--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 08:49:28 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/7res/ML1523/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -395.63 -398.87 2 -395.64 -398.42 -------------------------------------- TOTAL -395.63 -398.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896569 0.088716 0.364753 1.492079 0.865948 1429.62 1465.31 1.000 r(A<->C){all} 0.164364 0.020207 0.000109 0.460436 0.123398 165.54 298.28 1.000 r(A<->G){all} 0.175485 0.021959 0.000111 0.476632 0.136343 238.54 245.64 1.000 r(A<->T){all} 0.153878 0.017526 0.000063 0.419009 0.118289 116.15 176.11 1.002 r(C<->G){all} 0.171717 0.019716 0.000127 0.458213 0.139008 321.67 333.99 1.000 r(C<->T){all} 0.172194 0.019816 0.000011 0.444855 0.138384 240.99 278.02 1.001 r(G<->T){all} 0.162362 0.019194 0.000038 0.432821 0.126298 259.38 289.25 1.000 pi(A){all} 0.178055 0.000498 0.134130 0.221433 0.177557 1187.44 1272.16 1.000 pi(C){all} 0.294746 0.000703 0.246508 0.351172 0.294059 1098.49 1148.49 1.000 pi(G){all} 0.287008 0.000692 0.234797 0.337725 0.286737 1178.77 1296.37 1.000 pi(T){all} 0.240190 0.000597 0.193106 0.287051 0.240206 1244.86 1305.99 1.000 alpha{1,2} 0.405508 0.212621 0.000147 1.325281 0.243990 1394.28 1407.19 1.000 alpha{3} 0.431717 0.214520 0.000166 1.380933 0.276220 1189.62 1345.31 1.000 pinvar{all} 0.993954 0.000055 0.980013 0.999995 0.996341 847.89 1125.92 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -379.089068 Model 2: PositiveSelection -379.089099 Model 0: one-ratio -379.089123 Model 7: beta -379.089098 Model 8: beta&w>1 -379.0891 Model 0 vs 1 1.0999999994965037E-4 Model 2 vs 1 6.199999995715189E-5 Model 8 vs 7 3.999999989900971E-6
>C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR ************************************************** C1 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C2 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C3 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C4 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C5 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C6 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN ********************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [2880] Library Relaxation: Multi_proc [96] Relaxation Summary: [2880]--->[2880] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR ************************************************** C1 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C2 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C3 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C4 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C5 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN C6 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN ********************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT C2 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT C3 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT C4 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT C5 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT C6 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT ************************************************** C1 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG C2 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG C3 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG C4 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG C5 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG C6 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG ************************************************** C1 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG C2 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG C3 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG C4 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG C5 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG C6 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG ************************************************** C1 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA C2 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA C3 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA C4 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA C5 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA C6 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA ************************************************** C1 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG C2 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG C3 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG C4 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG C5 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG C6 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG ************************************************** C1 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC C2 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC C3 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC C4 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC C5 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC C6 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC ************************************** >C1 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C2 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C3 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C4 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C5 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C6 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 288 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579855693 Setting output file names to "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 366606530 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5490007798 Seed = 1960593637 Swapseed = 1579855693 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -644.557769 -- -24.965149 Chain 2 -- -644.557769 -- -24.965149 Chain 3 -- -644.557708 -- -24.965149 Chain 4 -- -644.557769 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -644.557708 -- -24.965149 Chain 2 -- -644.557769 -- -24.965149 Chain 3 -- -644.557806 -- -24.965149 Chain 4 -- -644.557806 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558) 500 -- (-406.097) (-407.562) [-401.630] (-410.831) * (-407.576) [-404.677] (-408.143) (-414.448) -- 0:33:19 1000 -- (-407.354) [-400.459] (-408.024) (-409.706) * (-402.660) (-400.711) [-407.705] (-404.268) -- 0:16:39 1500 -- [-407.347] (-404.711) (-402.983) (-407.587) * [-405.121] (-408.674) (-405.520) (-405.337) -- 0:11:05 2000 -- [-401.071] (-407.529) (-406.265) (-411.852) * (-403.805) [-400.082] (-418.434) (-402.485) -- 