 0.000084 0.275893 0.064982 1.001 2 length{all}[13] 0.102228 0.009986 0.000025 0.306098 0.071744 0.999 2 length{all}[14] 0.100476 0.011037 0.000243 0.309141 0.068343 0.998 2 length{all}[15] 0.096109 0.010591 0.000604 0.301157 0.061589 1.001 2 length{all}[16] 0.093211 0.008096 0.000111 0.271793 0.065325 0.998 2 length{all}[17] 0.099256 0.008559 0.000204 0.291338 0.067464 0.998 2 length{all}[18] 0.095982 0.009402 0.000544 0.295143 0.063528 1.002 2 length{all}[19] 0.092793 0.008665 0.000195 0.281627 0.068680 0.998 2 length{all}[20] 0.095839 0.008150 0.000527 0.264017 0.072003 0.998 2 length{all}[21] 0.094303 0.007446 0.000199 0.259503 0.069221 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006564 Maximum standard deviation of split frequencies = 0.015546 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.008 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------ C1 (1) | |--------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \-------------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1044 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 55 patterns at 348 / 348 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 55 patterns at 348 / 348 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 53680 bytes for conP 4840 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.100651 0.089111 0.019257 0.097009 0.059541 0.084050 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1511.993341 Iterating by ming2 Initial: fx= 1511.993341 x= 0.10065 0.08911 0.01926 0.09701 0.05954 0.08405 0.30000 1.30000 1 h-m-p 0.0000 0.0001 836.1057 ++ 1472.910225 m 0.0001 13 | 1/8 2 h-m-p 0.0013 0.0538 32.6130 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 764.4260 ++ 1403.885559 m 0.0001 44 | 2/8 4 h-m-p 0.0020 0.0621 40.5641 ------------.. | 2/8 5 h-m-p 0.0000 0.0001 688.1533 ++ 1369.742786 m 0.0001 76 | 3/8 6 h-m-p 0.0008 0.0736 50.9976 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 598.4398 ++ 1364.415021 m 0.0000 107 | 4/8 8 h-m-p 0.0002 0.0959 45.2558 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 488.7947 ++ 1358.858116 m 0.0000 137 | 5/8 10 h-m-p 0.0003 0.1429 31.5017 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 346.0342 ++ 1357.573667 m 0.0000 167 | 6/8 12 h-m-p 0.0500 8.0000 0.0000 Y 1357.573667 0 0.0500 178 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 C 1357.573667 0 1.6000 191 | 6/8 14 h-m-p 0.0160 8.0000 0.0000 C 1357.573667 0 0.0160 204 | 6/8 15 h-m-p 0.0160 8.0000 0.0000 -----Y 1357.573667 0 0.0000 222 Out.. lnL = -1357.573667 223 lfun, 223 eigenQcodon, 1338 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.044688 0.102634 0.050161 0.021938 0.033229 0.034624 0.300131 0.851886 0.590403 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.418841 np = 9 lnL0 = -1455.868021 Iterating by ming2 Initial: fx= 1455.868021 x= 0.04469 0.10263 0.05016 0.02194 0.03323 0.03462 0.30013 0.85189 0.59040 1 h-m-p 0.0000 0.0001 833.0273 ++ 1411.204211 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0003 265.4342 ++ 1392.159901 m 0.0003 26 | 2/9 3 h-m-p 0.0000 0.0000 7571.7093 ++ 1390.511098 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 67192.3019 ++ 1381.065385 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 