--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:48:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1512/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2291.00         -2295.45
2      -2290.91         -2295.75
--------------------------------------
TOTAL    -2290.95         -2295.61
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.868400    0.090508    0.330586    1.449455    0.832307   1501.00   1501.00    1.000
r(A<->C){all}   0.176926    0.023087    0.000006    0.482971    0.136033    104.92    152.36    1.007
r(A<->G){all}   0.157931    0.019583    0.000048    0.438039    0.119368    283.43    311.25    1.000
r(A<->T){all}   0.139433    0.014933    0.000084    0.384292    0.103045    178.49    219.41    1.000
r(C<->G){all}   0.175083    0.021573    0.000057    0.470213    0.137947    171.04    205.35    1.000
r(C<->T){all}   0.221675    0.026174    0.000120    0.543974    0.191298    269.57    309.15    1.000
r(G<->T){all}   0.128952    0.013691    0.000030    0.363967    0.094967    258.97    280.04    1.008
pi(A){all}      0.177393    0.000084    0.159760    0.195501    0.177454   1242.20   1371.60    1.000
pi(C){all}      0.278527    0.000120    0.258180    0.300207    0.278426   1224.96   1269.90    1.000
pi(G){all}      0.326657    0.000132    0.304138    0.349094    0.326438   1283.03   1392.01    1.000
pi(T){all}      0.217423    0.000099    0.199174    0.237830    0.217111   1135.48   1318.24    1.000
alpha{1,2}      0.234150    0.090891    0.000641    0.811147    0.148061   1253.13   1268.87    1.000
alpha{3}        0.410522    0.227514    0.000124    1.371066    0.234070   1141.11   1181.00    1.000
pinvar{all}     0.997923    0.000003    0.994706    0.999956    0.998339   1380.05   1440.53    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2198.89015
Model 2: PositiveSelection	-2198.528505
Model 0: one-ratio	-2198.528384
Model 7: beta	-2198.890135
Model 8: beta&w>1	-2198.528505


Model 0 vs 1	0.7235319999999774

Model 2 vs 1	0.7232899999999063

Model 8 vs 7	0.7232599999997547
>C1
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLSP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C2
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C3
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C4
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C5
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C6
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=558 

C1              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLSP
C2              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C3              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C4              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C5              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C6              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
                ************************************************ *

C1              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C2              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C3              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C4              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C5              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C6              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
                **************************************************

C1              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C2              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C3              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C4              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C5              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C6              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
                **************************************************

C1              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C2              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C3              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C4              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C5              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C6              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
                **************************************************

C1              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C2              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C3              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C4              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C5              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C6              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
                **************************************************

C1              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C2              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C3              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C4              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C5              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C6              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
                **************************************************

C1              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C2              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C3              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C4              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C5              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C6              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
                **************************************************

C1              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C2              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C3              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C4              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C5              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C6              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
                **************************************************

C1              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C2              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C3              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C4              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C5              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C6              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
                **************************************************

C1              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C2              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C3              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C4              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C5              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C6              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
                **************************************************

C1              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C2              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C3              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C4              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C5              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C6              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
                **************************************************

C1              IVPTVIEV
C2              IVPTVIEV
C3              IVPTVIEV
C4              IVPTVIEV
C5              IVPTVIEV
C6              IVPTVIEV
                ********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  558 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  558 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16740]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16740]--->[16740]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.576 Mb, Max= 31.168 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLSP
C2              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C3              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C4              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C5              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
C6              VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
                ************************************************ *

C1              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C2              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C3              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C4              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C5              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
C6              GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
                **************************************************

C1              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C2              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C3              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C4              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C5              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
C6              PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
                **************************************************

C1              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C2              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C3              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C4              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C5              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
C6              PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
                **************************************************

C1              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C2              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C3              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C4              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C5              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
C6              CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
                **************************************************

C1              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C2              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C3              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C4              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C5              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
C6              AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
                **************************************************

C1              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C2              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C3              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C4              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C5              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
C6              VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
                **************************************************

C1              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C2              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C3              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C4              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C5              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
C6              VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
                **************************************************

C1              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C2              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C3              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C4              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C5              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
C6              RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
                **************************************************

C1              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C2              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C3              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C4              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C5              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
C6              GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
                **************************************************

C1              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C2              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C3              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C4              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C5              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
C6              PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
                **************************************************

C1              IVPTVIEV
C2              IVPTVIEV
C3              IVPTVIEV
C4              IVPTVIEV
C5              IVPTVIEV
C6              IVPTVIEV
                ********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.82 C1	 C2	 99.82
TOP	    1    0	 99.82 C2	 C1	 99.82
BOT	    0    2	 99.82 C1	 C3	 99.82
TOP	    2    0	 99.82 C3	 C1	 99.82
BOT	    0    3	 99.82 C1	 C4	 99.82
TOP	    3    0	 99.82 C4	 C1	 99.82
BOT	    0    4	 99.82 C1	 C5	 99.82
TOP	    4    0	 99.82 C5	 C1	 99.82
BOT	    0    5	 99.82 C1	 C6	 99.82
TOP	    5    0	 99.82 C6	 C1	 99.82
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.82
AVG	 1	 C2	  *	 99.96
AVG	 2	 C3	  *	 99.96
AVG	 3	 C4	  *	 99.96
AVG	 4	 C5	  *	 99.96
AVG	 5	 C6	  *	 99.96
TOT	 TOT	  *	 99.94
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
C2              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
C3              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
C4              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
C5              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
C6              GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
                **************************************************

C1              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
C2              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
C3              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
C4              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
C5              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
C6              GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
                **************************************************

C1              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTCCCCC
C2              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
C3              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
C4              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
C5              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
C6              TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
                ********************************************* ****

C1              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
C2              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
C3              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
C4              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
C5              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
C6              GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
                **************************************************

C1              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
C2              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
C3              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
C4              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
C5              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
C6              CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
                **************************************************

C1              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
C2              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
C3              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
C4              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
C5              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
C6              AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
                **************************************************

C1              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
C2              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
C3              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
C4              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
C5              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
C6              CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
                **************************************************

C1              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
C2              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
C3              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
C4              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
C5              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
C6              TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
                **************************************************

C1              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
C2              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
C3              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
C4              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
C5              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
C6              CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
                **************************************************

C1              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
C2              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
C3              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
C4              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
C5              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
C6              CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
                **************************************************

C1              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
C2              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
C3              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
C4              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
C5              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
C6              CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
                **************************************************

C1              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
C2              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
C3              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
C4              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
C5              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
C6              ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
                **************************************************

C1              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
C2              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
C3              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
C4              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
C5              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
C6              TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
                **************************************************

C1              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
C2              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
C3              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
C4              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
C5              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
C6              GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
                **************************************************

C1              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
C2              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
C3              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
C4              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
C5              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
C6              TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
                **************************************************

C1              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
C2              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
C3              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
C4              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
C5              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
C6              GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
                **************************************************

C1              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
C2              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
C3              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
C4              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
C5              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
C6              CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
                **************************************************

C1              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
C2              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
C3              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
C4              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
C5              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
C6              CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
                **************************************************

C1              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
C2              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
C3              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
C4              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
C5              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
C6              GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
                **************************************************

C1              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
C2              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
C3              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
C4              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
C5              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
C6              GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
                **************************************************

C1              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
C2              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
C3              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
C4              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
C5              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
C6              TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
                **************************************************

C1              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
C2              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
C3              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
C4              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
C5              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
C6              GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
                **************************************************

C1              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
C2              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
C3              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
C4              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
C5              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
C6              AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
                **************************************************

C1              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
C2              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
C3              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
C4              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
C5              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
C6              TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
                **************************************************

C1              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
C2              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
C3              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
C4              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
C5              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
C6              CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
                **************************************************

C1              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
C2              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
C3              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
C4              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
C5              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
C6              GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
                **************************************************

C1              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
C2              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
C3              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
C4              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
C5              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
C6              GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
                **************************************************

C1              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
C2              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
C3              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
C4              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
C5              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
C6              GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
                **************************************************

C1              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
C2              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
C3              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
C4              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
C5              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
C6              CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
                **************************************************

C1              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
C2              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
C3              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
C4              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
C5              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
C6              GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
                **************************************************

C1              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
C2              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
C3              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
C4              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
C5              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
C6              CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
                **************************************************

C1              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
C2              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
C3              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
C4              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
C5              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
C6              GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
                **************************************************

C1              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
C2              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
C3              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
C4              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
C5              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
C6              GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
                **************************************************

C1              ATCGTGCCGACGGTGATCGAGGTT
C2              ATCGTGCCGACGGTGATCGAGGTT
C3              ATCGTGCCGACGGTGATCGAGGTT
C4              ATCGTGCCGACGGTGATCGAGGTT
C5              ATCGTGCCGACGGTGATCGAGGTT
C6              ATCGTGCCGACGGTGATCGAGGTT
                ************************



>C1
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTCCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C2
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C3
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C4
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C5
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C6
GTGGATGTAGCCCTGGCCCCGCCAGGTCCGCTGGCCTCAGGTGGGTTGAG
GGTTACAGCGTTGGGAGGCATCAGCGAAATCGGCCGCAATATGACGATTT
TCGAGCATCTGGGCCGGTTGCTGATCATCGACTGCGGCGTGCTGTTCCCC
GGCCACGACGAGCCCGGTGTCGACCTGATCCTGCCGGACCTGCGCCATAT
CGAAGACCGGCTCGACGATATCGAGGCGCTCGTGTTGACACACGCGCACG
AGGATCACATCGGCGCAATCCCGTTCTTGCTCAAGTTGCGGTCTGATATC
CCGGTAGTCGGCTCGAAGTTCACCTTGGCCTTGGTCGCCGCGAAATGCCG
TGAACACCGCATCAAACCGGTGTTTGTCGAAGTCGTCGGGGGGCAGAGCT
CTCGGCACGGTGTGTTCGAGTGCGAGTATTTCGCCGTCAACCATTCCATA
CCGGACGCACTTACTATCGCGGTCTACACGGGCGCGGGAACGGTATTGCA
CACCGGAGACATCAAGCTCGATCAATTGCCGCTCGACGGCCGCCCTACCG
ACTTGCCAGGCATGTCCCGGCTGGGTGACGCTGGTGTAGACCTTTTCCTG
TGCGACTCAACCAATGCCGAGATACCCGGCGTCGGGCCTAGTGAAAGCGA
GGTGGGTCCGACACTGCATAGGCTGATTCAGGGGGCTGATGGCCGTGTCA
TCGTGGCGTGTTTTGCTTCCAATGTGGACCGGGTGCAGCAGGTTATAGAT
GCTGCAGTGGCATTGGGCCGGCGGGTGTCGTTCGTCGGACGGTCGATGGT
CCGCAATATGAGCATCGCGCGTGACCTCGGATTTCTACGAGTAGACGATT
CCCATATGATTGACATCGCCGCTGCCGAGATGATGGCACCAGAACAGGTA
GTGTTGATTACCACTGGCACCCAAGGTGAGCCGATGTCGGCGTTGTCGCG
GATGTCACGCGGCGAGCATCAGAGCATCACGCTGACCTCGGGTGACCTCG
TCGTGTTGTCATCATCGCTGATCCCTGGCAACGAGGAGGCGGTCTACGGT
GTCATCGACGCGCTCGCCAAGATTGGAGCTCGAGTTGTCACCAATGCCCA
AGCCCGGGTCCATGTTTCGGGCCACGCCTACGCTGGTGAGCTGCTGTTCT
TGTACAACGGCGTGCGGCCGCGTCAGGTTATGCCGGTGCACGGTACTTGG
CGGATGCTTCGCGCTAACGCTAAGCTGGCTGCCAGCACCGGGGTGCCGGA
GGATTCAATCTTGATCGCCGAGAACGGCGTCAGTGTCGACCTGGTTGCTG
GTAAGGCGTCGGTCTCCGGAGCGGTGCCGGTCGGCAAGATGTTTGTCGAT
GGGCTGATTACCGGCGATGTCGGCGATGTTATCCTGGGTGAGCGGCTTAT
CTTGTCGTCGGGTTTTGTCGCGGTCACGGTGGTGGTGAAGCGCAGCACTG
GGCGTCCAGTTACTGTGCCGCAACTGTATTCACGAGGATTTTCCGAAGAC
CCCAAAGCGCTTGAGCCTGCAGTTCGCAAGGTCGAGGCAGAGCTGGAGTC
GCTGCTCGCCGAGAACGTGACCGACCCGAGCAAGATCGCCCAGGCCGTGC
GCCGCGCCATTGGCAAATGGGTAGGTGAAACCTACCGTCGGCAGCCGATG
ATCGTGCCGACGGTGATCGAGGTT
>C1
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLSP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C2
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C3
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C4
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C5
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV
>C6
VDVALAPPGPLASGGLRVTALGGISEIGRNMTIFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGAIPFLLKLRSDI
PVVGSKFTLALVAAKCREHRIKPVFVEVVGGQSSRHGVFECEYFAVNHSI
PDALTIAVYTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAEIPGVGPSESEVGPTLHRLIQGADGRVIVACFASNVDRVQQVID
AAVALGRRVSFVGRSMVRNMSIARDLGFLRVDDSHMIDIAAAEMMAPEQV
VLITTGTQGEPMSALSRMSRGEHQSITLTSGDLVVLSSSLIPGNEEAVYG
VIDALAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRQVMPVHGTW
RMLRANAKLAASTGVPEDSILIAENGVSVDLVAGKASVSGAVPVGKMFVD
GLITGDVGDVILGERLILSSGFVAVTVVVKRSTGRPVTVPQLYSRGFSED
PKALEPAVRKVEAELESLLAENVTDPSKIAQAVRRAIGKWVGETYRRQPM
IVPTVIEV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1674 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855575
      Setting output file names to "/data/7res/ML1512/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 814343174
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5978222685
      Seed = 187149902
      Swapseed = 1579855575
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3749.895107 -- -24.965149
         Chain 2 -- -3749.895107 -- -24.965149
         Chain 3 -- -3749.893341 -- -24.965149
         Chain 4 -- -3749.895107 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3749.895107 -- -24.965149
         Chain 2 -- -3749.895107 -- -24.965149
         Chain 3 -- -3749.894471 -- -24.965149
         Chain 4 -- -3749.895107 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3749.895] (-3749.895) (-3749.893) (-3749.895) * [-3749.895] (-3749.895) (-3749.894) (-3749.895) 
        500 -- [-2296.751] (-2315.745) (-2315.522) (-2305.677) * [-2308.747] (-2326.348) (-2321.679) (-2328.838) -- 0:00:00
       1000 -- (-2299.529) (-2304.101) (-2296.159) [-2292.679] * [-2290.910] (-2300.555) (-2292.000) (-2306.341) -- 0:16:39
       1500 -- (-2298.152) (-2305.925) (-2296.297) [-2292.015] * [-2291.265] (-2296.875) (-2304.300) (-2293.212) -- 0:11:05
       2000 -- (-2295.390) (-2307.270) (-2296.876) [-2299.905] * (-2296.848) [-2299.639] (-2298.285) (-2295.094) -- 0:08:19
       2500 -- (-2302.929) (-2297.247) (-2295.700) [-2295.590] * (-2295.402) (-2294.747) [-2295.037] (-2291.820) -- 0:06:39
       3000 -- [-2298.105] (-2295.523) (-2296.144) (-2301.510) * (-2300.112) [-2293.970] (-2296.503) (-2295.774) -- 0:05:32
       3500 -- (-2293.215) (-2297.852) [-2295.854] (-2300.893) * [-2298.648] (-2297.764) (-2295.569) (-2299.679) -- 0:04:44
       4000 -- (-2298.368) (-2302.623) (-2301.320) [-2298.998] * (-2299.226) (-2302.527) [-2301.877] (-2295.542) -- 0:04:09
       4500 -- (-2297.927) (-2293.787) (-2297.941) [-2296.120] * (-2293.795) (-2300.468) [-2297.805] (-2300.579) -- 0:03:41
       5000 -- (-2299.351) [-2302.196] (-2298.758) (-2304.314) * (-2295.678) [-2299.063] (-2299.528) (-2297.292) -- 0:03:19