0:08:19 2500 -- (-406.572) [-402.562] (-404.693) (-403.201) * (-405.288) [-403.219] (-402.670) (-403.576) -- 0:06:39 3000 -- (-406.380) [-409.375] (-405.047) (-406.649) * [-401.647] (-412.600) (-403.253) (-406.398) -- 0:05:32 3500 -- (-411.820) [-407.911] (-408.539) (-403.798) * (-404.920) (-411.282) [-409.894] (-411.119) -- 0:04:44 4000 -- (-406.882) (-402.245) (-403.286) [-404.460] * (-405.579) (-412.531) [-402.801] (-403.648) -- 0:04:09 4500 -- (-403.338) [-403.456] (-415.973) (-401.363) * (-405.159) [-400.986] (-407.263) (-403.242) -- 0:03:41 5000 -- (-408.795) (-406.114) [-407.971] (-409.152) * (-407.196) (-404.813) [-408.169] (-408.418) -- 0:03:19 Average standard deviation of split frequencies: 0.089791 5500 -- (-408.676) (-399.640) (-402.656) [-402.359] * [-406.393] (-414.132) (-406.166) (-403.729) -- 0:03:00 6000 -- (-404.173) (-408.805) (-405.694) [-402.699] * [-411.464] (-406.158) (-401.546) (-405.935) -- 0:02:45 6500 -- (-405.026) (-400.883) (-409.725) [-411.083] * [-401.985] (-403.994) (-401.038) (-403.842) -- 0:02:32 7000 -- (-413.043) (-410.198) (-405.352) [-402.990] * (-403.351) [-399.679] (-404.293) (-411.364) -- 0:02:21 7500 -- (-405.001) (-403.101) [-413.624] (-412.217) * (-404.616) (-402.182) [-407.350] (-411.568) -- 0:02:12 8000 -- (-412.535) (-404.043) [-408.054] (-401.416) * (-403.859) (-411.443) (-402.946) [-404.144] -- 0:02:04 8500 -- (-407.825) (-412.760) [-404.606] (-400.719) * (-408.585) [-404.499] (-403.660) (-409.906) -- 0:01:56 9000 -- (-409.475) [-405.849] (-408.080) (-404.969) * (-405.747) [-404.476] (-412.441) (-402.898) -- 0:01:50 9500 -- (-405.321) [-403.764] (-405.274) (-404.887) * (-408.808) (-406.657) (-413.407) [-405.560] -- 0:01:44 10000 -- (-406.193) [-405.250] (-404.843) (-407.706) * (-401.358) (-403.703) [-405.853] (-409.107) -- 0:01:39 Average standard deviation of split frequencies: 0.069448 10500 -- (-403.759) [-403.784] (-404.901) (-406.155) * (-408.083) [-401.374] (-408.853) (-406.460) -- 0:01:34 11000 -- (-410.126) (-412.025) [-403.310] (-403.552) * (-413.549) (-406.991) [-408.096] (-408.445) -- 0:01:29 11500 -- (-416.257) (-408.323) [-405.689] (-404.328) * (-405.271) (-407.811) [-399.729] (-402.424) -- 0:01:25 12000 -- (-415.870) (-411.045) (-404.989) [-406.890] * (-404.487) (-406.632) [-403.922] (-408.027) -- 0:01:22 12500 -- (-410.262) [-400.708] (-403.820) (-405.565) * (-406.903) (-405.549) (-403.885) [-402.021] -- 0:01:19 13000 -- (-414.289) (-408.144) [-399.960] (-403.204) * [-403.356] (-408.904) (-409.416) (-406.154) -- 0:01:15 13500 -- (-404.852) (-403.706) [-407.271] (-401.740) * (-406.604) (-408.295) [-420.325] (-413.520) -- 0:01:13 14000 -- (-405.147) (-411.545) [-404.693] (-413.349) * (-417.019) [-406.115] (-403.386) (-406.792) -- 0:01:10 14500 -- (-415.036) [-396.151] (-399.019) (-409.392) * [-407.958] (-414.805) (-403.535) (-416.063) -- 0:01:07 15000 -- (-409.062) (-405.427) (-400.778) [-399.448] * [-400.871] (-406.011) (-406.358) (-411.269) -- 0:01:05 Average standard deviation of split frequencies: 0.052521 15500 -- (-405.198) (-395.691) (-409.512) [-402.608] * (-402.947) (-414.533) [-401.933] (-408.929) -- 0:01:03 16000 -- (-395.604) (-395.573) (-415.091) [-406.935] * [-407.947] (-405.201) (-403.491) (-399.800) -- 