12386.2235 ++ 1377.689716 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0001 2951.8272 ++ 1357.573635 m 0.0001 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1357.573635 m 8.0000 86 | 6/9 8 h-m-p 0.0102 5.1187 0.0610 +++++ 1357.573613 m 5.1187 104 | 7/9 9 h-m-p 1.6000 8.0000 0.0056 +Y 1357.573613 0 7.1740 120 | 7/9 10 h-m-p 1.6000 8.0000 0.0001 ++ 1357.573613 m 8.0000 134 | 7/9 11 h-m-p 0.0155 7.7701 0.3699 --------C 1357.573613 0 0.0000 156 | 7/9 12 h-m-p 0.0000 0.0206 17.0180 +++++ 1357.573564 m 0.0206 173 | 8/9 13 h-m-p 0.6266 4.1447 0.2132 ------------C 1357.573564 0 0.0000 197 | 8/9 14 h-m-p 0.0160 8.0000 0.0000 +++++ 1357.573564 m 8.0000 213 | 8/9 15 h-m-p 0.0126 6.2947 0.0185 +++++ 1357.573515 m 6.2947 229 | 9/9 16 h-m-p 0.0160 8.0000 0.0000 N 1357.573515 0 0.0160 242 | 9/9 17 h-m-p 0.0160 8.0000 0.0000 N 1357.573515 0 0.0160 254 Out.. lnL = -1357.573515 255 lfun, 765 eigenQcodon, 3060 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.040671 0.046023 0.048144 0.066863 0.104649 0.016844 0.000100 0.903672 0.361991 0.438828 1.381263 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.594498 np = 11 lnL0 = -1466.565769 Iterating by ming2 Initial: fx= 1466.565769 x= 0.04067 0.04602 0.04814 0.06686 0.10465 0.01684 0.00011 0.90367 0.36199 0.43883 1.38126 1 h-m-p 0.0000 0.0000 807.7868 ++ 1459.478923 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 308.8361 ++ 1431.889507 m 0.0003 30 | 2/11 3 h-m-p 0.0000 0.0002 293.9458 ++ 1396.386614 m 0.0002 44 | 3/11 4 h-m-p 0.0006 0.0028 84.4115 ++ 1364.801729 m 0.0028 58 | 4/11 5 h-m-p 0.0000 0.0000 2758.7192 ++ 1362.523164 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 28644.6095 ++ 1360.231442 m 0.0000 86 | 6/11 7 h-m-p 0.0000 0.0001 82.9974 ++ 1359.849518 m 0.0001 100 | 7/11 8 h-m-p 0.0026 1.3237 3.7984 ------------.. | 7/11 9 h-m-p 0.0000 0.0000 343.4388 ++ 1357.573644 m 0.0000 138 | 8/11 10 h-m-p 0.0259 8.0000 0.0000 +++++ 1357.573644 m 8.0000 155 | 8/11 11 h-m-p 0.0160 8.0000 0.0049 -----C 1357.573644 0 0.0000 177 | 8/11 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1357.573644 m 8.0000 197 | 8/11 13 h-m-p 0.0020 1.0120 0.4213 +++++ 1357.573639 m 1.0120 217 | 9/11 14 h-m-p 0.1037 8.0000 1.5777 -----------C 1357.573639 0 0.0000 245 | 9/11 15 h-m-p 0.0160 8.0000 0.0008 +++++ 1357.573639 m 8.0000 262 | 9/11 16 h-m-p 0.0160 8.0000 2.0854 -----------N 1357.573639 0 0.0000 289 | 9/11 17 h-m-p 0.0160 8.0000 0.0000 ----Y 1357.573639 0 0.0000 307 | 8/11 18 h-m-p -0.0000 -0.0000 0.0003 h-m-p: -0.00000000e+00 -0.00000000e+00 2.56437176e-04 1357.573639 .. | 8/11 19 h-m-p 0.0160 8.0000 0.0000 +++++ 1357.573639 m 8.0000 340 | 8/11 20 h-m-p 0.0160 8.0000 0.5414 +++Y 1357.573614 0 2.4517 360 | 8/11 21 h-m-p 1.6000 8.0000 0.0548 Y 1357.573614 0 1.0681 377 | 8/11 22 h-m-p 1.6000 8.0000 0.0007 ++ 1357.573614 m 8.0000 394 | 8/11 23 h-m-p 0.0699 8.0000 0.0794 ++Y 1357.573614 0 2.0841 413 | 8/11 24 h-m-p 1.6000 8.0000 0.0133 ++ 1357.573609 m 8.0000 430 | 8/11 25 h-m-p 0.1497 8.0000 0.7107 ----------C 1357.573609 0 0.0000 457 | 8/11 26 h-m-p 0.0160 8.0000 0.8152 +++Y 1357.573599 0 1.0240 477 | 8/11 27 h-m-p 1.6000 8.0000 0.2216 Y 1357.573599 0 1.2627 494 | 8/11 28 h-m-p 1.6000 8.0000 0.0269 --------C 1357.573599 0 0.0000 519 | 8/11 29 h-m-p 0.0160 8.0000 0.0016 +++++ 1357.573599 m 8.0000 539 | 8/11 30 h-m-p 0.0352 8.0000 0.3597 ++Y 1357.573598 0 1.2092 558 | 8/11 31 h-m-p 1.6000 8.0000 0.0156 -------N 1357.573598 0 0.0000 582 | 8/11 32 h-m-p 0.0160 8.0000 0.0001 +++++ 1357.573598 m 8.0000 602 | 8/11 33 h-m-p 0.0141 7.0660 20.0752 -----------C 1357.573598 0 0.0000 630 | 8/11 34 h-m-p 0.0160 8.0000 0.0007 ----------Y 1357.573598 0 0.0000 654 | 8/11 35 h-m-p 0.0160 8.0000 0.0005 +++++ 1357.573598 m 8.0000 674 | 8/11 36 h-m-p 0.0698 8.0000 0.0526 ++Y 1357.573598 0 0.9483 693 | 8/11 37 h-m-p 1.6000 8.0000 0.0008 ++ 1357.573598 m 8.0000 710 | 8/11 38 h-m-p 0.1749 8.0000 0.0360 ++Y 1357.573598 0 2.2603 729 | 8/11 39 h-m-p 1.6000 8.0000 0.0013 ++ 1357.573598 m 8.0000 746 | 8/11 40 h-m-p 0.0160 8.0000 2.9445 ----------Y 1357.573598 0 0.0000 773 | 8/11 41 h-m-p 0.0005 0.2652 5.6435 +++++ 1357.573537 m 0.2652 790 | 9/11 42 h-m-p 0.3717 8.0000 3.7876 Y 1357.573536 0 0.2077 804 | 9/11 43 h-m-p 1.6000 8.0000 0.1627 Y 1357.573536 0 0.3124 818 | 9/11 44 h-m-p 1.6000 8.0000 0.0006 ----Y 1357.573536 0 0.0016 838 | 9/11 45 h-m-p 0.0870 8.0000 0.0000 ++++ 1357.573536 m 8.0000 856 | 9/11 46 h-m-p 0.0160 8.0000 4.6711 +++++ 1357.573515 m 8.0000 875 | 9/11 47 h-m-p 1.6000 8.0000 0.0000 N 1357.573515 0 1.6000 889 | 9/11 48 h-m-p 0.0160 8.0000 0.0000 Y 1357.573515 0 0.0160 905 Out.. lnL = -1357.573515 906 lfun, 3624 eigenQcodon, 16308 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1357.619803 S = -1357.574451 -0.017501 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:05 did 20 / 55 patterns 0:05 did 30 / 55 patterns 0:05 did 40 / 55 patterns 0:05 did 50 / 55 patterns 0:06 did 55 / 55 patterns 0:06 Time used: 0:06 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.089724 0.039388 0.081411 0.093706 0.098328 0.045140 0.000100 0.266870 1.619376 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 20.347043 np = 9 lnL0 = -1503.350712 Iterating by ming2 Initial: fx= 1503.350712 x= 0.08972 0.03939 0.08141 0.09371 0.09833 0.04514 0.00011 0.26687 1.61938 1 h-m-p 0.0000 0.0000 762.9059 ++ 1502.842162 m 0.0000 14 | 1/9 2 h-m-p 0.0001 0.0461 35.6304 ---------.. | 1/9 3 h-m-p 0.0000 0.0001 763.1351 ++ 1429.585685 m 0.0001 45 | 2/9 4 h-m-p 0.0012 0.0062 25.9068 -----------.. | 2/9 5 h-m-p 0.0000 0.0000 727.2695 ++ 1420.185630 m 0.0000 78 | 3/9 6 h-m-p 0.0005 0.0147 21.7819 -----------.. | 3/9 7 h-m-p 0.0000 0.0001 651.1433 ++ 1370.974787 m 0.0001 111 | 4/9 8 h-m-p 0.0022 0.0110 24.0754 ------------.. | 4/9 9 h-m-p 0.0000 0.0000 585.4663 ++ 1362.107625 m 0.0000 145 | 5/9 10 h-m-p 0.0006 0.0126 20.7913 -----------.. | 5/9 11 h-m-p 0.0000 0.0000 481.3971 ++ 1359.244773 m 0.0000 178 | 6/9 12 h-m-p 0.0003 0.0165 15.9601 ----------.. | 6/9 13 h-m-p 0.0000 0.0000 341.1028 ++ 1357.573571 m 0.0000 210 | 7/9 14 h-m-p 0.5923 8.0000 0.0000 Y 1357.573571 0 0.1481 222 | 7/9 15 h-m-p 0.3253 8.0000 0.0000 -Y 1357.573571 0 0.0437 237 Out.. lnL = -1357.573571 238 lfun, 2618 eigenQcodon, 14280 P(t) Time used: 0:09 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.077417 0.068676 0.092581 0.091170 0.034575 0.107857 0.000100 0.900000 0.306222 1.670377 1.299939 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 