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-2297.394) (-2301.157) [-2294.505] (-2304.089) * (-2296.107) (-2294.931) [-2295.355] (-2293.604) -- 0:03:00
       6000 -- (-2306.090) (-2298.467) [-2307.789] (-2292.964) * [-2295.945] (-2298.925) (-2294.961) (-2302.111) -- 0:02:45
       6500 -- (-2302.307) [-2295.766] (-2296.478) (-2299.833) * (-2300.982) (-2307.441) [-2293.384] (-2297.779) -- 0:02:32
       7000 -- [-2291.523] (-2298.666) (-2294.945) (-2296.988) * (-2301.230) [-2296.413] (-2299.121) (-2297.428) -- 0:02:21
       7500 -- [-2294.391] (-2303.412) (-2305.772) (-2297.770) * (-2299.195) [-2297.009] (-2300.979) (-2298.858) -- 0:02:12
       8000 -- (-2303.199) (-2304.875) (-2297.181) [-2299.709] * (-2305.524) (-2298.360) (-2297.965) [-2292.261] -- 0:02:04
       8500 -- (-2298.896) [-2298.217] (-2298.133) (-2301.475) * (-2296.603) (-2299.329) (-2296.706) [-2295.160] -- 0:01:56
       9000 -- (-2299.559) [-2289.131] (-2293.831) (-2296.660) * (-2301.265) (-2300.785) [-2301.570] (-2295.328) -- 0:01:50
       9500 -- (-2295.826) [-2295.772] (-2296.878) (-2297.475) * (-2298.663) [-2293.771] (-2293.470) (-2296.710) -- 0:01:44
      10000 -- (-2299.159) [-2293.642] (-2297.157) (-2300.785) * (-2290.536) [-2298.259] (-2298.250) (-2297.970) -- 0:01:39

      Average standard deviation of split frequencies: 0.086179

      10500 -- [-2294.251] (-2292.525) (-2296.214) (-2300.026) * [-2291.838] (-2297.975) (-2295.020) (-2302.769) -- 0:01:34
      11000 -- (-2301.823) (-2296.675) [-2296.522] (-2297.626) * (-2297.370) (-2291.397) [-2297.168] (-2300.847) -- 0:01:29
      11500 -- (-2302.977) (-2297.223) (-2298.013) [-2297.188] * (-2297.044) [-2291.784] (-2294.261) (-2295.564) -- 0:01:25
      12000 -- (-2307.840) (-2297.928) [-2292.545] (-2296.478) * (-2294.803) (-2294.264) [-2293.331] (-2297.469) -- 0:01:22
      12500 -- (-2303.277) (-2296.373) (-2297.537) [-2293.220] * (-2295.487) (-2295.878) (-2293.144) [-2296.149] -- 0:01:19
      13000 -- (-2294.361) (-2302.361) (-2294.647) [-2296.634] * (-2297.657) (-2295.174) [-2296.138] (-2305.761) -- 0:01:15
      13500 -- (-2298.046) (-2300.092) [-2292.326] (-2295.060) * (-2301.210) (-2297.111) [-2298.201] (-2297.255) -- 0:01:13
      14000 -- [-2295.543] (-2295.366) (-2304.347) (-2303.747) * (-2296.363) [-2300.776] (-2296.227) (-2293.129) -- 0:02:20
      14500 -- (-2292.653) (-2293.274) (-2297.553) [-2303.894] * (-2296.349) [-2292.549] (-2296.138) (-2298.539) -- 0:02:15
      15000 -- (-2301.826) (-2297.536) (-2295.195) [-2296.638] * (-2296.607) (-2297.133) (-2297.511) [-2295.196] -- 0:02:11

      Average standard deviation of split frequencies: 0.066291

      15500 -- (-2299.851) [-2300.635] (-2295.942) (-2294.307) * (-2299.417) (-2299.301) [-2296.441] (-2298.446) -- 0:02:07
      16000 -- (-2298.337) (-2295.597) [-2294.159] (-2309.999) * (-2301.950) [-2294.385] (-2296.610) (-2298.126) -- 0:02:03
      16500 -- (-2306.295) (-2298.129) (-2297.133) [-2292.962] * (-2298.250) (-2293.027) (-2292.112) [-2295.775] -- 0:01:59
      17000 -- (-2295.436) [-2297.453] (-2290.568) (-2297.913) * [-2292.786] (-2295.189) (-2292.654) (-2297.334) -- 0:01:55
      17500 -- (-2295.224) (-2300.853) [-2296.142] (-2293.992) * [-2294.046] (-2295.079) (-2299.510) (-2295.487) -- 0:01:52
      18000 -- [-2294.198] (-2292.492) (-2299.599) (-2303.042) * (-2295.862) (-2298.879) [-2291.205] (-2299.883) -- 0:01:49
      18500 -- (-2293.227) (-2293.957) (-2297.904) [-2301.392] * (-2294.265) (-2294.303) (-2297.681) [-2292.209] -- 0:01:46
      19000 -- (-2292.226) [-2292.209] (-2289.636) (-2295.950) * [-2301.772] (-2307.898) (-2304.674) (-2294.610) -- 0:01:43
      19500 -- (-2295.356) (-2292.018) [-2291.656] (-2296.752) * (-2298.711) (-2304.873) [-2290.318] (-2292.468) -- 0:01:40
      20000 -- (-2296.919) (-2293.168) [-2295.844] (-2292.271) * [-2296.048] (-2294.772) (-2297.705) (-2293.261) -- 0:01:38

      Average standard deviation of split frequencies: 0.069950

      20500 -- [-2295.608] (-2296.809) (-2291.759) (-2304.096) * (-2292.103) (-2290.529) (-2295.651) [-2302.526] -- 0:01:35
      21000 -- (-2291.926) (-2299.231) [-2297.554] (-2302.641) * (-2291.411) [-2294.011] (-2294.304) (-2295.636) -- 0:01:33
      21500 -- (-2292.558) (-2293.597) (-2292.319) [-2297.388] * (-2301.609) [-2295.044] (-2294.527) (-2299.681) -- 0:01:31
      22000 -- (-2294.334) (-2293.031) [-2297.894] (-2302.612) * (-2301.178) (-2299.665) [-2295.790] (-2299.019) -- 0:01:28
      22500 -- (-2291.768) (-2292.614) [-2297.162] (-2303.600) * [-2296.464] (-2298.259) (-2296.526) (-2298.565) -- 0:01:26
      23000 -- (-2294.129) [-2293.387] (-2298.171) (-2306.628) * [-2294.465] (-2294.682) (-2294.726) (-2296.308) -- 0:01:24
      23500 -- (-2296.361) (-2293.932) (-2308.045) [-2297.777] * [-2297.904] (-2298.526) (-2294.094) (-2300.306) -- 0:01:23
      24000 -- (-2296.924) (-2297.050) [-2292.164] (-2313.657) * (-2308.217) (-2299.627) (-2294.485) [-2302.131] -- 0:01:21
      24500 -- (-2292.685) (-2298.094) [-2298.483] (-2298.744) * [-2296.331] (-2299.824) (-2300.001) (-2293.923) -- 0:01:19
      25000 -- (-2292.546) (-2291.662) [-2293.574] (-2293.710) * (-2293.329) (-2298.218) (-2290.612) [-2295.477] -- 0:01:18

      Average standard deviation of split frequencies: 0.040795

      25500 -- (-2290.762) (-2295.754) [-2295.175] (-2297.945) * (-2298.942) [-2300.194] (-2298.587) (-2297.411) -- 0:01:16
      26000 -- (-2291.178) (-2293.166) (-2303.619) [-2295.468] * (-2301.145) [-2299.647] (-2298.234) (-2293.860) -- 0:01:14
      26500 -- (-2291.394) (-2293.732) (-2297.472) [-2299.767] * (-2303.333) (-2295.514) [-2299.186] (-2295.324) -- 0:01:13
      27000 -- [-2294.482] (-2297.304) (-2295.628) (-2297.176) * (-2299.858) [-2296.101] (-2298.449) (-2301.077) -- 0:01:12
      27500 -- (-2292.792) (-2294.978) (-2301.710) [-2296.394] * (-2296.676) (-2294.170) [-2295.572] (-2301.562) -- 0:01:46
      28000 -- (-2291.968) (-2291.628) (-2302.483) [-2297.011] * (-2303.317) [-2296.554] (-2294.178) (-2293.777) -- 0:01:44
      28500 -- [-2291.512] (-2294.204) (-2295.108) (-2297.685) * (-2296.158) (-2304.310) [-2294.641] (-2299.180) -- 0:01:42
      29000 -- (-2291.864) [-2293.555] (-2292.587) (-2303.198) * (-2301.504) (-2301.136) [-2295.419] (-2293.476) -- 0:01:40
      29500 -- (-2293.511) (-2290.274) [-2293.650] (-2297.473) * (-2292.179) (-2292.135) (-2298.924) [-2295.379] -- 0:01:38
      30000 -- (-2292.600) (-2289.902) [-2291.984] (-2306.553) * (-2298.356) [-2297.624] (-2297.783) (-2289.195) -- 0:01:37

      Average standard deviation of split frequencies: 0.031512

      30500 -- (-2294.221) [-2290.319] (-2299.020) (-2293.381) * (-2293.526) [-2300.111] (-2308.897) (-2291.096) -- 0:01:35
      31000 -- (-2293.356) (-2290.345) (-2296.833) [-2297.667] * [-2295.086] (-2293.053) (-2305.515) (-2295.742) -- 0:01:33
      31500 -- (-2295.544) (-2290.785) (-2297.957) [-2292.510] * (-2299.178) (-2296.328) [-2292.957] (-2290.759) -- 0:01:32
      32000 -- (-2293.763) (-2290.990) [-2293.221] (-2294.545) * (-2306.250) (-2299.970) (-2293.113) [-2301.054] -- 0:01:30
      32500 -- (-2291.107) [-2289.396] (-2298.761) (-2294.164) * (-2299.163) (-2300.311) [-2296.438] (-2311.617) -- 0:01:29
      33000 -- (-2288.979) [-2289.327] (-2293.428) (-2304.076) * (-2302.896) [-2299.872] (-2295.475) (-2296.079) -- 0:01:27
      33500 -- (-2290.796) (-2291.190) (-2292.566) [-2292.360] * (-2295.854) [-2297.242] (-2299.726) (-2299.274) -- 0:01:26
      34000 -- (-2290.713) [-2292.009] (-2293.965) (-2296.474) * (-2297.725) (-2297.365) (-2303.682) [-2297.992] -- 0:01:25
      34500 -- (-2291.592) (-2296.468) (-2293.644) [-2296.943] * (-2293.675) (-2307.955) (-2299.265) [-2295.704] -- 0:01:23
      35000 -- (-2290.604) (-2293.902) (-2292.604) [-2297.612] * [-2294.915] (-2293.666) (-2298.718) (-2299.698) -- 0:01:22

      Average standard deviation of split frequencies: 0.032392

      35500 -- (-2291.637) [-2292.918] (-2292.726) (-2301.032) * [-2297.275] (-2301.515) (-2291.371) (-2302.103) -- 0:01:21
      36000 -- (-2292.551) [-2296.377] (-2296.926) (-2296.829) * (-2305.362) (-2295.048) [-2296.646] (-2296.057) -- 0:01:20
      36500 -- (-2294.941) (-2292.813) [-2292.820] (-2296.330) * (-2292.705) [-2299.250] (-2297.208) (-2293.396) -- 0:01:19
      37000 -- (-2294.428) (-2291.803) (-2293.919) [-2300.334] * (-2300.261) (-2299.230) (-2292.955) [-2293.134] -- 0:01:18
      37500 -- [-2290.282] (-2292.683) (-2290.209) (-2302.961) * (-2299.737) [-2299.901] (-2296.260) (-2303.476) -- 0:01:17
      38000 -- (-2293.278) (-2291.483) (-2292.992) [-2293.900] * (-2307.062) (-2297.382) (-2302.798) [-2293.851] -- 0:01:15
      38500 -- (-2290.198) (-2291.688) [-2290.033] (-2304.037) * (-2301.282) [-2296.946] (-2294.706) (-2297.420) -- 0:01:14
      39000 -- [-2292.158] (-2294.571) (-2295.777) (-2302.635) * [-2294.600] (-2299.450) (-2294.937) (-2295.616) -- 0:01:13
      39500 -- (-2289.356) (-2297.101) [-2295.231] (-2298.327) * (-2294.413) (-2294.636) (-2301.654) [-2297.282] -- 0:01:12
      40000 -- [-2290.721] (-2292.110) (-2296.862) (-2295.269) * (-2295.521) (-2301.495) (-2301.405) [-2297.107] -- 0:01:12

      Average standard deviation of split frequencies: 0.033672

      40500 -- (-2289.907) [-2291.784] (-2294.658) (-2293.674) * (-2295.297) (-2298.553) (-2300.057) [-2295.017] -- 0:01:11
      41000 -- (-2291.088) (-2293.355) (-2293.537) [-2297.559] * (-2297.936) (-2295.313) [-2294.927] (-2299.233) -- 0:01:10
      41500 -- (-2290.769) (-2292.400) (-2292.163) [-2295.892] * (-2297.201) (-2300.505) [-2299.881] (-2297.706) -- 0:01:32
      42000 -- (-2295.280) (-2291.104) [-2290.399] (-2297.449) * [-2292.177] (-2296.764) (-2297.392) (-2295.445) -- 0:01:31
      42500 -- (-2293.563) (-2292.553) (-2291.037) [-2293.904] * (-2300.886) (-2300.040) [-2297.371] (-2304.549) -- 0:01:30
      43000 -- (-2291.210) (-2295.505) (-2291.505) [-2301.604] * (-2297.678) [-2294.137] (-2296.642) (-2301.755) -- 0:01:29
      43500 -- (-2291.871) (-2295.102) (-2290.646) [-2300.559] * (-2298.781) [-2296.196] (-2298.793) (-2303.241) -- 0:01:27
      44000 -- (-2291.351) (-2293.824) [-2291.094] (-2295.449) * (-2296.389) [-2294.327] (-2295.466) (-2300.149) -- 0:01:26
      44500 -- (-2292.325) (-2292.790) [-2294.979] (-2295.416) * (-2296.237) (-2293.082) [-2296.549] (-2304.365) -- 0:01:25
      45000 -- (-2291.493) (-2295.276) [-2291.351] (-2300.312) * (-2298.144) [-2290.478] (-2291.497) (-2293.678) -- 0:01:24

      Average standard deviation of split frequencies: 0.037576

      45500 -- (-2292.972) [-2293.399] (-2291.888) (-2301.216) * (-2301.215) (-2295.027) (-2300.737) [-2295.078] -- 0:01:23
      46000 -- [-2292.206] (-2293.936) (-2290.641) (-2297.253) * (-2307.269) (-2300.957) (-2298.696) [-2299.039] -- 0:01:22
      46500 -- (-2293.094) (-2294.830) (-2292.185) [-2294.796] * (-2304.704) (-2298.326) [-2299.379] (-2292.552) -- 0:01:22
      47000 -- (-2293.240) (-2297.308) [-2290.695] (-2296.473) * (-2310.622) (-2302.947) [-2298.962] (-2298.118) -- 0:01:21
      47500 -- (-2293.273) (-2295.409) (-2293.048) [-2295.557] * (-2292.665) (-2299.932) [-2290.570] (-2294.629) -- 0:01:20
      48000 -- [-2294.855] (-2293.928) (-2293.297) (-2300.580) * (-2299.392) (-2303.987) [-2298.425] (-2292.926) -- 0:01:19
      48500 -- (-2291.322) (-2293.924) (-2290.725) [-2297.979] * [-2297.228] (-2302.950) (-2302.691) (-2294.754) -- 0:01:18
      49000 -- [-2290.825] (-2290.009) (-2291.493) (-2293.940) * (-2298.152) (-2301.821) (-2301.189) [-2299.397] -- 0:01:17
      49500 -- (-2294.116) [-2290.764] (-2297.325) (-2293.431) * (-2295.902) (-2294.107) [-2297.420] (-2300.464) -- 0:01:16
      50000 -- [-2294.328] (-2293.470) (-2294.935) (-2293.629) * (-2303.746) (-2302.810) (-2299.858) [-2293.720] -- 0:01:16