0:01:01 16500 -- [-395.472] (-394.054) (-403.056) (-408.812) * (-401.254) [-407.050] (-410.755) (-395.939) -- 0:00:59 17000 -- (-395.183) [-395.662] (-411.098) (-407.109) * (-413.733) (-411.696) [-402.410] (-395.562) -- 0:01:55 17500 -- [-398.054] (-399.493) (-405.169) (-402.714) * (-424.851) (-409.760) [-402.485] (-397.095) -- 0:01:52 18000 -- (-399.005) (-399.606) (-399.503) [-408.398] * (-401.536) (-407.095) [-403.299] (-396.286) -- 0:01:49 18500 -- (-396.885) (-399.448) [-406.035] (-413.333) * (-405.419) (-417.811) (-402.227) [-396.665] -- 0:01:46 19000 -- (-400.358) (-398.400) (-408.831) [-408.218] * [-407.317] (-412.455) (-405.261) (-394.095) -- 0:01:43 19500 -- (-395.003) (-400.235) [-397.638] (-404.975) * (-408.823) (-408.909) (-407.748) [-395.841] -- 0:01:40 20000 -- (-394.405) [-394.469] (-405.415) (-405.724) * [-403.972] (-409.775) (-402.959) (-395.333) -- 0:01:38 Average standard deviation of split frequencies: 0.052823 20500 -- (-395.844) (-395.518) [-402.398] (-413.339) * [-403.764] (-406.131) (-416.709) (-398.575) -- 0:01:35 21000 -- (-397.627) (-395.968) [-410.610] (-406.819) * (-406.487) (-402.058) (-405.460) [-396.751] -- 0:01:33 21500 -- (-395.577) [-396.205] (-409.044) (-407.222) * [-407.454] (-406.700) (-406.994) (-398.259) -- 0:01:31 22000 -- (-396.484) [-395.744] (-402.789) (-410.767) * (-407.056) (-403.919) [-405.524] (-395.585) -- 0:01:28 22500 -- (-397.269) [-396.932] (-406.588) (-409.839) * (-414.367) [-408.816] (-407.153) (-396.361) -- 0:01:26 23000 -- (-396.790) (-397.331) [-398.958] (-411.458) * [-405.231] (-418.696) (-403.765) (-398.059) -- 0:01:24 23500 -- (-399.888) (-397.027) [-412.487] (-426.067) * (-420.659) [-401.458] (-407.957) (-397.306) -- 0:01:23 24000 -- [-396.740] (-395.652) (-402.456) (-431.144) * (-405.553) (-418.144) (-400.300) [-394.962] -- 0:01:21 24500 -- [-394.955] (-396.194) (-405.178) (-419.549) * (-402.776) (-415.805) [-403.917] (-396.806) -- 0:01:19 25000 -- (-395.587) [-399.627] (-406.777) (-405.155) * (-402.419) (-412.508) [-410.892] (-395.735) -- 0:01:18 Average standard deviation of split frequencies: 0.047800 25500 -- (-394.383) [-398.166] (-417.198) (-395.214) * (-416.971) [-408.200] (-411.849) (-397.255) -- 0:01:16 26000 -- (-399.120) (-399.080) [-412.873] (-395.502) * (-400.533) [-410.640] (-408.954) (-398.939) -- 0:01:14 26500 -- (-398.016) [-399.014] (-401.880) (-395.424) * (-401.373) (-409.052) [-401.232] (-398.757) -- 0:01:13 27000 -- (-396.350) (-397.009) (-408.571) [-396.760] * (-407.898) (-413.315) [-411.675] (-395.890) -- 0:01:12 27500 -- (-395.335) [-394.883] (-411.247) (-399.656) * (-427.778) [-396.689] (-404.885) (-396.133) -- 0:01:10 28000 -- (-394.486) [-394.416] (-402.974) (-396.550) * (-406.925) (-397.086) (-404.591) [-396.625] -- 0:01:09 28500 -- (-394.411) [-395.622] (-406.541) (-398.396) * (-406.242) (-395.756) (-408.801) [-396.710] -- 0:01:08 29000 -- (-395.284) (-396.156) (-401.094) [-395.340] * (-401.017) [-396.432] (-409.261) (-396.457) -- 0:01:06 29500 -- (-396.784) [-394.967] (-396.814) (-395.895) * (-407.238) [-396.455] (-415.208) (-396.326) -- 0:01:05 30000 -- (-395.504) (-395.447) (-398.504) [-395.258] * (-402.896) [-397.322] (-415.006) (-396.774) -- 0:01:04 Average standard deviation of split frequencies: 0.043689 30500 -- [-396.674] (-396.541) (-402.438) (-396.903) * (-407.703) [-394.672] (-402.917) (-402.216) -- 0:01:03 31000 -- (-394.256) (-395.213) (-394.874) [-394.166] * (-396.565) (-397.141) [-395.137] (-395.691) -- 0:01:02 31500 -- [-394.159] (-395.736) (-393.954) (-396.202) * (-395.193) [-396.230] (-394.590) (-394.817) -- 0:01:01 32000 -- (-398.478) [-394.698] (-395.669) (-400.724) * (-395.836) (-396.005) [-395.365] (-400.372) -- 0:01:00 32500 -- (-398.843) (-397.004) [-397.894] (-397.439) * [-399.050] (-396.173) (-397.003) (-399.970) -- 0:00:59 33000 -- (-395.943) (-395.666) (-395.809) [-398.626] * [-397.377] (-398.066) (-399.155) (-395.816) -- 0:00:58 33500 -- (-398.077) (-395.068) (-394.327) [-398.185] * [-396.646] (-398.746) (-399.989) (-398.553) -- 0:01:26 34000 -- (-399.491) [-395.730] (-395.202) (-397.420) * (-395.218) (-396.454) (-400.073) [-400.652] -- 0:01:25 34500 -- (-396.840) [-396.629] (-399.202) (-395.830) * (-394.860) [-397.732] (-394.631) (-397.559) -- 0:01:23 35000 -- (-400.082) (-398.683) [-397.800] (-396.633) * (-395.818) (-398.702) (-396.666) [-398.454] -- 0:01:22 Average standard deviation of split frequencies: 0.038556 35500 -- (-395.487) [-395.361] (-397.671) (-396.181) * (-397.370) [-399.674] (-396.495) (-400.786) -- 0:01:21 36000 -- [-397.332] (-398.000) (-395.837) (-395.779) * (-395.723) [-397.341] (-394.920) (-396.221) -- 0:01:20 36500 -- [-399.441] (-398.047) (-397.980) (-395.241) * (-397.258) (-397.370) [-396.931] (-396.124) -- 0:01:19 37000 -- (-397.581) (-401.849) (-395.518) [-396.568] * (-396.367) (-397.117) [-395.651] (-396.165) -- 0:01:18 37500 -- (-395.030) [-401.989] (-396.063) (-395.500) * [-397.652] (-401.282) (-398.180) (-394.792) -- 0:01:17 38000 -- (-395.156) [-396.482] (-395.941) (-395.740) * (-395.813) (-397.563) [-398.343] (-399.847) -- 0:01:15 38500 -- (-397.377) [-396.350] (-398.101) (-395.515) * (-399.222) (-395.906) (-397.667) [-397.094] -- 0:01:14 39000 -- [-394.312] (-395.846) (-394.658) (-395.738) * (-395.037) [-395.181] (-395.972) (-394.945) -- 0:01:13 39500 -- (-401.538) [-395.001] (-397.200) (-395.393) * (-396.225) (-396.982) (-397.124) [-394.579] -- 0:01:12 40000 -- (-399.875) [-395.755] (-394.623) (-396.927) * [-395.196] (-395.588) (-399.337) (-396.173) -- 0:01:12 Average standard deviation of split frequencies: 0.040267 40500 -- (-405.947) [-395.849] (-395.364) (-399.252) * (-394.501) (-398.764) (-396.008) [-396.523] -- 0:01:11 41000 -- (-396.271) (-398.601) (-394.644) [-397.141] * [-394.885] (-396.240) (-394.905) (-396.214) -- 0:01:10 41500 -- (-398.926) (-396.077) (-394.588) [-395.812] * (-396.411) (-397.432) (-399.515) [-397.474] -- 0:01:09 42000 -- (-396.345) (-394.563) (-399.946) [-396.081] * (-399.148) [-394.985] (-397.244) (-395.873) -- 0:01:08 42500 -- (-396.583) [-395.588] (-396.519) (-396.770) * (-399.151) (-395.754) [-395.040] (-395.199) -- 0:01:07 43000 -- (-398.063) (-395.906) [-394.918] (-397.334) * (-399.679) (-397.561) (-399.585) [-398.538] -- 0:01:06 43500 -- (-395.368) [-396.614] (-397.067) (-396.847) * (-401.059) [-397.246] (-400.444) (-395.096) -- 0:01:05 44000 -- (-394.126) (-394.434) (-395.286) [-395.198] * (-395.442) (-398.630) (-397.515) [-395.981] -- 0:01:05 44500 -- (-396.043) (-396.906) [-399.090] (-394.802) * (-398.247) (-398.476) (-398.778) [-394.266] -- 