16.691324 np = 11 lnL0 = -1505.803163 Iterating by ming2 Initial: fx= 1505.803163 x= 0.07742 0.06868 0.09258 0.09117 0.03458 0.10786 0.00011 0.90000 0.30622 1.67038 1.29994 1 h-m-p 0.0000 0.0000 711.2753 ++ 1505.301384 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0002 698.9222 +++ 1444.304125 m 0.0002 31 | 2/11 3 h-m-p 0.0000 0.0001 925.6716 ++ 1388.500130 m 0.0001 45 | 3/11 4 h-m-p 0.0002 0.0011 97.6842 ++ 1380.202392 m 0.0011 59 | 4/11 5 h-m-p 0.0000 0.0000 351407.4499 ++ 1371.286643 m 0.0000 73 | 5/11 6 h-m-p 0.0001 0.0003 99.3722 ++ 1368.498421 m 0.0003 87 | 6/11 7 h-m-p 0.0000 0.0000 5765.5331 ++ 1360.997824 m 0.0000 101 | 7/11 8 h-m-p 0.0018 0.0518 9.3193 +++ 1359.467743 m 0.0518 116 | 8/11 9 h-m-p 0.0012 0.0060 82.7896 ++ 1357.573515 m 0.0060 130 | 9/11 10 h-m-p 1.6000 8.0000 0.0000 Y 1357.573515 0 1.6000 144 | 9/11 11 h-m-p 0.0160 8.0000 0.0000 C 1357.573515 0 0.0160 160 Out.. lnL = -1357.573515 161 lfun, 1932 eigenQcodon, 10626 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1357.633432 S = -1357.574450 -0.026204 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:12 did 20 / 55 patterns 0:12 did 30 / 55 patterns 0:13 did 40 / 55 patterns 0:13 did 50 / 55 patterns 0:13 did 55 / 55 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=348 NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ NC_002677_1_NP_302056_1_928_ML1506 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA NC_002677_1_NP_302056_1_928_ML1506 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG NC_002677_1_NP_302056_1_928_ML1506 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT NC_002677_1_NP_302056_1_928_ML1506 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP NC_002677_1_NP_302056_1_928_ML1506 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP NC_002677_1_NP_302056_1_928_ML1506 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP ************************************************** NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP NC_002677_1_NP_302056_1_928_ML1506 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP ************************************************
>NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >NC_002677_1_NP_302056_1_928_ML1506 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG >NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 TTGAAGACCGGAGGATTCGTGACAAGCGCTTGGAATCTACCCAAGGGTTT GGTCGCCGTCGTCACGGCATCGACTGCCGCGTTCGGGCTGTGCCAGAATG CAGCAGCCGACCCGGCCAACCCCTACGGCACACCGCCAAACCCCACCCAA CAACTACCGGGTCTGCCCGCGTTGGCTCAGTTGAGTCCGATAGTCCAGCA AGCAGCCAACAACCCTCAGCAAGCGACACAGCTGCTCATGGAGGCGGTGT CAGCACTCACCCAGAATCCGACTGCACCCATCGCGTCCAAGAACCTGGCC ACGTCGGTAAGCCAGTTCATGCAGGAGCCGAACAATCCGAATCCCGGGGC TTCGGCCCTGGACATACCCACTTCGGGCGTACCCGCTCCAGCGGCCAATG GCATCACCCCGTTGGACGTCGTCCTGGTGCCTCACCTACCATCGGCAGGT GCGGAGCCCGGCGCCCAGGCACACCTGCCTACGGGTATTGATCCAGTTCA CGCGGCCGGCCCGGCGACCGCTGCAACGCCGACACCCGGAAGCCCCACTA ACCGGACCGCTGCCCCACCCACGCCGGTAGCATCACCTGCACCGACCACT CCGGAACTGCCTGCGACGACCCCGGGTTTTGGGCCAGACGCCCCACCGAC GCAGGACTTCATATATCCCTCGATCAGCACCAATTGCCTTGCAGACGGCA GTAGCTCGATTGCGACAGCACTGTCAGTGGCAGGGCCGGCGAAGATCCCA CTGCCCGGTCCCGGTCCCGGTCAGGCCGCCTATGTGTTTACCGCTGTCGG AACGCCTGGACCCGCCGATGTCCAGAAGTTACCATTGAACGTCACCTGGG TGAACCTGACCACCGGCAAGTCTGGGAGCGCTACGCTCAAGCCACGCCCA GACATAAATCCGGAAGGGCCAACAACGTTGACCGTAATCGCCGACACCGG CTCAGGCAGCATTATGTCTACGATCTTCGGGCAGGTCACCACCAAAGAAA AACAATGCCAGTTCATGCCCACGATCGGCTCCACGGTGGTGCCG
>NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >NC_002677_1_NP_302056_1_928_ML1506 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP >NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 LKTGGFVTSAWNLPKGLVAVVTASTAAFGLCQNAAADPANPYGTPPNPTQ QLPGLPALAQLSPIVQQAANNPQQATQLLMEAVSALTQNPTAPIASKNLA TSVSQFMQEPNNPNPGASALDIPTSGVPAPAANGITPLDVVLVPHLPSAG AEPGAQAHLPTGIDPVHAAGPATAATPTPGSPTNRTAAPPTPVASPAPTT PELPATTPGFGPDAPPTQDFIYPSISTNCLADGSSSIATALSVAGPAKIP LPGPGPGQAAYVFTAVGTPGPADVQKLPLNVTWVNLTTGKSGSATLKPRP DINPEGPTTLTVIADTGSGSIMSTIFGQVTTKEKQCQFMPTIGSTVVP
#NEXUS [ID: 5176003918] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 NC_002677_1_NP_302056_1_928_ML1506 NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 ; end; begin trees; translate 1 NC_011896_1_WP_010908377_1_1592_MLBR_RS07570, 2 NC_002677_1_NP_302056_1_928_ML1506, 3 NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015, 4 NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800, 5 NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255, 6 NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0668202,2:0.07019185,3:0.06904222,4:0.07004935,5:0.07322835,6:0.06959604); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0668202,2:0.07019185,3:0.06904222,4:0.07004935,5:0.07322835,6:0.06959604); end;
Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1402.30 -1405.75 2 -1402.26 -1405.19 -------------------------------------- TOTAL -1402.28 -1405.51 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1506/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.888920 0.088882 0.354249 1.444268 0.849925 1443.34 1472.17 1.000 r(A<->C){all} 0.165280 0.020034 0.000043 0.444490 0.126385 219.66 226.12 1.003 r(A<->G){all} 0.170404 0.020937 0.000016 0.459428 0.132482 163.92 219.12 1.000 r(A<->T){all} 0.158926 0.018329 0.000186 0.436666 0.121455 147.44 180.06 1.002 r(C<->G){all} 0.183281 0.021618 0.000066 0.476269 0.145225 197.41 221.28 1.005 r(C<->T){all} 0.156803 0.018551 0.000010 0.440722 0.118362 196.79 199.80 1.003 r(G<->T){all} 0.165306 0.018622 0.000116 0.441913 0.132096 169.33 237.49 1.000 pi(A){all} 0.214751 0.000158 0.190110 0.238381 0.214340 1022.73 1200.53 1.000 pi(C){all} 0.360880 0.000233 0.331977 0.392046 0.360725 878.07 982.44 1.000 pi(G){all} 0.267373 0.000189 0.241124 0.294506 0.267190 966.37 1231.92 1.000 pi(T){all} 0.156996 0.000133 0.134111 0.178420 0.156739 1128.22 1181.36 1.000 alpha{1,2} 0.424729 0.213631 0.000225 1.366127 0.263298 1305.41 1397.54 1.000 alpha{3} 0.474269 0.249006 0.000438 1.511573 0.313063 1221.45 1262.40 1.000 pinvar{all} 0.998630 0.000003 0.995710 1.000000 0.999097 1056.49 1125.