      Average standard deviation of split frequencies: 0.036286

      50500 -- (-2292.597) (-2292.993) (-2292.069) [-2295.972] * (-2302.777) (-2299.606) (-2300.180) [-2291.083] -- 0:01:15
      51000 -- (-2293.032) (-2292.633) (-2291.701) [-2297.450] * (-2300.170) (-2302.837) [-2294.247] (-2298.533) -- 0:01:14
      51500 -- (-2291.234) (-2296.206) [-2293.093] (-2296.917) * [-2292.440] (-2299.982) (-2298.749) (-2292.102) -- 0:01:13
      52000 -- [-2293.795] (-2292.359) (-2292.578) (-2297.690) * (-2300.196) (-2315.996) (-2294.939) [-2294.882] -- 0:01:12
      52500 -- (-2294.469) (-2291.361) (-2290.529) [-2298.387] * [-2294.179] (-2302.178) (-2297.254) (-2302.262) -- 0:01:12
      53000 -- (-2293.955) (-2293.089) (-2294.595) [-2294.464] * (-2292.517) (-2293.037) [-2291.410] (-2293.197) -- 0:01:11
      53500 -- (-2295.593) (-2292.071) [-2293.563] (-2292.995) * (-2298.616) (-2293.736) [-2296.054] (-2292.915) -- 0:01:10
      54000 -- (-2290.807) (-2293.658) [-2291.364] (-2292.927) * (-2294.139) (-2293.154) (-2294.417) [-2290.780] -- 0:01:10
      54500 -- (-2290.417) (-2294.450) (-2291.279) [-2290.618] * (-2294.877) (-2295.916) [-2298.518] (-2295.195) -- 0:01:09
      55000 -- (-2291.302) (-2289.896) (-2291.738) [-2291.370] * (-2292.413) [-2291.780] (-2300.274) (-2291.619) -- 0:01:25

      Average standard deviation of split frequencies: 0.028862

      55500 -- (-2292.431) (-2295.394) [-2290.412] (-2289.484) * (-2292.865) (-2290.879) (-2295.915) [-2291.339] -- 0:01:25
      56000 -- (-2294.659) (-2295.003) [-2290.327] (-2294.601) * (-2291.522) (-2291.780) (-2300.017) [-2291.546] -- 0:01:24
      56500 -- (-2293.090) [-2295.635] (-2290.935) (-2294.047) * (-2292.034) (-2292.316) [-2306.273] (-2293.239) -- 0:01:23
      57000 -- [-2291.432] (-2293.167) (-2292.070) (-2292.433) * (-2291.214) [-2292.923] (-2299.899) (-2292.851) -- 0:01:22
      57500 -- (-2289.897) (-2291.797) (-2291.725) [-2293.051] * (-2292.123) (-2293.147) [-2296.334] (-2292.130) -- 0:01:21
      58000 -- [-2291.505] (-2293.688) (-2291.700) (-2293.564) * (-2295.580) (-2292.023) (-2293.062) [-2293.801] -- 0:01:21
      58500 -- [-2291.557] (-2293.404) (-2292.002) (-2295.452) * (-2293.137) (-2291.440) [-2291.426] (-2291.146) -- 0:01:20
      59000 -- (-2292.557) (-2292.890) (-2293.642) [-2296.743] * (-2291.708) (-2293.513) [-2293.195] (-2290.037) -- 0:01:19
      59500 -- (-2290.019) (-2292.608) [-2294.117] (-2297.128) * [-2292.423] (-2294.856) (-2297.446) (-2290.735) -- 0:01:19
      60000 -- (-2291.852) [-2293.051] (-2293.753) (-2296.757) * (-2291.108) (-2294.893) [-2294.371] (-2290.772) -- 0:01:18

      Average standard deviation of split frequencies: 0.023720

      60500 -- [-2291.246] (-2289.779) (-2292.482) (-2298.234) * (-2293.453) (-2293.961) [-2299.564] (-2291.253) -- 0:01:17
      61000 -- [-2291.775] (-2292.773) (-2295.618) (-2297.980) * (-2297.416) [-2293.967] (-2292.687) (-2293.892) -- 0:01:16
      61500 -- (-2293.604) (-2295.762) (-2294.127) [-2294.545] * (-2294.446) (-2292.656) [-2295.098] (-2293.197) -- 0:01:16
      62000 -- [-2290.310] (-2297.596) (-2293.457) (-2293.915) * [-2293.659] (-2296.214) (-2299.316) (-2291.555) -- 0:01:15
      62500 -- (-2291.190) [-2296.049] (-2296.197) (-2292.655) * (-2296.278) (-2294.780) (-2295.795) [-2290.428] -- 0:01:15
      63000 -- [-2292.533] (-2294.423) (-2291.928) (-2292.501) * (-2291.954) (-2294.251) (-2299.159) [-2291.320] -- 0:01:14
      63500 -- [-2291.872] (-2295.984) (-2295.896) (-2295.585) * (-2293.923) (-2294.713) (-2294.418) [-2291.573] -- 0:01:13
      64000 -- (-2293.898) (-2291.778) [-2288.960] (-2296.690) * (-2296.225) (-2293.622) (-2294.699) [-2292.137] -- 0:01:13
      64500 -- (-2293.935) [-2291.280] (-2289.810) (-2296.181) * (-2294.833) [-2295.481] (-2292.411) (-2290.886) -- 0:01:12
      65000 -- [-2291.475] (-2292.553) (-2289.565) (-2295.112) * (-2291.321) (-2292.850) [-2291.903] (-2289.523) -- 0:01:11

      Average standard deviation of split frequencies: 0.020676

      65500 -- (-2291.906) (-2289.788) [-2289.864] (-2293.873) * (-2291.199) [-2292.039] (-2298.194) (-2291.188) -- 0:01:11
      66000 -- (-2293.795) [-2290.473] (-2288.329) (-2292.729) * (-2291.815) (-2292.886) (-2299.741) [-2293.487] -- 0:01:10
      66500 -- (-2294.884) (-2290.876) [-2293.081] (-2295.796) * (-2298.273) (-2294.393) [-2288.739] (-2293.995) -- 0:01:10
      67000 -- (-2289.146) (-2294.512) [-2294.068] (-2298.315) * (-2291.909) (-2292.986) (-2299.864) [-2294.300] -- 0:01:09
      67500 -- (-2291.854) [-2291.443] (-2290.432) (-2295.027) * (-2294.742) (-2293.332) (-2303.639) [-2292.173] -- 0:01:09
      68000 -- (-2292.640) [-2294.718] (-2290.012) (-2295.776) * [-2290.897] (-2292.086) (-2296.584) (-2293.138) -- 0:01:08
      68500 -- (-2291.921) (-2291.863) [-2291.889] (-2295.868) * (-2292.568) (-2291.782) [-2296.711] (-2293.516) -- 0:01:07
      69000 -- (-2288.768) (-2292.803) (-2293.934) [-2292.962] * (-2291.917) (-2294.941) [-2295.104] (-2292.230) -- 0:01:20
      69500 -- (-2297.322) (-2293.587) [-2292.515] (-2296.213) * (-2291.666) (-2296.441) [-2297.438] (-2293.432) -- 0:01:20
      70000 -- (-2293.881) (-2294.396) [-2292.617] (-2297.406) * (-2289.317) [-2292.283] (-2292.226) (-2290.751) -- 0:01:19

      Average standard deviation of split frequencies: 0.023875

      70500 -- [-2293.860] (-2291.069) (-2293.113) (-2292.774) * (-2291.193) (-2290.557) [-2294.126] (-2291.317) -- 0:01:19
      71000 -- (-2293.340) (-2292.335) [-2291.074] (-2294.354) * (-2289.756) [-2292.632] (-2297.902) (-2291.591) -- 0:01:18
      71500 -- (-2294.700) (-2291.847) [-2292.655] (-2295.749) * (-2291.913) [-2295.942] (-2293.967) (-2290.119) -- 0:01:17
      72000 -- (-2290.922) [-2289.747] (-2292.896) (-2295.503) * (-2294.028) (-2295.460) (-2295.174) [-2291.097] -- 0:01:17
      72500 -- (-2291.571) (-2290.083) [-2292.588] (-2294.956) * [-2287.822] (-2294.398) (-2295.413) (-2290.688) -- 0:01:16
      73000 -- (-2290.560) [-2290.780] (-2293.159) (-2294.927) * [-2293.419] (-2294.176) (-2299.948) (-2288.985) -- 0:01:16
      73500 -- [-2290.438] (-2296.172) (-2291.380) (-2299.352) * [-2292.749] (-2294.155) (-2292.659) (-2292.436) -- 0:01:15
      74000 -- (-2291.237) (-2298.868) [-2291.692] (-2294.526) * (-2293.738) (-2294.346) [-2289.819] (-2291.426) -- 0:01:15
      74500 -- (-2291.402) [-2295.157] (-2295.487) (-2293.806) * (-2290.535) (-2293.799) [-2291.473] (-2294.022) -- 0:01:14
      75000 -- [-2292.631] (-2293.258) (-2292.329) (-2292.372) * (-2290.238) (-2292.352) (-2292.397) [-2291.279] -- 0:01:14

      Average standard deviation of split frequencies: 0.022852

      75500 -- (-2292.186) [-2292.254] (-2293.848) (-2294.021) * (-2290.576) (-2294.341) [-2295.195] (-2291.326) -- 0:01:13
      76000 -- (-2292.021) [-2290.651] (-2293.916) (-2294.598) * (-2294.323) (-2294.020) [-2298.721] (-2296.789) -- 0:01:12
      76500 -- (-2291.675) (-2292.622) [-2292.190] (-2293.809) * (-2293.648) [-2291.274] (-2293.607) (-2294.538) -- 0:01:12
      77000 -- (-2292.248) (-2293.730) (-2293.743) [-2291.653] * (-2291.635) (-2290.969) [-2293.448] (-2291.365) -- 0:01:11
      77500 -- (-2292.222) [-2294.295] (-2292.721) (-2293.951) * [-2294.858] (-2290.770) (-2299.466) (-2289.074) -- 0:01:11
      78000 -- (-2290.156) [-2290.938] (-2291.003) (-2292.162) * (-2298.240) (-2290.944) [-2299.001] (-2292.062) -- 0:01:10
      78500 -- (-2291.258) (-2290.863) [-2295.011] (-2293.775) * (-2290.816) (-2294.436) [-2292.532] (-2293.704) -- 0:01:10
      79000 -- (-2290.565) (-2292.973) (-2292.099) [-2293.785] * (-2289.551) (-2291.488) (-2301.699) [-2292.003] -- 0:01:09
      79500 -- (-2291.514) [-2290.548] (-2291.296) (-2292.877) * (-2290.222) [-2290.477] (-2302.616) (-2292.140) -- 0:01:09
      80000 -- (-2290.316) [-2292.261] (-2290.401) (-2293.170) * (-2291.365) (-2291.036) (-2299.200) [-2290.012] -- 0:01:09

      Average standard deviation of split frequencies: 0.023375

      80500 -- (-2295.068) (-2293.464) [-2291.950] (-2291.987) * (-2291.776) (-2290.487) [-2290.494] (-2292.843) -- 0:01:08
      81000 -- (-2292.744) (-2289.607) [-2291.994] (-2292.924) * (-2294.014) (-2291.465) (-2299.816) [-2290.063] -- 0:01:08
      81500 -- (-2295.102) [-2290.252] (-2292.728) (-2292.856) * [-2291.172] (-2290.689) (-2305.698) (-2292.452) -- 0:01:07
      82000 -- [-2295.491] (-2292.450) (-2293.825) (-2292.671) * (-2292.959) (-2291.910) [-2299.709] (-2290.245) -- 0:01:07
      82500 -- [-2292.320] (-2290.287) (-2291.678) (-2292.220) * [-2289.498] (-2293.466) (-2296.233) (-2290.429) -- 0:01:17
      83000 -- (-2292.304) [-2291.240] (-2292.018) (-2294.143) * (-2292.378) (-2294.492) [-2294.101] (-2291.362) -- 0:01:17
      83500 -- (-2290.735) [-2290.692] (-2291.888) (-2298.301) * (-2292.513) (-2292.374) [-2300.018] (-2291.613) -- 0:01:16
      84000 -- (-2293.703) (-2289.241) (-2292.664) [-2296.516] * (-2290.548) (-2292.693) (-2291.936) [-2294.700] -- 0:01:16
      84500 -- [-2292.237] (-2294.779) (-2294.518) (-2292.159) * (-2295.610) (-2295.075) (-2293.672) [-2292.064] -- 0:01:15
      85000 -- (-2292.964) (-2293.738) [-2294.469] (-2294.562) * [-2295.414] (-2292.719) (-2296.066) (-2290.759) -- 0:01:15

      Average standard deviation of split frequencies: 0.025580

      85500 -- (-2293.427) (-2289.851) [-2294.566] (-2294.339) * (-2292.425) (-2293.877) [-2300.344] (-2291.673) -- 0:01:14
      86000 -- (-2294.319) (-2289.668) (-2293.641) [-2293.063] * (-2296.020) (-2291.587) [-2295.279] (-2291.124) -- 0:01:14
      86500 -- (-2293.282) (-2292.114) [-2294.484] (-2291.592) * (-2294.507) (-2292.403) [-2301.458] (-2291.339) -- 0:01:13
      87000 -- (-2293.287) (-2294.964) [-2290.299] (-2292.348) * (-2292.020) (-2291.704) [-2294.730] (-2290.417) -- 0:01:13
      87500 -- (-2295.330) (-2294.842) (-2296.311) [-2297.943] * [-2293.762] (-2291.006) (-2299.248) (-2290.313) -- 0:01:13
      88000 -- [-2293.305] (-2292.032) (-2293.864) (-2295.207) * (-2292.176) (-2290.077) (-2305.124) [-2289.502] -- 0:01:12
      88500 -- (-2297.130) (-2293.850) [-2295.272] (-2292.667) * (-2291.505) (-2290.826) [-2294.335] (-2291.416) -- 0:01:12
      89000 -- (-2293.179) [-2292.499] (-2294.616) (-2297.036) * (-2291.843) [-2295.363] (-2297.163) (-2294.118) -- 0:01:11
      89500 -- [-2294.452] (-2293.590) (-2295.383) (-2291.015) * (-2293.623) (-2290.098) [-2290.845] (-2292.190) -- 0:01:11
      90000 -- (-2295.186) (-2291.887) [-2293.355] (-2294.307) * (-2291.015) (-2292.570) (-2299.253) [-2295.000] -- 0:01:10

      Average standard deviation of split frequencies: 0.025477

      90500 -- [-2294.100] (-2292.487) (-2294.251) (-2294.479) * (-2293.404) (-2293.208) [-2296.428] (-2292.201) -- 0:01:10
      91000 -- (-2292.868) (-2292.812) [-2292.015] (-2291.221) * (-2294.173) (-2293.761) [-2294.675] (-2291.855) -- 0:01:09
      91500 -- [-2291.315] (-2289.281) (-2291.848) (-2292.788) * [-2291.682] (-2291.842) (-2295.375) (-2293.049) -- 0:01:09
      92000 -- (-2291.029) (-2291.141) (-2295.525) [-2291.117] * [-2290.411] (-2291.697) (-2297.494) (-2291.541) -- 0:01:09
      92500 -- (-2293.167) (-2289.497) (-2296.611) [-2291.893] * (-2291.679) [-2290.639] (-2295.190) (-2292.260) -- 0:01:08
      93000 -- (-2297.392) (-2289.836) [-2296.641] (-2292.179) * (-2290.307) (-2292.783) [-2294.055] (-2291.751) -- 0:01:08
      93500 -- (-2292.568) [-2291.169] (-2294.510) (-2292.746) * (-2291.690) (-2293.427) (-2292.423) [-2295.611] -- 0:01:07
      94000 -- (-2294.944) [-2289.923] (-2296.532) (-2293.496) * (-2294.280) [-2290.906] (-2292.143) (-2295.231) -- 0:01:07
      94500 -- (-2292.941) (-2289.698) [-2295.573] (-2293.903) * [-2294.229] (-2291.318) (-2294.645) (-2293.721) -- 0:01:07
      95000 -- (-2291.130) (-2291.490) (-2293.067) [-2292.493] * (-2291.933) (-2290.976) (-2292.817) [-2289.836] -- 0:01:06