0:01:04 45000 -- [-399.488] (-395.582) (-395.668) (-397.997) * (-399.347) (-395.641) [-395.062] (-395.233) -- 0:01:03 Average standard deviation of split frequencies: 0.039040 45500 -- (-399.671) [-394.498] (-396.108) (-398.261) * [-395.959] (-395.598) (-395.484) (-395.647) -- 0:01:02 46000 -- (-396.533) (-394.595) (-395.417) [-397.020] * [-396.984] (-397.326) (-396.057) (-399.097) -- 0:01:02 46500 -- (-395.414) [-394.860] (-395.479) (-396.474) * [-395.141] (-395.999) (-399.425) (-397.480) -- 0:01:01 47000 -- (-394.991) (-396.749) (-395.280) [-394.728] * (-395.334) (-395.351) [-400.696] (-401.243) -- 0:01:00 47500 -- (-400.192) (-396.542) (-395.046) [-396.543] * [-395.285] (-396.341) (-396.480) (-396.961) -- 0:01:00 48000 -- (-395.534) (-396.435) [-397.058] (-396.559) * (-404.171) (-398.285) (-397.453) [-395.487] -- 0:00:59 48500 -- [-397.736] (-397.349) (-395.722) (-397.289) * (-403.969) (-403.579) [-396.225] (-395.088) -- 0:00:58 49000 -- (-395.423) (-395.367) (-394.110) [-394.595] * (-399.405) (-399.075) (-396.988) [-395.759] -- 0:00:58 49500 -- [-394.919] (-396.376) (-394.415) (-399.354) * (-395.793) (-400.713) (-395.198) [-393.913] -- 0:00:57 50000 -- [-397.673] (-395.254) (-396.175) (-398.029) * [-397.503] (-399.951) (-395.441) (-396.966) -- 0:00:57 Average standard deviation of split frequencies: 0.041351 50500 -- [-395.167] (-394.268) (-395.825) (-395.006) * [-396.759] (-399.409) (-395.340) (-396.487) -- 0:01:15 51000 -- (-397.543) [-394.571] (-397.380) (-395.440) * (-395.990) (-400.828) (-402.042) [-395.717] -- 0:01:14 51500 -- (-394.213) (-394.033) [-396.030] (-396.365) * (-399.548) [-395.900] (-399.258) (-397.129) -- 0:01:13 52000 -- (-394.586) (-395.947) [-396.546] (-396.330) * (-396.225) [-394.789] (-397.827) (-395.267) -- 0:01:12 52500 -- (-395.726) [-395.467] (-397.097) (-408.692) * (-395.358) (-394.550) (-396.816) [-396.041] -- 0:01:12 53000 -- [-398.014] (-398.946) (-396.597) (-403.517) * [-395.865] (-395.216) (-395.562) (-396.921) -- 0:01:11 53500 -- [-395.016] (-396.299) (-395.593) (-394.824) * [-397.431] (-395.131) (-399.172) (-397.840) -- 0:01:10 54000 -- (-396.503) (-398.830) [-396.491] (-394.855) * (-395.652) (-395.928) (-396.379) [-395.436] -- 0:01:10 54500 -- (-399.025) [-394.907] (-394.669) (-396.179) * (-399.011) (-397.170) [-395.218] (-395.658) -- 0:01:09 55000 -- (-397.795) [-395.053] (-395.396) (-395.715) * (-397.451) (-395.559) (-395.283) [-394.657] -- 0:01:08 Average standard deviation of split frequencies: 0.040761 55500 -- [-395.691] (-395.534) (-395.421) (-394.786) * [-396.332] (-397.987) (-394.714) (-395.606) -- 0:01:08 56000 -- (-397.004) (-399.263) [-395.470] (-396.753) * (-397.574) (-396.019) [-394.336] (-394.495) -- 0:01:07 56500 -- (-398.041) (-394.632) [-396.339] (-399.952) * (-397.031) (-400.763) (-397.057) [-394.599] -- 0:01:06 57000 -- [-395.021] (-395.248) (-395.574) (-396.764) * (-395.179) (-397.447) [-400.549] (-396.604) -- 0:01:06 57500 -- (-397.116) (-397.299) [-396.153] (-397.820) * (-397.789) [-396.997] (-395.402) (-397.252) -- 0:01:05 58000 -- (-398.677) (-398.740) [-396.988] (-397.017) * (-394.818) (-394.471) [-394.740] (-394.771) -- 0:01:04 58500 -- [-396.255] (-397.328) (-397.729) (-395.723) * (-400.817) [-396.718] (-395.438) (-396.728) -- 