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1506/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 348 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3 Leu TTA 1 1 1 1 1 1 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 7 7 7 7 7 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 6 6 6 6 6 6 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0 CTC 3 3 3 3 3 3 | CCC 18 18 18 18 18 18 | CAC 3 3 3 3 3 3 | CGC 1 1 1 1 1 1 CTA 3 3 3 3 3 3 | CCA 12 12 12 12 12 12 | Gln CAA 5 5 5 5 5 5 | CGA 0 0 0 0 0 0 CTG 11 11 11 11 11 11 | CCG 18 18 18 18 18 18 | CAG 14 14 14 14 14 14 | CGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 5 5 5 5 5 5 | Asn AAT 8 8 8 8 8 8 | Ser AGT 2 2 2 2 2 2 ATC 7 7 7 7 7 7 | ACC 17 17 17 17 17 17 | AAC 9 9 9 9 9 9 | AGC 7 7 7 7 7 7 ATA 4 4 4 4 4 4 | ACA 6 6 6 6 6 6 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0 Met ATG 4 4 4 4 4 4 | ACG 13 13 13 13 13 13 | AAG 7 7 7 7 7 7 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 8 8 8 8 8 8 | Asp GAT 2 2 2 2 2 2 | Gly GGT 8 8 8 8 8 8 GTC 10 10 10 10 10 10 | GCC 16 16 16 16 16 16 | GAC 8 8 8 8 8 8 | GGC 10 10 10 10 10 10 GTA 4 4 4 4 4 4 | GCA 14 14 14 14 14 14 | Glu GAA 3 3 3 3 3 3 | GGA 5 5 5 5 5 5 GTG 8 8 8 8 8 8 | GCG 12 12 12 12 12 12 | GAG 3 3 3 3 3 3 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908377_1_1592_MLBR_RS07570 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 #2: NC_002677_1_NP_302056_1_928_ML1506 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 #3: NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 #4: NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 #5: NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 #6: NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455 position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 12 | Cys C TGT 0 TTC 36 | TCC 12 | TAC 6 | TGC 18 Leu L TTA 6 | TCA 24 | *** * TAA 0 | *** * TGA 0 TTG 42 | TCG 42 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 36 | His H CAT 0 | Arg R CGT 0 CTC 18 | CCC 108 | CAC 18 | CGC 6 CTA 18 | CCA 72 | Gln Q CAA 30 | CGA 0 CTG 66 | CCG 108 | CAG 84 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 30 | Asn N AAT 48 | Ser S AGT 12 ATC 42 | ACC 102 | AAC 54 | AGC 42 ATA 24 | ACA 36 | Lys K AAA 12 | Arg R AGA 0 Met M ATG 24 | ACG 78 | AAG 42 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 48 | Asp D GAT 12 | Gly G GGT 48 GTC 60 | GCC 96 | GAC 48 | GGC 60 GTA 24 | GCA 84 | Glu E GAA 18 | GGA 30 GTG 48 | GCG 72 | GAG 18 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11207 C:0.27586 A:0.27011 G:0.34195 position 2: T:0.21552 C:0.45977 A:0.19253 G:0.13218 position 3: T:0.14368 C:0.34770 A:0.18103 G:0.32759 Average T:0.15709 C:0.36111 A:0.21456 G:0.26724 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1357.573667 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300131 1.299939 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908377_1_1592_MLBR_RS07570: 0.000004, NC_002677_1_NP_302056_1_928_ML1506: 0.000004, NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015: 0.000004, NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800: 0.000004, NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255: 0.000004, NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.30013 omega (dN/dS) = 1.29994 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 7..2 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 7..3 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 7..4 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 7..5 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 7..6 0.000 719.7 324.3 1.2999 