      Average standard deviation of split frequencies: 0.022226

      95500 -- (-2288.644) (-2291.234) [-2293.822] (-2293.793) * (-2295.625) (-2294.870) (-2293.210) [-2290.351] -- 0:01:06
      96000 -- (-2291.131) [-2290.959] (-2295.176) (-2292.926) * [-2290.745] (-2293.576) (-2294.060) (-2293.871) -- 0:01:05
      96500 -- (-2290.575) (-2294.657) (-2297.621) [-2292.522] * (-2293.795) [-2292.258] (-2292.246) (-2294.329) -- 0:01:14
      97000 -- [-2291.676] (-2292.612) (-2297.890) (-2291.440) * (-2289.769) (-2290.827) (-2293.392) [-2292.759] -- 0:01:14
      97500 -- (-2292.525) (-2289.868) [-2297.447] (-2293.482) * (-2290.826) (-2295.214) [-2291.968] (-2294.910) -- 0:01:14
      98000 -- (-2294.125) (-2289.254) (-2296.731) [-2292.170] * (-2293.163) (-2295.370) (-2290.683) [-2293.322] -- 0:01:13
      98500 -- (-2293.404) (-2291.586) (-2295.709) [-2294.544] * (-2294.007) (-2295.727) (-2290.504) [-2290.399] -- 0:01:13
      99000 -- [-2290.585] (-2292.778) (-2296.339) (-2293.877) * [-2291.524] (-2292.973) (-2293.961) (-2292.889) -- 0:01:12
      99500 -- [-2291.074] (-2291.522) (-2293.168) (-2293.533) * (-2289.232) (-2297.109) (-2294.228) [-2293.457] -- 0:01:12
      100000 -- (-2291.643) (-2294.380) (-2295.251) [-2289.544] * (-2289.342) (-2294.242) [-2292.761] (-2294.431) -- 0:01:12

      Average standard deviation of split frequencies: 0.022182

      100500 -- [-2298.208] (-2294.300) (-2296.159) (-2292.448) * (-2290.569) (-2294.493) [-2291.082] (-2301.177) -- 0:01:11
      101000 -- (-2292.750) (-2296.101) (-2296.668) [-2289.503] * (-2294.261) [-2293.358] (-2292.478) (-2297.343) -- 0:01:11
      101500 -- (-2289.384) [-2291.042] (-2294.682) (-2290.212) * [-2293.674] (-2295.541) (-2293.085) (-2294.145) -- 0:01:10
      102000 -- (-2291.714) (-2290.189) (-2292.946) [-2291.518] * (-2294.466) (-2294.073) [-2291.304] (-2293.725) -- 0:01:10
      102500 -- (-2290.370) (-2288.565) (-2294.486) [-2293.036] * (-2294.419) (-2296.819) (-2292.373) [-2293.021] -- 0:01:10
      103000 -- (-2293.584) (-2295.881) (-2292.608) [-2291.620] * (-2296.102) (-2294.637) (-2292.256) [-2291.603] -- 0:01:09
      103500 -- [-2290.790] (-2292.675) (-2291.717) (-2292.460) * (-2299.592) [-2294.423] (-2294.391) (-2290.829) -- 0:01:09
      104000 -- [-2293.044] (-2293.781) (-2294.786) (-2291.058) * (-2295.202) (-2294.601) [-2291.629] (-2292.348) -- 0:01:08
      104500 -- (-2291.364) (-2293.844) [-2290.683] (-2290.689) * (-2295.376) (-2296.059) (-2293.287) [-2291.378] -- 0:01:08
      105000 -- [-2291.334] (-2292.067) (-2294.076) (-2291.850) * [-2292.710] (-2296.620) (-2294.003) (-2291.730) -- 0:01:08

      Average standard deviation of split frequencies: 0.019123

      105500 -- (-2293.894) [-2292.081] (-2295.587) (-2292.922) * [-2290.951] (-2294.056) (-2290.662) (-2292.897) -- 0:01:07
      106000 -- [-2291.932] (-2289.713) (-2292.241) (-2290.238) * (-2289.621) (-2294.798) [-2290.748] (-2292.930) -- 0:01:07
      106500 -- (-2292.590) [-2291.386] (-2292.389) (-2291.752) * (-2293.576) (-2292.624) (-2293.760) [-2292.222] -- 0:01:07
      107000 -- (-2293.799) [-2290.433] (-2293.404) (-2290.576) * [-2290.294] (-2292.929) (-2292.793) (-2293.543) -- 0:01:06
      107500 -- (-2293.260) (-2291.523) [-2292.501] (-2290.866) * (-2289.511) (-2294.416) [-2292.043] (-2292.815) -- 0:01:06
      108000 -- (-2289.832) (-2289.921) [-2293.745] (-2293.243) * [-2291.900] (-2296.361) (-2288.607) (-2293.269) -- 0:01:06
      108500 -- [-2292.814] (-2292.331) (-2291.972) (-2292.606) * (-2291.101) (-2292.662) (-2289.547) [-2293.144] -- 0:01:05
      109000 -- (-2293.511) (-2293.996) [-2291.772] (-2292.100) * [-2291.913] (-2293.777) (-2290.706) (-2290.828) -- 0:01:05
      109500 -- (-2295.579) (-2294.879) [-2291.530] (-2298.375) * (-2292.924) (-2293.025) (-2292.440) [-2292.787] -- 0:01:05
      110000 -- (-2294.981) (-2293.025) (-2292.344) [-2296.256] * (-2294.445) (-2293.195) (-2295.543) [-2291.689] -- 0:01:12

      Average standard deviation of split frequencies: 0.017465

      110500 -- (-2292.267) (-2290.928) [-2288.307] (-2295.030) * (-2296.953) (-2294.598) [-2295.543] (-2291.985) -- 0:01:12
      111000 -- (-2292.657) (-2292.759) (-2290.197) [-2294.134] * [-2296.223] (-2294.486) (-2297.802) (-2292.158) -- 0:01:12
      111500 -- [-2292.601] (-2293.121) (-2288.103) (-2292.759) * (-2292.916) (-2293.825) (-2291.266) [-2294.568] -- 0:01:11
      112000 -- (-2291.779) (-2293.884) (-2291.607) [-2292.125] * (-2291.270) [-2292.716] (-2292.196) (-2291.357) -- 0:01:11
      112500 -- (-2291.887) (-2290.805) [-2294.855] (-2292.698) * (-2291.601) (-2294.387) (-2292.664) [-2290.599] -- 0:01:11
      113000 -- (-2291.366) (-2298.633) [-2293.681] (-2298.430) * [-2291.212] (-2296.329) (-2290.791) (-2290.282) -- 0:01:10
      113500 -- (-2291.644) [-2296.621] (-2294.893) (-2295.255) * (-2291.227) (-2293.952) [-2290.066] (-2293.539) -- 0:01:10
      114000 -- (-2292.317) [-2291.234] (-2293.456) (-2295.604) * (-2294.890) (-2294.944) [-2290.154] (-2294.477) -- 0:01:09
      114500 -- (-2291.267) (-2291.640) (-2295.369) [-2292.806] * (-2291.000) [-2294.569] (-2293.510) (-2290.766) -- 0:01:09
      115000 -- (-2296.176) (-2292.635) [-2292.812] (-2291.012) * (-2293.345) (-2294.093) [-2294.469] (-2291.267) -- 0:01:09

      Average standard deviation of split frequencies: 0.017753

      115500 -- (-2291.295) (-2291.324) [-2293.184] (-2290.784) * (-2293.788) (-2290.528) [-2294.934] (-2291.421) -- 0:01:08
      116000 -- [-2293.191] (-2294.915) (-2299.441) (-2292.404) * (-2293.730) [-2292.383] (-2291.720) (-2291.555) -- 0:01:08
      116500 -- (-2290.862) (-2293.770) [-2293.270] (-2294.049) * [-2290.494] (-2292.268) (-2290.641) (-2290.409) -- 0:01:08
      117000 -- [-2291.214] (-2294.669) (-2293.137) (-2289.848) * (-2297.468) [-2292.208] (-2288.823) (-2290.585) -- 0:01:07
      117500 -- (-2293.906) (-2294.268) (-2291.717) [-2289.975] * [-2290.843] (-2300.047) (-2295.005) (-2289.657) -- 0:01:07
      118000 -- (-2292.445) (-2293.987) [-2300.365] (-2289.956) * [-2293.047] (-2296.731) (-2293.447) (-2290.017) -- 0:01:07
      118500 -- (-2292.371) [-2293.774] (-2294.714) (-2292.825) * (-2297.096) (-2296.487) (-2291.297) [-2291.027] -- 0:01:06
      119000 -- [-2292.768] (-2292.979) (-2291.891) (-2292.969) * [-2302.903] (-2296.496) (-2291.201) (-2293.819) -- 0:01:06
      119500 -- [-2293.948] (-2290.796) (-2292.939) (-2292.969) * (-2299.097) (-2291.620) (-2292.040) [-2289.407] -- 0:01:06
      120000 -- (-2294.853) (-2292.688) (-2290.474) [-2293.137] * (-2291.986) (-2296.033) (-2292.816) [-2288.694] -- 0:01:06

      Average standard deviation of split frequencies: 0.018384

      120500 -- (-2300.602) (-2292.552) [-2294.422] (-2291.533) * (-2292.409) [-2291.863] (-2292.046) (-2293.330) -- 0:01:05
      121000 -- [-2294.469] (-2291.260) (-2291.427) (-2290.183) * (-2290.925) (-2292.353) (-2293.580) [-2291.553] -- 0:01:05
      121500 -- (-2292.163) (-2295.709) (-2289.901) [-2291.498] * (-2290.001) (-2292.810) (-2292.439) [-2293.782] -- 0:01:05
      122000 -- (-2291.905) [-2296.812] (-2293.101) (-2289.981) * (-2289.673) [-2291.690] (-2293.166) (-2296.296) -- 0:01:04
      122500 -- (-2292.019) (-2298.128) [-2292.966] (-2291.656) * [-2291.943] (-2292.289) (-2293.843) (-2292.327) -- 0:01:04
      123000 -- (-2291.909) (-2302.294) (-2293.300) [-2291.728] * (-2292.913) (-2291.734) [-2291.977] (-2291.054) -- 0:01:04
      123500 -- (-2293.750) [-2291.683] (-2293.424) (-2295.063) * [-2290.262] (-2292.449) (-2291.967) (-2291.428) -- 0:01:03
      124000 -- [-2291.419] (-2290.680) (-2291.671) (-2293.828) * [-2289.976] (-2293.396) (-2293.352) (-2291.140) -- 0:01:10
      124500 -- (-2297.408) [-2290.515] (-2292.746) (-2294.301) * (-2289.759) (-2291.851) (-2294.026) [-2289.643] -- 0:01:10
      125000 -- (-2291.893) [-2289.024] (-2293.776) (-2288.345) * (-2294.376) (-2294.567) (-2292.432) [-2291.389] -- 0:01:10

      Average standard deviation of split frequencies: 0.019100

      125500 -- (-2289.876) (-2290.519) [-2292.114] (-2292.321) * (-2292.543) (-2291.607) [-2295.203] (-2289.855) -- 0:01:09
      126000 -- (-2289.997) [-2290.568] (-2295.494) (-2290.133) * (-2290.620) [-2294.281] (-2295.011) (-2290.741) -- 0:01:09
      126500 -- [-2292.583] (-2291.951) (-2292.232) (-2292.647) * (-2290.476) (-2300.375) (-2295.636) [-2291.089] -- 0:01:09
      127000 -- (-2291.267) (-2289.308) (-2292.483) [-2291.431] * (-2292.459) (-2294.010) (-2296.189) [-2290.383] -- 0:01:08
      127500 -- [-2292.249] (-2290.770) (-2291.468) (-2293.502) * (-2294.524) (-2291.881) (-2296.558) [-2293.849] -- 0:01:08
      128000 -- (-2290.663) [-2291.233] (-2291.626) (-2294.600) * (-2291.903) [-2293.142] (-2297.098) (-2293.146) -- 0:01:08
      128500 -- (-2290.979) (-2288.246) [-2292.717] (-2290.380) * (-2290.879) (-2293.606) (-2297.487) [-2292.953] -- 0:01:07
      129000 -- [-2293.318] (-2290.978) (-2292.868) (-2295.941) * (-2291.122) (-2294.729) [-2292.732] (-2295.505) -- 0:01:07
      129500 -- (-2295.022) (-2294.099) [-2293.390] (-2292.936) * (-2291.137) [-2295.308] (-2293.904) (-2289.137) -- 0:01:07
      130000 -- (-2291.336) (-2293.267) (-2295.526) [-2288.563] * (-2292.543) (-2293.419) (-2294.301) [-2288.634] -- 0:01:06

      Average standard deviation of split frequencies: 0.021456

      130500 -- [-2290.461] (-2289.161) (-2293.706) (-2292.301) * [-2291.951] (-2293.331) (-2292.733) (-2289.941) -- 0:01:06
      131000 -- (-2290.256) (-2291.776) [-2300.300] (-2294.173) * (-2293.549) [-2293.075] (-2295.553) (-2294.331) -- 0:01:06
      131500 -- (-2295.457) (-2294.119) (-2295.541) [-2292.437] * [-2291.289] (-2291.919) (-2298.686) (-2293.987) -- 0:01:06
      132000 -- (-2290.203) [-2290.129] (-2295.493) (-2293.262) * (-2293.123) [-2290.609] (-2299.573) (-2292.561) -- 0:01:05
      132500 -- (-2294.259) (-2291.162) (-2293.123) [-2291.206] * (-2289.110) [-2292.661] (-2294.959) (-2296.485) -- 0:01:05
      133000 -- (-2292.782) (-2290.962) (-2295.981) [-2292.710] * (-2295.964) (-2292.832) [-2297.220] (-2292.604) -- 0:01:05
      133500 -- (-2294.750) [-2291.504] (-2298.123) (-2290.510) * (-2293.352) (-2294.980) (-2294.817) [-2293.686] -- 0:01:04
      134000 -- (-2294.858) (-2290.428) [-2297.305] (-2291.790) * [-2293.301] (-2293.723) (-2292.424) (-2293.138) -- 0:01:04
      134500 -- (-2295.637) (-2292.777) [-2293.790] (-2291.919) * (-2294.687) [-2293.898] (-2294.828) (-2291.628) -- 0:01:04
      135000 -- [-2290.720] (-2294.485) (-2295.151) (-2296.205) * (-2296.063) (-2293.648) [-2293.107] (-2291.729) -- 0:01:04

      Average standard deviation of split frequencies: 0.020797

      135500 -- (-2293.764) [-2291.355] (-2294.472) (-2290.451) * (-2293.182) [-2294.208] (-2295.948) (-2289.529) -- 0:01:03
      136000 -- (-2296.339) [-2289.821] (-2293.643) (-2289.703) * (-2289.849) [-2293.378] (-2301.947) (-2290.995) -- 0:01:03
      136500 -- (-2298.635) (-2291.898) (-2294.015) [-2289.957] * (-2292.736) (-2292.098) (-2293.696) [-2290.501] -- 0:01:03
      137000 -- (-2294.275) (-2293.752) (-2294.790) [-2288.640] * [-2294.771] (-2294.951) (-2290.227) (-2292.377) -- 0:01:02
      137500 -- (-2292.999) (-2295.088) (-2296.336) [-2288.204] * (-2295.074) (-2294.831) (-2291.340) [-2289.903] -- 0:01:09
      138000 -- (-2293.102) [-2297.287] (-2290.474) (-2290.940) * (-2293.112) [-2291.154] (-2291.992) (-2292.105) -- 0:01:08
      138500 -- (-2290.573) (-2289.251) (-2293.045) [-2289.967] * (-2293.003) (-2292.528) (-2292.046) [-2289.952] -- 0:01:08
      139000 -- (-2293.026) (-2292.320) (-2294.372) [-2289.955] * (-2294.263) (-2293.556) [-2292.731] (-2290.837) -- 0:01:08
      139500 -- (-2295.226) [-2291.819] (-2294.643) (-2294.007) * (-2293.153) (-2293.257) [-2292.258] (-2295.595) -- 0:01:07
      140000 -- [-2294.776] (-2291.881) (-2295.060) (-2290.785) * (-2293.678) (-2290.448) (-2293.314) [-2288.811] -- 0:01:07

      Average standard deviation of split frequencies: 0.020107

      140500 -- (-2293.742) (-2291.979) [-2290.918] (-2294.977) * (-2291.851) (-2296.048) [-2292.017] (-2289.487) -- 0:01:07
      141000 -- (-2294.911) (-2289.970) [-2294.207] (-2293.566) * (-2292.232) (-2295.577) [-2291.772] (-2290.126) -- 0:01:07
      141500 -- (-2294.706) [-2291.129] (-2292.370) (-2295.029) * (-2292.954) (-2292.885) (-2293.730) [-2289.597] -- 0:01:06
      142000 -- (-2293.633) (-2289.989) (-2294.203) [-2293.795] * (-2290.506) [-2290.539] (-2291.722) (-2291.339) -- 0:01:06
      142500 -- [-2293.501] (-2293.639) (-2294.064) (-2297.670) * (-2293.249) (-2291.838) (-2291.079) [-2297.621] -- 0:01:06
      143000 -- (-2292.963) (-2293.018) [-2294.819] (-2293.388) * (-2293.802) (-2295.711) (-2290.634) [-2291.991] -- 0:01:05
      143500 -- (-2291.575) (-2293.769) [-2294.053] (-2296.759) * (-2290.964) (-2290.370) (-2291.306) [-2288.886] -- 0:01:05
      144000 -- (-2291.677) (-2293.279) (-2296.256) [-2294.338] * (-2291.918) [-2291.047] (-2293.457) (-2290.036) -- 0:01:05
      144500 -- (-2293.216) (-2294.778) (-2295.103) [-2294.633] * (-2292.023) (-2290.242) (-2292.865) [-2290.820] -- 0:01:05
      145000 -- (-2295.126) (-2295.432) (-2293.893) [-2294.788] * (-2292.897) (-2294.133) (-2294.227) [-2293.685] -- 0:01:04

      Average standard deviation of split frequencies: 0.019696

      145500 -- (-2292.280) [-2292.966] (-2295.464) (-2293.150) * (-2290.813) [-2291.139] (-2290.786) (-2293.635) -- 0:01:04
      146000 -- (-2294.629) (-2290.865) (-2293.908) [-2289.510] * (-2294.168) (-2289.831) (-2291.833) [-2293.490] -- 0:01:04
      146500 -- (-2294.041) [-2291.942] (-2294.263) (-2290.389) * (-2295.353) (-2291.668) [-2290.466] (-2293.302) -- 0:01:04
      147000 -- (-2300.753) (-2295.766) (-2293.464) [-2290.829] * (-2294.220) [-2291.841] (-2293.721) (-2293.315) -- 0:01:03
      147500 -- (-2291.064) (-2295.232) (-2294.718) [-2288.968] * (-2294.324) (-2291.543) (-2291.076) [-2294.960] -- 0:01:03
      148000 -- (-2296.110) [-2294.963] (-2295.857) (-2288.224) * (-2291.663) (-2291.904) (-2292.380) [-2294.191] -- 0:01:03
      148500 -- [-2297.105] (-2294.383) (-2292.831) (-2293.971) * (-2293.380) (-2299.106) (-2291.180) [-2291.502] -- 0:01:03
      149000 -- (-2295.885) (-2293.521) [-2292.560] (-2291.633) * (-2295.392) (-2300.467) (-2291.543) [-2290.127] -- 0:01:02
      149500 -- (-2293.480) (-2293.613) (-2290.634) [-2292.665] * (-2289.876) (-2294.285) [-2291.325] (-2296.708) -- 0:01:02
      150000 -- [-2293.461] (-2292.761) (-2291.840) (-2292.931) * [-2289.902] (-2295.210) (-2291.609) (-2289.385) -- 0:01:02

      Average standard deviation of split frequencies: 0.019761

      150500 -- [-2293.439] (-2290.707) (-2288.971) (-2295.093) * (-2295.447) [-2291.474] (-2292.747) (-2291.817) -- 0:01:02
      151000 -- (-2291.370) (-2296.278) [-2292.889] (-2294.450) * [-2289.858] (-2291.200) (-2292.526) (-2295.189) -- 0:01:07
      151500 -- (-2292.761) (-2289.342) [-2293.935] (-2298.917) * (-2291.679) (-2291.896) [-2290.798] (-2290.483) -- 0:01:07
      152000 -- [-2293.065] (-2291.567) (-2290.052) (-2295.155) * (-2290.131) (-2293.278) [-2290.125] (-2293.459) -- 0:01:06
      152500 -- (-2292.906) (-2295.644) [-2290.247] (-2294.343) * (-2294.321) (-2296.847) [-2293.888] (-2293.115) -- 0:01:06
      153000 -- (-2291.303) (-2293.036) [-2291.800] (-2294.717) * [-2295.070] (-2299.287) (-2292.232) (-2293.054) -- 0:01:06
      153500 -- [-2291.583] (-2293.753) (-2290.705) (-2292.828) * (-2295.650) (-2299.014) [-2292.370] (-2293.968) -- 0:01:06
      154000 -- [-2291.747] (-2290.314) (-2290.935) (-2293.602) * (-2294.212) (-2296.623) (-2292.947) [-2291.644] -- 0:01:05
      154500 -- (-2295.269) [-2290.636] (-2290.137) (-2296.002) * [-2291.525] (-2293.694) (-2293.761) (-2295.129) -- 0:01:05
      155000 -- (-2297.700) (-2290.867) (-2289.830) [-2293.296] * (-2292.795) (-2293.597) (-2291.756) [-2290.188] -- 0:01:05

      Average standard deviation of split frequencies: 0.020481

      155500 -- (-2296.646) [-2290.092] (-2293.834) (-2293.832) * (-2293.336) [-2293.115] (-2292.047) (-2291.905) -- 0:01:05
      156000 -- (-2299.799) [-2292.543] (-2297.960) (-2292.744) * (-2297.057) [-2291.190] (-2293.357) (-2293.858) -- 0:01:04
      156500 -- (-2293.166) (-2294.933) [-2290.939] (-2290.191) * (-2290.734) (-2290.854) [-2294.584] (-2290.496) -- 0:01:04
      157000 -- (-2291.787) (-2293.131) [-2289.881] (-2291.274) * (-2291.843) (-2293.171) [-2290.709] (-2289.291) -- 0:01:04
      157500 -- (-2294.414) (-2301.717) [-2291.779] (-2289.635) * [-2294.650] (-2292.584) (-2290.627) (-2291.657) -- 0:01:04
      158000 -- (-2293.890) (-2293.360) (-2294.930) [-2292.391] * [-2294.513] (-2292.672) (-2293.634) (-2290.913) -- 0:01:03
      158500 -- (-2292.417) [-2294.580] (-2292.115) (-2294.879) * [-2293.042] (-2292.667) (-2292.078) (-2293.422) -- 0:01:03
      159000 -- [-2296.301] (-2294.298) (-2295.132) (-2294.669) * (-2290.122) (-2296.052) [-2291.296] (-2290.835) -- 0:01:03
      159500 -- (-2297.536) [-2291.965] (-2293.650) (-2293.088) * (-2289.821) [-2293.896] (-2291.962) (-2290.556) -- 0:01:03
      160000 -- (-2303.287) (-2288.092) (-2290.732) [-2290.782] * [-2289.256] (-2290.974) (-2293.947) (-2291.218) -- 0:01:02

      Average standard deviation of split frequencies: 0.021774

      160500 -- (-2304.379) (-2289.035) (-2292.067) [-2289.677] * (-2290.957) (-2295.471) [-2291.380] (-2293.202) -- 0:01:02
      161000 -- (-2298.618) [-2288.748] (-2296.921) (-2292.272) * [-2291.532] (-2291.814) (-2291.489) (-2293.442) -- 0:01:02
      161500 -- (-2295.118) [-2289.767] (-2294.720) (-2297.580) * (-2295.274) (-2295.664) [-2291.444] (-2293.405) -- 0:01:02
      162000 -- (-2292.738) [-2289.531] (-2293.999) (-2293.591) * (-2291.003) (-2293.215) (-2294.119) [-2291.842] -- 0:01:02
      162500 -- (-2293.589) (-2291.360) (-2293.389) [-2294.732] * (-2289.936) [-2294.692] (-2292.481) (-2293.532) -- 0:01:01
      163000 -- (-2290.615) (-2288.720) [-2294.494] (-2291.978) * [-2290.576] (-2292.214) (-2293.986) (-2293.612) -- 0:01:01
      163500 -- (-2292.222) [-2290.012] (-2294.565) (-2292.231) * (-2292.298) [-2291.624] (-2293.283) (-2293.113) -- 0:01:01
      164000 -- (-2291.976) (-2292.302) [-2293.538] (-2296.794) * [-2289.351] (-2293.114) (-2292.666) (-2293.085) -- 0:01:01
      164500 -- (-2292.203) (-2292.573) (-2296.561) [-2293.069] * [-2291.832] (-2290.667) (-2294.545) (-2293.003) -- 0:01:00
      165000 -- (-2290.816) (-2290.591) (-2298.909) [-2293.628] * [-2289.838] (-2292.968) (-2294.166) (-2291.631) -- 0:01:05

      Average standard deviation of split frequencies: 0.020925

      165500 -- (-2292.502) (-2290.767) (-2294.847) [-2291.323] * (-2291.581) [-2293.213] (-2293.565) (-2293.719) -- 0:01:05
      166000 -- (-2291.317) [-2292.531] (-2292.783) (-2293.992) * [-2291.717] (-2293.053) (-2292.675) (-2293.099) -- 0:01:05
      166500 -- (-2292.337) (-2290.581) [-2293.738] (-2292.761) * (-2293.354) [-2288.368] (-2294.610) (-2299.574) -- 0:01:05
      167000 -- [-2291.750] (-2294.315) (-2292.144) (-2295.466) * (-2292.242) [-2293.593] (-2295.316) (-2295.869) -- 0:01:04
      167500 -- (-2292.421) (-2292.994) [-2292.225] (-2297.886) * (-2292.321) (-2294.672) [-2294.541] (-2296.017) -- 0:01:04
      168000 -- [-2290.480] (-2292.582) (-2290.499) (-2298.812) * [-2292.325] (-2293.065) (-2295.761) (-2295.820) -- 0:01:04
      168500 -- (-2291.869) (-2293.855) [-2292.553] (-2299.379) * (-2292.993) [-2293.421] (-2291.556) (-2292.618) -- 0:01:04
      169000 -- [-2291.005] (-2298.878) (-2294.560) (-2298.278) * (-2292.322) (-2292.476) [-2296.712] (-2292.182) -- 0:01:03
      169500 -- (-2293.127) [-2296.302] (-2294.632) (-2296.693) * (-2292.494) (-2294.846) (-2296.755) [-2294.275] -- 0:01:03
      170000 -- [-2293.807] (-2292.948) (-2292.551) (-2294.397) * [-2292.433] (-2300.585) (-2297.106) (-2292.194) -- 0:01:03

      Average standard deviation of split frequencies: 0.020854

      170500 -- [-2295.124] (-2291.936) (-2292.531) (-2293.656) * [-2294.129] (-2296.756) (-2294.985) (-2291.043) -- 0:01:03
      171000 -- (-2291.409) (-2292.385) [-2292.878] (-2293.360) * [-2295.017] (-2292.665) (-2294.854) (-2296.472) -- 0:01:03
      171500 -- (-2293.657) (-2295.152) (-2293.506) [-2293.390] * [-2290.421] (-2290.380) (-2297.883) (-2294.080) -- 0:01:02
      172000 -- (-2293.005) [-2293.990] (-2293.767) (-2289.295) * [-2295.040] (-2290.517) (-2294.052) (-2290.899) -- 0:01:02
      172500 -- (-2294.714) [-2293.573] (-2296.945) (-2292.443) * (-2292.112) [-2290.962] (-2298.140) (-2291.677) -- 0:01:02
      173000 -- (-2292.534) [-2294.112] (-2292.272) (-2292.719) * (-2299.694) (-2289.698) [-2295.721] (-2295.202) -- 0:01:02
      173500 -- (-2294.793) [-2292.985] (-2295.949) (-2295.331) * [-2291.165] (-2289.738) (-2296.178) (-2294.048) -- 0:01:01
      174000 -- (-2292.557) (-2291.077) (-2292.484) [-2297.184] * (-2289.939) (-2290.663) [-2295.107] (-2293.325) -- 0:01:01
      174500 -- (-2293.976) (-2290.892) (-2292.560) [-2294.568] * [-2290.711] (-2295.451) (-2294.162) (-2295.966) -- 0:01:01
      175000 -- [-2293.645] (-2294.164) (-2291.581) (-2290.511) * [-2290.782] (-2296.970) (-2293.121) (-2298.364) -- 0:01:01

      Average standard deviation of split frequencies: 0.021850

      175500 -- (-2293.649) [-2290.858] (-2291.088) (-2290.015) * [-2290.877] (-2291.656) (-2296.642) (-2295.726) -- 0:01:01
      176000 -- (-2293.593) [-2290.337] (-2291.738) (-2292.693) * (-2291.383) (-2293.404) (-2293.075) [-2291.090] -- 0:01:00
      176500 -- (-2293.239) (-2293.600) (-2291.587) [-2292.641] * (-2292.623) (-2291.019) [-2292.328] (-2291.624) -- 0:01:00
      177000 -- (-2293.229) [-2292.593] (-2291.523) (-2292.192) * [-2293.113] (-2295.584) (-2293.288) (-2293.718) -- 0:01:00
      177500 -- (-2292.929) [-2296.054] (-2297.081) (-2295.696) * (-2292.307) [-2294.643] (-2291.134) (-2288.910) -- 0:01:00
      178000 -- (-2294.888) (-2294.017) [-2295.371] (-2293.620) * (-2292.822) [-2294.847] (-2296.938) (-2290.062) -- 0:01:00
      178500 -- (-2292.664) (-2295.672) (-2296.379) [-2290.462] * (-2290.265) [-2294.344] (-2291.823) (-2290.804) -- 0:00:59
      179000 -- (-2292.680) (-2298.953) (-2294.337) [-2292.870] * (-2290.157) (-2295.598) [-2290.409] (-2291.754) -- 0:01:04
      179500 -- (-2295.431) (-2293.531) (-2293.659) [-2291.839] * (-2293.956) (-2291.810) [-2290.799] (-2292.235) -- 0:01:03
      180000 -- [-2294.211] (-2288.796) (-2292.075) (-2290.669) * (-2292.429) [-2292.659] (-2300.830) (-2291.408) -- 0:01:03