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1357.573515 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908377_1_1592_MLBR_RS07570: 0.000004, NC_002677_1_NP_302056_1_928_ML1506: 0.000004, NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015: 0.000004, NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800: 0.000004, NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255: 0.000004, NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1357.573515 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908377_1_1592_MLBR_RS07570: 0.000004, NC_002677_1_NP_302056_1_928_ML1506: 0.000004, NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015: 0.000004, NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800: 0.000004, NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255: 0.000004, NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908377_1_1592_MLBR_RS07570) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:06 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1357.573571 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.266544 1.619185 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908377_1_1592_MLBR_RS07570: 0.000004, NC_002677_1_NP_302056_1_928_ML1506: 0.000004, NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015: 0.000004, NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800: 0.000004, NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255: 0.000004, NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.26654 q = 1.61918 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00001 0.00043 0.00294 0.01043 0.02699 0.05819 0.11189 0.20036 0.34694 0.61983 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 7..2 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 7..3 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 7..4 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 7..5 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 7..6 0.000 720.7 323.3 0.1378 0.0000 0.0000 0.0 0.0 Time used: 0:09 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1357.573515 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.823252 2.391195 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908377_1_1592_MLBR_RS07570: 0.000004, NC_002677_1_NP_302056_1_928_ML1506: 0.000004, NZ_LVXE01000037_1_WP_010908377_1_1641_A3216_RS10015: 0.000004, NZ_LYPH01000042_1_WP_010908377_1_1633_A8144_RS07800: 0.000004, NZ_CP029543_1_WP_010908377_1_1621_DIJ64_RS08255: 0.000004, NZ_AP014567_1_WP_010908377_1_1661_JK2ML_RS08455: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.82325 (p1 = 0.00001) w = 2.39120 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.39120 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.7 323.3 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908377_1_1592_MLBR_RS07570) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.096 0.096 0.097 0.098 0.099 0.100 0.101 0.103 0.104 0.105 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096 Time used: 0:13
Model 1: NearlyNeutral -1357.573515 Model 2: PositiveSelection -1357.573515 Model 0: one-ratio -1357.573667 Model 7: beta -1357.573571 Model 8: beta&w>1 -1357.573515 Model 0 vs 1 3.0399999968722113E-4 Model 2 vs 1 0.0 Model 8 vs 7 1.1199999971722718E-4