      Average standard deviation of split frequencies: 0.021423

      180500 -- (-2293.772) [-2291.561] (-2297.639) (-2293.764) * [-2292.753] (-2291.399) (-2292.251) (-2293.253) -- 0:01:03
      181000 -- (-2293.429) (-2298.171) (-2292.911) [-2292.029] * (-2293.030) (-2295.406) [-2291.779] (-2294.419) -- 0:01:03
      181500 -- (-2294.064) (-2293.085) [-2292.397] (-2294.982) * (-2292.332) [-2293.454] (-2292.443) (-2294.782) -- 0:01:03
      182000 -- (-2292.741) [-2292.113] (-2292.962) (-2293.898) * (-2290.082) (-2296.304) (-2294.144) [-2291.406] -- 0:01:02
      182500 -- (-2294.560) (-2293.455) [-2293.815] (-2293.086) * [-2289.368] (-2297.872) (-2292.165) (-2293.193) -- 0:01:02
      183000 -- (-2293.496) (-2295.715) (-2293.846) [-2291.668] * (-2293.267) [-2296.039] (-2296.110) (-2294.777) -- 0:01:02
      183500 -- (-2293.798) [-2293.048] (-2293.234) (-2291.232) * [-2289.988] (-2292.834) (-2295.436) (-2295.749) -- 0:01:02
      184000 -- (-2293.798) [-2293.602] (-2291.342) (-2290.236) * (-2293.810) [-2292.752] (-2292.413) (-2297.965) -- 0:01:02
      184500 -- (-2300.453) (-2296.053) (-2295.995) [-2294.664] * (-2292.500) (-2293.475) (-2295.756) [-2295.489] -- 0:01:01
      185000 -- [-2298.199] (-2302.330) (-2294.054) (-2296.112) * [-2291.535] (-2293.218) (-2291.832) (-2290.816) -- 0:01:01

      Average standard deviation of split frequencies: 0.021076

      185500 -- [-2291.922] (-2293.400) (-2291.246) (-2293.735) * [-2292.636] (-2292.475) (-2292.776) (-2297.622) -- 0:01:01
      186000 -- (-2295.620) (-2290.502) [-2292.717] (-2294.078) * (-2294.382) (-2292.439) [-2291.761] (-2290.697) -- 0:01:01
      186500 -- (-2296.234) (-2289.682) [-2294.703] (-2293.603) * (-2294.937) [-2294.889] (-2296.345) (-2295.123) -- 0:01:01
      187000 -- (-2294.693) (-2292.481) [-2293.677] (-2295.177) * (-2294.710) (-2294.019) [-2291.600] (-2295.426) -- 0:01:00
      187500 -- (-2296.775) (-2294.050) (-2293.666) [-2290.582] * (-2291.075) [-2292.773] (-2291.801) (-2289.118) -- 0:01:00
      188000 -- (-2293.925) [-2295.045] (-2293.199) (-2292.209) * (-2289.144) (-2297.466) [-2290.702] (-2292.587) -- 0:01:00
      188500 -- (-2294.983) (-2294.303) [-2291.894] (-2289.965) * (-2292.705) [-2297.586] (-2293.624) (-2295.522) -- 0:01:00
      189000 -- (-2294.666) (-2293.478) (-2296.935) [-2289.709] * (-2292.511) (-2294.999) [-2291.169] (-2295.960) -- 0:01:00
      189500 -- (-2294.188) [-2293.753] (-2292.044) (-2292.389) * [-2292.224] (-2293.832) (-2291.865) (-2300.362) -- 0:00:59
      190000 -- (-2290.333) (-2293.074) (-2293.301) [-2291.399] * (-2293.520) (-2293.027) [-2291.465] (-2293.306) -- 0:00:59

      Average standard deviation of split frequencies: 0.021991

      190500 -- (-2292.390) (-2292.677) [-2291.842] (-2292.263) * [-2291.055] (-2293.171) (-2292.902) (-2291.460) -- 0:00:59
      191000 -- (-2294.801) (-2294.345) (-2295.786) [-2291.900] * [-2293.587] (-2293.512) (-2292.500) (-2293.392) -- 0:00:59
      191500 -- (-2295.712) (-2293.002) [-2292.785] (-2290.606) * (-2292.905) (-2293.430) [-2290.743] (-2293.313) -- 0:00:59
      192000 -- (-2296.441) (-2290.798) (-2291.944) [-2290.978] * (-2292.854) [-2293.054] (-2291.408) (-2294.763) -- 0:00:58
      192500 -- (-2300.341) (-2295.665) [-2292.383] (-2292.710) * (-2291.453) [-2294.678] (-2292.343) (-2295.288) -- 0:01:02
      193000 -- (-2294.062) [-2291.762] (-2294.643) (-2292.422) * [-2290.910] (-2296.222) (-2291.840) (-2292.409) -- 0:01:02
      193500 -- [-2291.440] (-2292.302) (-2291.883) (-2289.638) * (-2288.895) (-2294.082) (-2292.628) [-2291.136] -- 0:01:02
      194000 -- (-2292.671) (-2292.007) [-2290.510] (-2290.136) * [-2291.379] (-2295.416) (-2293.662) (-2294.582) -- 0:01:02
      194500 -- (-2290.983) (-2292.729) [-2290.488] (-2291.562) * [-2290.987] (-2295.708) (-2292.760) (-2296.758) -- 0:01:02
      195000 -- (-2292.961) (-2292.268) (-2293.316) [-2292.500] * [-2293.063] (-2296.546) (-2291.521) (-2299.671) -- 0:01:01

      Average standard deviation of split frequencies: 0.021140

      195500 -- [-2290.888] (-2288.767) (-2288.553) (-2294.755) * [-2289.698] (-2295.478) (-2290.604) (-2294.331) -- 0:01:01
      196000 -- (-2289.065) (-2291.048) [-2291.212] (-2293.301) * (-2290.917) (-2298.772) (-2294.563) [-2293.244] -- 0:01:01
      196500 -- (-2292.642) [-2290.830] (-2290.422) (-2297.392) * (-2292.533) [-2294.101] (-2291.677) (-2294.449) -- 0:01:01
      197000 -- (-2291.977) (-2295.346) (-2290.844) [-2296.129] * [-2290.411] (-2293.738) (-2292.117) (-2293.590) -- 0:01:01
      197500 -- (-2296.432) (-2294.505) [-2290.957] (-2293.058) * (-2292.658) (-2294.020) (-2293.300) [-2295.612] -- 0:01:00
      198000 -- (-2293.727) (-2292.169) [-2289.590] (-2291.022) * (-2292.295) (-2293.948) (-2293.077) [-2292.977] -- 0:01:00
      198500 -- (-2292.705) (-2290.718) [-2291.439] (-2290.999) * (-2291.048) [-2297.216] (-2291.415) (-2292.024) -- 0:01:00
      199000 -- (-2292.748) (-2292.365) [-2288.943] (-2291.797) * (-2293.266) [-2297.599] (-2292.536) (-2291.451) -- 0:01:00
      199500 -- (-2292.318) (-2292.182) [-2294.630] (-2290.502) * (-2290.048) [-2295.297] (-2290.720) (-2293.522) -- 0:01:00
      200000 -- (-2293.073) [-2293.962] (-2293.035) (-2288.994) * (-2289.679) (-2291.458) [-2291.255] (-2293.065) -- 0:00:59

      Average standard deviation of split frequencies: 0.020154

      200500 -- (-2295.500) (-2295.816) (-2290.816) [-2291.034] * (-2289.179) (-2292.889) (-2290.355) [-2290.941] -- 0:00:59
      201000 -- (-2295.279) [-2292.034] (-2292.923) (-2290.903) * (-2293.068) (-2297.106) [-2292.072] (-2291.851) -- 0:00:59
      201500 -- (-2295.868) (-2291.616) (-2291.749) [-2290.858] * (-2290.930) [-2292.628] (-2290.979) (-2292.971) -- 0:00:59
      202000 -- (-2293.939) (-2294.040) [-2290.102] (-2289.753) * (-2289.867) [-2292.340] (-2294.171) (-2291.186) -- 0:00:59
      202500 -- (-2289.893) (-2292.023) [-2294.180] (-2292.900) * (-2291.846) (-2293.041) (-2293.527) [-2290.110] -- 0:00:59
      203000 -- (-2295.170) (-2298.176) (-2295.939) [-2294.232] * (-2293.748) (-2291.369) [-2293.749] (-2293.336) -- 0:00:58
      203500 -- (-2294.906) (-2294.654) (-2294.715) [-2293.563] * (-2290.435) [-2294.183] (-2292.075) (-2291.888) -- 0:00:58
      204000 -- (-2291.850) [-2292.146] (-2292.383) (-2292.791) * (-2291.213) (-2294.523) (-2295.531) [-2290.920] -- 0:00:58
      204500 -- (-2292.979) [-2293.209] (-2290.671) (-2293.610) * (-2296.994) (-2299.379) (-2290.742) [-2289.749] -- 0:00:58
      205000 -- (-2292.842) [-2290.856] (-2291.087) (-2293.760) * (-2290.376) [-2295.431] (-2291.269) (-2294.747) -- 0:00:58

      Average standard deviation of split frequencies: 0.021438

      205500 -- (-2290.643) (-2291.087) [-2293.305] (-2295.127) * (-2291.698) (-2296.954) (-2293.641) [-2292.716] -- 0:00:57
      206000 -- (-2291.440) [-2289.386] (-2291.915) (-2293.172) * (-2291.790) (-2295.381) [-2294.233] (-2290.407) -- 0:01:01
      206500 -- (-2291.103) [-2290.618] (-2290.960) (-2293.628) * [-2294.292] (-2295.143) (-2293.297) (-2290.897) -- 0:01:01
      207000 -- (-2291.425) (-2290.197) (-2289.774) [-2292.934] * [-2289.470] (-2292.784) (-2294.576) (-2291.718) -- 0:01:01
      207500 -- (-2292.231) [-2291.672] (-2289.728) (-2290.089) * (-2289.988) (-2294.278) (-2291.858) [-2293.034] -- 0:01:01
      208000 -- [-2292.214] (-2296.919) (-2288.219) (-2294.470) * [-2289.526] (-2291.697) (-2290.492) (-2292.153) -- 0:01:00
      208500 -- (-2292.715) (-2292.645) (-2289.954) [-2298.642] * (-2290.589) (-2293.254) (-2290.358) [-2291.503] -- 0:01:00
      209000 -- [-2289.705] (-2298.037) (-2293.606) (-2296.667) * [-2294.990] (-2292.500) (-2292.110) (-2292.371) -- 0:01:00
      209500 -- (-2291.517) [-2290.698] (-2290.830) (-2293.279) * [-2290.298] (-2292.500) (-2289.604) (-2292.215) -- 0:01:00
      210000 -- [-2295.009] (-2297.396) (-2291.697) (-2292.032) * (-2290.720) (-2290.604) [-2291.634] (-2294.438) -- 0:01:00

      Average standard deviation of split frequencies: 0.019315

      210500 -- (-2292.930) (-2291.812) (-2291.201) [-2292.004] * (-2290.611) (-2295.950) [-2291.510] (-2292.744) -- 0:01:00
      211000 -- (-2293.200) (-2290.592) [-2288.888] (-2293.914) * [-2291.408] (-2295.564) (-2291.204) (-2291.106) -- 0:00:59
      211500 -- (-2293.713) (-2290.930) [-2290.111] (-2291.515) * (-2288.911) [-2292.851] (-2295.524) (-2293.742) -- 0:00:59
      212000 -- (-2294.262) (-2289.760) (-2292.757) [-2293.815] * [-2290.213] (-2291.503) (-2294.377) (-2297.507) -- 0:00:59
      212500 -- [-2292.505] (-2293.116) (-2292.492) (-2292.256) * [-2289.284] (-2291.401) (-2293.153) (-2294.267) -- 0:00:59
      213000 -- (-2293.897) (-2292.593) [-2292.244] (-2297.580) * (-2291.072) (-2294.168) [-2291.199] (-2295.720) -- 0:00:59
      213500 -- (-2291.662) (-2291.230) (-2292.528) [-2290.846] * (-2293.140) (-2293.670) (-2292.684) [-2293.778] -- 0:00:58
      214000 -- (-2293.922) [-2290.871] (-2293.227) (-2293.286) * [-2290.275] (-2293.639) (-2294.117) (-2293.204) -- 0:00:58
      214500 -- [-2294.300] (-2290.381) (-2295.104) (-2292.552) * (-2290.947) (-2293.085) (-2294.754) [-2293.808] -- 0:00:58
      215000 -- (-2292.625) (-2289.273) (-2288.896) [-2292.212] * (-2292.918) (-2292.458) (-2297.121) [-2292.572] -- 0:00:58

      Average standard deviation of split frequencies: 0.018723

      215500 -- (-2295.415) (-2289.796) [-2289.326] (-2290.868) * (-2295.209) [-2294.465] (-2294.363) (-2293.922) -- 0:00:58
      216000 -- (-2294.571) (-2290.277) [-2290.767] (-2293.562) * (-2290.167) [-2290.790] (-2291.714) (-2296.132) -- 0:00:58
      216500 -- (-2293.824) (-2289.663) [-2291.195] (-2294.421) * (-2292.589) (-2289.802) [-2289.729] (-2294.012) -- 0:00:57
      217000 -- [-2290.156] (-2294.418) (-2296.038) (-2295.933) * (-2293.084) [-2290.091] (-2289.890) (-2299.242) -- 0:00:57
      217500 -- [-2291.297] (-2295.444) (-2290.743) (-2292.269) * (-2292.978) (-2294.733) [-2290.407] (-2293.386) -- 0:00:57
      218000 -- (-2291.731) (-2294.412) [-2291.145] (-2294.690) * [-2293.480] (-2292.498) (-2291.528) (-2291.970) -- 0:00:57
      218500 -- (-2292.586) [-2292.672] (-2291.879) (-2291.332) * [-2292.319] (-2293.352) (-2297.666) (-2296.365) -- 0:00:57
      219000 -- (-2292.445) (-2292.664) (-2301.830) [-2292.700] * (-2292.888) (-2293.250) (-2291.971) [-2294.081] -- 0:00:57
      219500 -- (-2297.828) [-2292.452] (-2299.344) (-2297.571) * (-2292.922) [-2290.234] (-2292.939) (-2291.093) -- 0:00:56
      220000 -- (-2295.405) [-2293.739] (-2297.011) (-2292.797) * (-2292.058) (-2291.015) [-2291.227] (-2294.290) -- 0:01:00

      Average standard deviation of split frequencies: 0.018327

      220500 -- (-2295.368) [-2294.247] (-2290.892) (-2292.587) * (-2295.826) (-2293.578) [-2290.628] (-2293.295) -- 0:01:00
      221000 -- [-2295.246] (-2291.165) (-2290.598) (-2293.880) * [-2291.802] (-2290.297) (-2290.325) (-2291.149) -- 0:00:59
      221500 -- [-2293.429] (-2295.273) (-2290.241) (-2291.846) * (-2290.822) (-2290.771) (-2292.310) [-2290.822] -- 0:00:59
      222000 -- (-2293.303) (-2293.294) (-2292.861) [-2291.220] * [-2291.076] (-2292.270) (-2293.525) (-2289.860) -- 0:00:59
      222500 -- [-2295.046] (-2293.377) (-2296.799) (-2292.962) * (-2292.513) [-2291.102] (-2293.905) (-2289.672) -- 0:00:59
      223000 -- (-2294.428) (-2292.812) (-2292.069) [-2290.639] * (-2293.789) (-2292.899) [-2292.313] (-2294.248) -- 0:00:59
      223500 -- (-2292.358) [-2292.944] (-2290.461) (-2294.781) * (-2289.565) (-2292.804) (-2292.631) [-2293.271] -- 0:00:59
      224000 -- [-2293.288] (-2294.415) (-2291.352) (-2292.736) * (-2294.850) [-2293.418] (-2289.819) (-2291.315) -- 0:00:58
      224500 -- (-2290.992) [-2295.357] (-2292.888) (-2293.467) * [-2293.004] (-2293.104) (-2290.781) (-2291.272) -- 0:00:58
      225000 -- (-2291.099) [-2292.421] (-2292.038) (-2294.156) * [-2292.581] (-2293.438) (-2291.004) (-2292.857) -- 0:00:58

      Average standard deviation of split frequencies: 0.017894

      225500 -- (-2289.672) (-2294.521) (-2294.340) [-2293.459] * (-2292.860) (-2290.107) [-2290.799] (-2294.160) -- 0:00:58
      226000 -- (-2291.274) (-2298.202) (-2294.229) [-2290.409] * (-2290.349) (-2293.580) [-2290.842] (-2293.921) -- 0:00:58
      226500 -- (-2289.960) (-2293.620) [-2291.422] (-2297.704) * (-2289.779) (-2293.836) [-2291.178] (-2293.256) -- 0:00:58
      227000 -- (-2291.152) [-2291.184] (-2292.336) (-2294.939) * (-2291.461) (-2295.266) (-2292.717) [-2293.407] -- 0:00:57
      227500 -- (-2291.201) [-2291.392] (-2292.428) (-2290.899) * [-2290.646] (-2292.577) (-2292.147) (-2290.748) -- 0:00:57
      228000 -- [-2291.079] (-2292.555) (-2291.482) (-2293.665) * (-2290.035) (-2292.543) (-2294.196) [-2291.732] -- 0:00:57
      228500 -- (-2291.845) (-2293.769) (-2292.308) [-2291.875] * [-2291.178] (-2293.140) (-2293.148) (-2291.864) -- 0:00:57
      229000 -- (-2291.026) [-2293.886] (-2291.733) (-2291.142) * (-2291.750) [-2295.730] (-2293.344) (-2292.862) -- 0:00:57
      229500 -- (-2291.083) [-2290.532] (-2297.979) (-2293.753) * [-2290.465] (-2293.553) (-2293.642) (-2291.733) -- 0:00:57
      230000 -- (-2290.555) (-2290.518) [-2296.536] (-2295.237) * (-2293.227) (-2293.131) [-2291.417] (-2293.448) -- 0:00:56

      Average standard deviation of split frequencies: 0.018393

      230500 -- [-2289.926] (-2291.908) (-2293.156) (-2291.979) * (-2294.298) (-2294.668) (-2291.466) [-2291.489] -- 0:00:56
      231000 -- (-2290.700) [-2291.617] (-2295.647) (-2294.260) * [-2295.228] (-2294.200) (-2292.205) (-2290.668) -- 0:00:56
      231500 -- (-2291.172) [-2296.059] (-2295.111) (-2295.209) * (-2290.723) [-2292.684] (-2295.350) (-2291.798) -- 0:00:56
      232000 -- (-2291.305) (-2296.024) [-2292.797] (-2294.171) * (-2292.205) (-2298.390) (-2292.916) [-2290.443] -- 0:00:56
      232500 -- (-2290.880) (-2295.158) [-2291.919] (-2292.413) * (-2298.993) (-2292.990) (-2294.212) [-2290.837] -- 0:00:56
      233000 -- [-2289.825] (-2294.910) (-2290.801) (-2292.451) * [-2295.814] (-2298.545) (-2294.244) (-2291.191) -- 0:00:55
      233500 -- (-2289.268) (-2294.176) [-2289.796] (-2292.751) * [-2290.270] (-2296.463) (-2291.875) (-2291.309) -- 0:00:55
      234000 -- [-2289.712] (-2292.670) (-2292.491) (-2292.538) * (-2292.232) (-2293.186) [-2290.587] (-2292.595) -- 0:00:58
      234500 -- [-2289.887] (-2294.309) (-2296.552) (-2294.218) * (-2291.135) (-2293.602) [-2290.694] (-2291.550) -- 0:00:58
      235000 -- (-2292.858) (-2292.829) (-2294.208) [-2295.590] * [-2290.127] (-2291.008) (-2291.275) (-2291.415) -- 0:00:58

      Average standard deviation of split frequencies: 0.016400

      235500 -- (-2291.667) [-2290.775] (-2295.071) (-2295.101) * (-2294.479) [-2291.672] (-2293.190) (-2290.531) -- 0:00:58
      236000 -- (-2289.942) (-2292.259) [-2290.914] (-2293.009) * (-2292.371) (-2293.438) (-2295.531) [-2292.101] -- 0:00:58
      236500 -- [-2290.920] (-2293.236) (-2292.769) (-2294.111) * (-2291.893) (-2294.925) [-2290.935] (-2291.957) -- 0:00:58
      237000 -- (-2289.810) [-2292.824] (-2293.500) (-2291.598) * (-2297.947) [-2296.992] (-2293.716) (-2290.426) -- 0:00:57
      237500 -- (-2289.651) (-2291.541) [-2293.701] (-2293.440) * [-2295.123] (-2290.976) (-2291.177) (-2292.169) -- 0:00:57
      238000 -- [-2287.987] (-2292.698) (-2295.545) (-2292.722) * [-2290.746] (-2292.165) (-2289.968) (-2293.970) -- 0:00:57
      238500 -- [-2288.950] (-2292.407) (-2294.488) (-2292.416) * [-2290.888] (-2291.755) (-2292.368) (-2292.813) -- 0:00:57
      239000 -- (-2292.953) (-2295.513) [-2296.152] (-2290.058) * (-2291.863) (-2295.231) (-2292.681) [-2296.693] -- 0:00:57
      239500 -- (-2289.541) (-2290.948) (-2291.648) [-2295.358] * (-2290.950) (-2293.133) [-2290.790] (-2293.419) -- 0:00:57
      240000 -- (-2289.839) (-2290.156) [-2292.967] (-2297.002) * (-2294.350) (-2291.177) (-2292.627) [-2293.932] -- 0:00:56

      Average standard deviation of split frequencies: 0.015464

      240500 -- (-2291.426) (-2291.558) [-2291.741] (-2296.767) * (-2295.367) (-2292.169) [-2291.671] (-2291.921) -- 0:00:56
      241000 -- [-2288.952] (-2292.626) (-2291.652) (-2294.254) * (-2298.191) (-2292.613) [-2293.381] (-2292.526) -- 0:00:56
      241500 -- (-2290.338) (-2295.728) (-2293.521) [-2291.844] * [-2294.384] (-2291.224) (-2290.453) (-2293.250) -- 0:00:56
      242000 -- (-2296.260) [-2291.078] (-2294.382) (-2292.170) * (-2293.715) (-2293.075) [-2290.001] (-2293.563) -- 0:00:56
      242500 -- (-2295.066) (-2292.823) (-2293.149) [-2292.933] * (-2293.591) (-2292.810) [-2294.715] (-2295.372) -- 0:00:56
      243000 -- [-2292.610] (-2292.065) (-2292.944) (-2295.410) * (-2294.208) [-2292.589] (-2291.021) (-2291.335) -- 0:00:56
      243500 -- (-2291.871) [-2291.183] (-2292.121) (-2295.337) * (-2296.210) (-2291.027) (-2292.550) [-2291.452] -- 0:00:55
      244000 -- [-2296.174] (-2291.655) (-2294.490) (-2293.879) * (-2293.631) (-2291.736) [-2292.577] (-2296.137) -- 0:00:55
      244500 -- (-2290.936) [-2290.516] (-2298.456) (-2302.768) * (-2293.087) (-2293.337) [-2294.495] (-2295.531) -- 0:00:55
      245000 -- (-2292.498) (-2293.556) (-2293.363) [-2295.966] * [-2291.299] (-2292.018) (-2295.267) (-2294.979) -- 0:00:55

      Average standard deviation of split frequencies: 0.015028

      245500 -- [-2291.929] (-2294.820) (-2293.247) (-2290.162) * (-2294.337) (-2290.864) (-2295.275) [-2292.328] -- 0:00:55
      246000 -- (-2289.307) (-2291.738) (-2292.207) [-2289.880] * (-2294.816) (-2293.500) (-2294.087) [-2289.318] -- 0:00:55
      246500 -- [-2293.058] (-2292.137) (-2296.121) (-2290.275) * (-2293.884) (-2294.895) [-2295.296] (-2301.183) -- 0:00:58
      247000 -- (-2292.104) (-2293.396) [-2294.319] (-2290.902) * [-2292.552] (-2289.660) (-2298.406) (-2295.364) -- 0:00:57
      247500 -- [-2292.049] (-2295.453) (-2296.243) (-2289.877) * [-2288.813] (-2291.793) (-2297.039) (-2294.902) -- 0:00:57
      248000 -- (-2292.384) [-2290.967] (-2293.563) (-2291.128) * (-2294.069) [-2291.291] (-2295.371) (-2290.945) -- 0:00:57
      248500 -- (-2294.412) (-2291.627) (-2294.067) [-2292.930] * (-2294.346) [-2290.031] (-2293.564) (-2293.267) -- 0:00:57
      249000 -- (-2293.095) [-2290.665] (-2293.951) (-2293.996) * (-2290.382) [-2294.291] (-2292.077) (-2295.208) -- 0:00:57
      249500 -- (-2293.268) (-2292.769) [-2293.345] (-2291.573) * (-2292.618) [-2292.227] (-2291.782) (-2294.849) -- 0:00:57
      250000 -- (-2293.822) (-2289.497) (-2296.229) [-2294.723] * [-2290.215] (-2291.365) (-2291.622) (-2291.358) -- 0:00:57

      Average standard deviation of split frequencies: 0.015837

      250500 -- (-2291.949) (-2291.466) (-2296.639) [-2291.680] * (-2289.573) (-2293.919) (-2294.325) [-2294.584] -- 0:00:56
      251000 -- (-2293.670) (-2289.127) (-2294.823) [-2290.347] * (-2292.351) [-2293.667] (-2295.196) (-2294.642) -- 0:00:56
      251500 -- (-2296.885) [-2289.867] (-2293.524) (-2293.927) * (-2294.963) [-2292.780] (-2291.978) (-2290.041) -- 0:00:56
      252000 -- (-2292.493) [-2288.685] (-2292.729) (-2292.924) * (-2290.458) (-2296.406) (-2292.749) [-2292.165] -- 0:00:56
      252500 -- (-2292.555) (-2290.198) [-2293.314] (-2292.544) * (-2291.462) [-2299.428] (-2290.495) (-2292.761) -- 0:00:56
      253000 -- (-2294.835) (-2296.699) (-2292.728) [-2292.676] * (-2290.038) (-2296.251) [-2293.461] (-2289.806) -- 0:00:56
      253500 -- [-2293.306] (-2294.306) (-2293.535) (-2290.981) * (-2289.774) (-2298.597) (-2292.042) [-2292.456] -- 0:00:55
      254000 -- [-2292.879] (-2294.432) (-2294.273) (-2292.599) * (-2295.047) (-2294.530) (-2291.748) [-2290.628] -- 0:00:55
      254500 -- (-2292.398) (-2293.869) (-2295.179) [-2292.429] * [-2293.520] (-2295.717) (-2294.250) (-2291.190) -- 0:00:55
      255000 -- [-2291.587] (-2296.461) (-2294.782) (-2294.414) * [-2293.184] (-2296.124) (-2295.865) (-2292.276) -- 0:00:55

      Average standard deviation of split frequencies: 0.016960

      255500 -- (-2293.297) [-2293.869] (-2293.848) (-2291.742) * (-2292.421) (-2294.858) [-2295.605] (-2290.411) -- 0:00:55
      256000 -- (-2293.260) (-2294.832) (-2293.690) [-2290.668] * (-2292.805) (-2292.469) [-2293.446] (-2290.866) -- 0:00:55
      256500 -- [-2292.105] (-2295.472) (-2294.587) (-2292.464) * (-2292.520) (-2297.876) [-2296.969] (-2291.666) -- 0:00:55
      257000 -- (-2293.070) [-2290.893] (-2297.014) (-2290.217) * (-2294.314) [-2294.710] (-2293.234) (-2289.372) -- 0:00:54
      257500 -- [-2292.161] (-2291.437) (-2297.065) (-2291.857) * (-2290.872) (-2293.521) [-2290.389] (-2294.774) -- 0:00:54
      258000 -- (-2293.381) [-2291.981] (-2293.700) (-2292.731) * [-2293.626] (-2294.750) (-2292.863) (-2294.925) -- 0:00:54
      258500 -- (-2290.876) (-2295.621) (-2292.020) [-2293.983] * (-2296.430) (-2292.158) (-2289.298) [-2290.871] -- 0:00:57
      259000 -- (-2290.255) (-2293.144) [-2292.769] (-2288.989) * (-2295.869) (-2291.519) (-2294.386) [-2293.381] -- 0:00:57
      259500 -- [-2291.600] (-2292.138) (-2294.069) (-2293.435) * (-2294.334) (-2292.725) [-2293.113] (-2292.608) -- 0:00:57
      260000 -- (-2293.178) [-2292.652] (-2295.186) (-2297.940) * (-2295.646) (-2294.801) [-2291.924] (-2294.754) -- 0:00:56

      Average standard deviation of split frequencies: 0.015372

      260500 -- [-2290.475] (-2290.809) (-2295.226) (-2292.858) * [-2292.453] (-2290.498) (-2292.668) (-2289.887) -- 0:00:56
      261000 -- [-2289.951] (-2291.204) (-2291.108) (-2292.862) * [-2293.610] (-2291.539) (-2294.146) (-2289.185) -- 0:00:56
      261500 -- (-2293.221) (-2291.532) [-2294.624] (-2298.129) * (-2294.429) (-2291.569) [-2293.758] (-2292.409) -- 0:00:56
      262000 -- (-2292.006) (-2292.430) (-2290.775) [-2296.258] * (-2294.952) (-2293.823) [-2291.612] (-2294.692) -- 0:00:56
      262500 -- (-2290.576) (-2298.266) (-2291.112) [-2292.244] * (-2292.977) (-2293.475) [-2289.196] (-2294.058) -- 0:00:56
      263000 -- (-2293.551) (-2296.828) (-2293.043) [-2290.689] * (-2290.446) (-2293.370) [-2290.941] (-2293.898) -- 0:00:56
      263500 -- (-2293.997) (-2291.179) [-2293.097] (-2293.646) * (-2291.034) (-2290.233) (-2295.539) [-2291.083] -- 0:00:55
      264000 -- [-2296.650] (-2290.696) (-2292.304) (-2293.290) * (-2289.678) (-2292.517) (-2297.774) [-2291.779] -- 0:00:55
      264500 -- (-2295.073) (-2291.089) (-2289.005) [-2292.107] * (-2290.169) (-2291.727) [-2294.260] (-2291.535) -- 0:00:55
      265000 -- (-2294.500) [-2291.946] (-2293.815) (-2291.256) * (-2293.531) (-2293.802) (-2296.572) [-2295.358] -- 0:00:55

      Average standard deviation of split frequencies: 0.016230

      265500 -- (-2293.656) [-2290.507] (-2293.578) (-2294.985) * (-2293.584) (-2291.506) [-2294.053] (-2291.991) -- 0:00:55
      266000 -- [-2292.594] (-2291.590) (-2293.659) (-2295.839) * [-2293.859] (-2291.469) (-2294.660) (-2292.694) -- 0:00:55
      266500 -- (-2292.066) (-2294.278) (-2293.876) [-2291.268] * (-2293.691) [-2296.257] (-2294.326) (-2299.415) -- 0:00:55
      267000 -- [-2291.317] (-2292.115) (-2291.690) (-2294.702) * [-2293.765] (-2290.930) (-2291.150) (-2289.988) -- 0:00:54
      267500 -- (-2292.205) [-2289.801] (-2294.684) (-2293.875) * [-2294.084] (-2291.422) (-2296.032) (-2291.895) -- 0:00:54
      268000 -- (-2292.023) (-2292.478) [-2292.672] (-2296.219) * (-2293.812) (-2290.236) (-2293.481) [-2291.873] -- 0:00:54
      268500 -- (-2293.395) (-2295.002) (-2294.275) [-2291.424] * [-2290.580] (-2294.226) (-2292.655) (-2292.840) -- 0:00:54
      269000 -- [-2292.830] (-2292.800) (-2295.250) (-2290.735) * (-2294.574) (-2292.904) [-2291.590] (-2296.979) -- 0:00:54
      269500 -- (-2292.478) [-2291.982] (-2293.180) (-2291.732) * [-2295.455] (-2293.397) (-2291.905) (-2298.440) -- 0:00:54
      270000 -- (-2296.860) (-2291.637) (-2296.174) [-2289.151] * (-2294.426) (-2291.424) [-2291.265] (-2293.271) -- 0:00:54

      Average standard deviation of split frequencies: 0.015400

      270500 -- (-2293.625) (-2291.557) [-2294.922] (-2293.243) * (-2299.182) [-2291.803] (-2294.089) (-2293.423) -- 0:00:53
      271000 -- [-2291.512] (-2291.031) (-2294.717) (-2293.677) * (-2296.038) [-2289.597] (-2293.252) (-2293.770) -- 0:00:53
      271500 -- (-2294.155) (-2291.499) [-2291.410] (-2293.302) * (-2298.931) [-2290.261] (-2298.188) (-2292.940) -- 0:00:56
      272000 -- (-2295.483) (-2296.215) [-2289.243] (-2293.035) * (-2295.476) (-2292.280) (-2295.823) [-2291.590] -- 0:00:56
      272500 -- [-2296.309] (-2293.396) (-2292.423) (-2293.125) * (-2294.584) (-2291.951) [-2295.844] (-2295.777) -- 0:00:56
      273000 -- (-2292.699) [-2293.591] (-2292.742) (-2293.308) * (-2294.683) (-2291.357) (-2294.994) [-2295.134] -- 0:00:55
      273500 -- (-2294.749) [-2293.824] (-2290.485) (-2292.426) * [-2292.280] (-2299.044) (-2291.209) (-2292.579) -- 0:00:55
      274000 -- (-2293.231) (-2295.064) (-2290.039) [-2290.596] * [-2290.922] (-2293.166) (-2289.974) (-2291.931) -- 0:00:55
      274500 -- (-2292.889) [-2296.040] (-2292.833) (-2297.253) * (-2293.052) [-2291.488] (-2294.402) (-2293.321) -- 0:00:55
      275000 -- (-2295.442) [-2296.348] (-2294.118) (-2291.479) * (-2294.008) [-2290.952] (-2290.375) (-2292.714) -- 0:00:55

      Average standard deviation of split frequencies: 0.014233

      275500 -- (-2296.102) [-2297.987] (-2296.863) (-2290.902) * (-2294.506) (-2292.077) (-2291.123) [-2292.216] -- 0:00:55
      276000 -- (-2297.483) (-2295.550) [-2298.099] (-2294.261) * (-2295.968) (-2293.492) (-2298.381) [-2293.807] -- 0:00:55
      276500 -- (-2298.615) (-2299.352) [-2299.617] (-2291.747) * (-2292.288) (-2296.252) [-2294.262] (-2292.874) -- 0:00:54
      277000 -- (-2294.390) [-2298.446] (-2295.919) (-2291.448) * [-2290.195] (-2296.537) (-2293.204) (-2290.565) -- 0:00:54
      277500 -- (-2295.267) (-2292.656) (-2297.228) [-2290.574] * (-2292.142) (-2298.174) [-2292.066] (-2290.262) -- 0:00:54
      278000 -- (-2295.207) (-2294.573) (-2293.454) [-2293.095] * (-2294.776) (-2298.846) (-2290.672) [-2290.742] -- 0:00:54
      278500 -- (-2290.742) (-2291.626) (-2291.873) [-2289.835] * (-2295.209) (-2294.010) (-2289.160) [-2290.113] -- 0:00:54
      279000 -- (-2290.432) (-2293.940) [-2292.957] (-2290.063) * (-2292.751) (-2292.381) (-2291.393) [-2292.680] -- 0:00:54
      279500 -- (-2293.964) [-2292.861] (-2294.393) (-2292.603) * (-2294.741) [-2290.908] (-2290.494) (-2291.350) -- 0:00:54
      280000 -- (-2291.662) (-2291.647) (-2291.423) [-2290.091] * (-2301.554) (-2292.968) (-2293.255) [-2292.448] -- 0:00:53

      Average standard deviation of split frequencies: 0.014743

      280500 -- (-2291.844) (-2293.948) [-2291.164] (-2289.136) * (-2294.041) [-2290.493] (-2292.406) (-2292.225) -- 0:00:53
      281000 -- (-2292.401) [-2294.204] (-2291.335) (-2290.722) * (-2293.027) (-2292.453) [-2293.867] (-2294.503) -- 0:00:53
      281500 -- (-2293.106) (-2292.623) [-2290.922] (-2297.952) * (-2292.851) (-2298.332) [-2291.508] (-2291.665) -- 0:00:53
      282000 -- (-2291.614) (-2292.569) [-2295.370] (-2294.015) * (-2293.628) (-2294.949) [-2292.699] (-2290.287) -- 0:00:53
      282500 -- (-2291.223) (-2290.681) [-2291.169] (-2291.715) * (-2293.602) [-2293.859] (-2291.152) (-2290.742) -- 0:00:53
      283000 -- (-2292.818) (-2290.670) (-2290.462) [-2293.737] * (-2294.520) (-2291.079) [-2292.233] (-2290.994) -- 0:00:53
      283500 -- (-2293.452) (-2292.739) [-2291.204] (-2293.738) * (-2294.722) (-2295.608) [-2292.656] (-2290.531) -- 0:00:53
      284000 -- (-2291.930) [-2294.206] (-2293.324) (-2291.856) * (-2294.664) (-2293.133) (-2291.900) [-2293.802] -- 0:00:55
      284500 -- (-2296.134) (-2291.868) (-2293.708) [-2293.008] * (-2290.657) (-2295.480) (-2296.141) [-2291.343] -- 0:00:55
      285000 -- [-2294.437] (-2290.892) (-2294.910) (-2293.970) * [-2290.692] (-2294.604) (-2294.101) (-2290.903) -- 0:00:55

      Average standard deviation of split frequencies: 0.015475

      285500 -- [-2291.114] (-2294.840) (-2300.312) (-2296.519) * (-2292.711) (-2291.665) (-2292.872) [-2291.779] -- 0:00:55
      286000 -- (-2291.452) (-2292.941) [-2292.771] (-2294.104) * (-2293.806) (-2293.157) (-2295.314) [-2290.939] -- 0:00:54
      286500 -- (-2291.199) [-2291.263] (-2291.895) (-2293.116) * [-2291.212] (-2292.108) (-2292.092) (-2292.572) -- 0:00:54
      287000 -- (-2291.562) (-2290.752) [-2289.391] (-2292.812) * (-2291.639) (-2291.449) [-2291.721] (-2290.683) -- 0:00:54
      287500 -- (-2291.511) (-2296.011) [-2292.565] (-2294.321) * [-2293.752] (-2293.738) (-2293.609) (-2290.952) -- 0:00:54
      288000 -- (-2292.966) (-2296.606) [-2292.090] (-2292.932) * (-2292.177) (-2293.115) (-2292.031) [-2291.948] -- 0:00:54
      288500 -- (-2291.243) (-2294.575) [-2292.739] (-2292.929) * (-2295.361) (-2293.662) [-2292.089] (-2290.820) -- 0:00:54
      289000 -- (-2293.361) (-2293.255) [-2290.977] (-2292.429) * (-2295.075) (-2292.308) (-2291.186) [-2292.570] -- 0:00:54
      289500 -- (-2291.127) (-2292.561) (-2290.434) [-2291.005] * [-2294.591] (-2290.505) (-2289.213) (-2294.473) -- 0:00:53
      290000 -- (-2289.929) [-2292.629] (-2292.905) (-2295.187) * (-2294.017) [-2292.679] (-2289.915) (-2298.153) -- 0:00:53

      Average standard deviation of split frequencies: 0.015858

      290500 -- (-2290.996) (-2292.083) [-2290.451] (-2293.734) * (-2295.133) (-2291.516) [-2291.516] (-2298.084) -- 0:00:53
      291000 -- (-2290.289) (-2293.115) [-2291.710] (-2292.494) * (-2291.303) (-2294.101) (-2289.995) [-2296.115] -- 0:00:53
      291500 -- [-2291.179] (-2298.090) (-2293.427) (-2290.277) * (-2291.854) [-2292.381] (-2290.762) (-2295.512) -- 0:00:53
      292000 -- (-2295.614) [-2291.594] (-2292.035) (-2291.637) * [-2293.463] (-2291.069) (-2292.448) (-2293.259) -- 0:00:53
      292500 -- (-2292.020) (-2289.888) [-2291.491] (-2293.784) * (-2292.999) [-2299.711] (-2291.838) (-2291.404) -- 0:00:53
      293000 -- (-2294.897) (-2290.611) [-2291.088] (-2292.101) * (-2294.537) (-2296.239) (-2290.860) [-2290.141] -- 0:00:53
      293500 -- (-2293.287) (-2293.306) [-2290.464] (-2291.681) * (-2295.251) [-2291.325] (-2298.898) (-2292.984) -- 0:00:52
      294000 -- (-2292.658) [-2292.594] (-2292.054) (-2295.602) * (-2292.885) [-2290.970] (-2291.171) (-2291.324) -- 0:00:52
      294500 -- (-2290.158) (-2293.896) [-2291.992] (-2293.338) * (-2293.451) (-2291.042) [-2290.963] (-2290.163) -- 0:00:52
      295000 -- (-2291.173) (-2294.901) [-2292.644] (-2295.062) * (-2293.344) [-2295.694] (-2294.243) (-2291.003) -- 0:00:52

      Average standard deviation of split frequencies: 0.015218

      295500 -- (-2293.059) (-2295.420) [-2293.075] (-2289.392) * [-2290.879] (-2295.909) (-2293.213) (-2294.890) -- 0:00:52
      296000 -- (-2293.925) [-2293.204] (-2292.261) (-2289.594) * [-2291.939] (-2295.026) (-2293.495) (-2294.467) -- 0:00:54
      296500 -- (-2291.469) (-2291.672) [-2292.219] (-2292.791) * [-2290.290] (-2293.453) (-2290.190) (-2292.313) -- 0:00:54
      297000 -- [-2290.735] (-2293.484) (-2295.124) (-2292.305) * (-2293.892) (-2292.350) (-2292.946) [-2290.285] -- 0:00:54
      297500 -- (-2296.006) (-2291.972) (-2297.592) [-2291.484] * (-2292.646) (-2291.232) [-2293.114] (-2293.758) -- 0:00:54
      298000 -- [-2296.461] (-2291.093) (-2290.527) (-2292.400) * (-2293.016) [-2294.578] (-2293.990) (-2294.070) -- 0:00:54
      298500 -- [-2290.792] (-2292.472) (-2289.374) (-2294.421) * (-2293.243) (-2295.298) (-2294.892) [-2291.878] -- 0:00:54
      299000 -- (-2292.842) (-2295.028) [-2291.600] (-2290.447) * (-2293.055) [-2290.256] (-2294.109) (-2289.380) -- 0:00:53
      299500 -- (-2294.117) (-2294.294) [-2293.859] (-2290.478) * [-2292.710] (-2292.463) (-2291.488) (-2299.899) -- 0:00:53
      300000 -- (-2291.120) [-2291.372] (-2293.574) (-2289.775) * [-2293.498] (-2290.734) (-2293.133) (-2292.859) -- 0:00:53

      Average standard deviation of split frequencies: 0.014285

      300500 -- (-2290.125) (-2292.935) [-2293.721] (-2293.143) * (-2291.316) [-2290.311] (-2292.531) (-2291.150) -- 0:00:53
      301000 -- (-2292.595) [-2297.043] (-2293.879) (-2295.854) * (-2293.711) (-2292.096) [-2291.443] (-2290.687) -- 0:00:53
      301500 -- (-2292.742) (-2292.938) [-2294.203] (-2292.516) * [-2292.556] (-2292.417) (-2295.671) (-2292.001) -- 0:00:53
      302000 -- [-2293.793] (-2292.964) (-2294.726) (-2293.871) * [-2291.710] (-2293.719) (-2292.793) (-2291.703) -- 0:00:53
      302500 -- (-2293.185) (-2293.281) (-2293.876) [-2291.081] * [-2290.655] (-2293.882) (-2291.173) (-2293.362) -- 0:00:53
      303000 -- [-2292.798] (-2292.308) (-2289.790) (-2288.443) * (-2293.659) [-2291.360] (-2291.081) (-2293.472) -- 0:00:52
      303500 -- (-2292.300) (-2293.421) (-2292.803) [-2291.249] * (-2290.999) (-2292.425) [-2292.132] (-2293.735) -- 0:00:52
      304000 -- (-2289.972) [-2292.724] (-2297.631) (-2289.373) * [-2292.249] (-2292.557) (-2291.474) (-2291.536) -- 0:00:52
      304500 -- (-2295.920) [-2290.989] (-2293.767) (-2290.897) * (-2294.433) (-2289.118) [-2291.781] (-2292.442) -- 0:00:52
      305000 -- (-2295.112) (-2293.939) (-2297.392) [-2292.275] * (-2292.402) (-2293.688) (-2295.346) [-2289.436] -- 0:00:52

      Average standard deviation of split frequencies: 0.013180

      305500 -- (-2292.199) [-2291.793] (-2296.066) (-2295.693) * (-2292.498) (-2297.288) [-2290.937] (-2292.070) -- 0:00:52
      306000 -- (-2293.733) (-2293.142) [-2290.690] (-2294.162) * (-2292.904) (-2298.187) [-2290.654] (-2293.548) -- 0:00:52
      306500 -- (-2293.156) [-2291.497] (-2290.650) (-2291.597) * [-2293.167] (-2294.734) (-2295.992) (-2292.517) -- 0:00:52
      307000 -- [-2290.600] (-2293.399) (-2294.134) (-2295.918) * [-2289.923] (-2294.235) (-2288.614) (-2290.796) -- 0:00:51
      307500 -- [-2292.027] (-2291.356) (-2295.047) (-2295.291) * (-2293.404) (-2293.245) [-2291.399] (-2289.906) -- 0:00:51
      308000 -- [-2292.029] (-2293.671) (-2294.644) (-2291.306) * (-2290.567) [-2292.493] (-2289.779) (-2288.809) -- 0:00:53
      308500 -- (-2293.074) (-2296.519) [-2291.137] (-2294.675) * (-2288.831) (-2294.554) (-2291.054) [-2289.366] -- 0:00:53
      309000 -- (-2290.293) [-2291.823] (-2292.562) (-2291.324) * (-2295.439) (-2294.740) (-2291.489) [-2289.291] -- 0:00:53
      309500 -- (-2291.872) (-2299.055) [-2290.400] (-2293.962) * [-2298.247] (-2295.764) (-2290.993) (-2290.556) -- 0:00:53
      310000 -- [-2292.557] (-2290.480) (-2293.039) (-2293.556) * [-2290.441] (-2296.035) (-2297.866) (-2293.349) -- 0:00:53

      Average standard deviation of split frequencies: 0.012561

      310500 -- (-2292.519) (-2291.759) [-2292.167] (-2293.276) * (-2291.142) (-2290.591) (-2294.530) [-2292.761] -- 0:00:53
      311000 -- (-2292.569) [-2290.206] (-2294.606) (-2295.084) * (-2295.899) (-2292.156) (-2295.549) [-2291.199] -- 0:00:53
      311500 -- [-2293.023] (-2290.768) (-2294.230) (-2292.585) * [-2290.719] (-2291.526) (-2294.392) (-2293.392) -- 0:00:53
      312000 -- (-2299.498) (-2291.400) [-2291.402] (-2291.793) * (-2290.770) (-2290.591) (-2293.428) [-2290.742] -- 0:00:52
      312500 -- [-2291.242] (-2297.766) (-2291.494) (-2290.260) * [-2292.110] (-2292.598) (-2295.621) (-2288.052) -- 0:00:52
      313000 -- [-2289.397] (-2295.018) (-2292.793) (-2291.806) * (-2293.510) (-2290.081) (-2295.899) [-2289.816] -- 0:00:52
      313500 -- (-2292.844) (-2294.028) [-2293.365] (-2293.526) * (-2293.863) [-2295.229] (-2293.668) (-2294.826) -- 0:00:52
      314000 -- (-2291.526) (-2290.832) [-2290.697] (-2293.874) * (-2294.011) (-2294.491) (-2296.119) [-2292.549] -- 0:00:52
      314500 -- [-2291.426] (-2293.725) (-2291.052) (-2296.430) * (-2291.177) (-2292.935) (-229