0:01:04 59000 -- (-397.253) (-395.055) (-395.221) [-395.689] * (-398.379) (-397.114) [-396.120] (-396.711) -- 0:01:03 59500 -- (-398.526) [-396.998] (-398.985) (-394.791) * [-396.296] (-398.066) (-395.836) (-396.556) -- 0:01:03 60000 -- (-397.493) (-397.766) [-394.574] (-397.140) * (-403.252) (-396.246) [-397.748] (-395.829) -- 0:01:02 Average standard deviation of split frequencies: 0.032309 60500 -- (-394.537) (-400.503) (-397.357) [-395.234] * [-399.252] (-396.617) (-398.420) (-397.789) -- 0:01:02 61000 -- (-396.035) (-395.028) (-396.667) [-396.227] * (-398.615) [-396.727] (-395.281) (-400.218) -- 0:01:01 61500 -- (-395.378) [-396.888] (-396.730) (-398.056) * [-395.640] (-398.079) (-396.923) (-396.191) -- 0:01:01 62000 -- (-395.680) (-395.130) (-396.759) [-398.553] * (-396.919) [-398.994] (-397.118) (-397.604) -- 0:01:00 62500 -- (-399.444) (-396.325) [-398.651] (-394.844) * [-396.141] (-395.850) (-395.393) (-397.718) -- 0:01:00 63000 -- (-402.163) [-394.912] (-396.640) (-394.735) * [-395.668] (-399.109) (-398.060) (-397.498) -- 0:00:59 63500 -- (-402.189) (-395.348) (-398.847) [-398.534] * (-395.509) [-396.526] (-397.837) (-396.190) -- 0:00:58 64000 -- (-400.820) [-395.861] (-398.350) (-396.062) * (-395.929) (-399.028) [-395.051] (-394.642) -- 0:00:58 64500 -- (-396.913) (-396.444) (-398.157) [-396.358] * (-399.448) (-396.136) (-397.796) [-396.289] -- 0:00:58 65000 -- (-395.076) (-401.465) (-397.808) [-398.460] * (-395.419) [-395.014] (-396.842) (-395.081) -- 0:00:57 Average standard deviation of split frequencies: 0.026869 65500 -- (-396.046) (-396.839) (-395.809) [-395.277] * (-396.301) [-396.311] (-395.948) (-397.598) -- 0:00:57 66000 -- (-396.122) (-397.452) (-395.983) [-397.565] * (-395.391) (-396.240) (-396.237) [-396.676] -- 0:00:56 66500 -- (-398.998) (-396.603) [-396.104] (-395.271) * (-396.411) (-397.398) (-396.090) [-396.661] -- 0:01:10 67000 -- (-401.563) [-396.857] (-394.903) (-395.914) * (-396.918) (-397.612) [-396.474] (-397.520) -- 0:01:09 67500 -- (-397.572) (-396.909) (-397.898) [-396.843] * (-396.127) (-403.066) [-394.689] (-395.888) -- 0:01:09 68000 -- (-396.578) (-398.494) [-395.678] (-399.208) * (-396.069) [-400.473] (-395.746) (-397.401) -- 0:01:08 68500 -- (-394.181) (-398.860) (-399.224) [-395.013] * (-394.210) [-397.710] (-396.702) (-396.140) -- 0:01:07 69000 -- (-395.881) (-394.627) [-398.927] (-394.634) * (-395.648) (-396.848) (-398.880) [-396.209] -- 0:01:07 69500 -- (-396.030) (-395.138) (-396.023) [-396.905] * [-396.366] (-396.463) (-395.563) (-396.535) -- 0:01:06 70000 -- (-394.447) [-394.645] (-396.490) (-399.823) * (-400.334) (-395.491) [-394.845] (-401.057) -- 0:01:06 Average standard deviation of split frequencies: 0.022347 70500 -- [-396.531] (-394.845) (-395.438) (-395.051) * (-396.032) (-394.876) [-394.952] (-394.719) -- 0:01:05 71000 -- (-401.329) [-396.343] (-395.506) (-396.414) * (-395.472) (-398.312) (-399.015) [-397.964] -- 0:01:05 71500 -- [-395.807] (-395.491) (-396.847) (-396.268) * (-395.705) [-397.215] (-397.286) (-395.230) -- 0:01:04 72000 -- (-394.835) (-394.716) [-395.899] (-397.868) * (-399.636) [-397.712] (-398.475) (-400.256) -- 0:01:04 72500 -- (-395.407) (-396.680) (-396.862) [-395.897] * (-394.525) (-400.153) (-396.997) [-395.146] -- 0:01:03 73000 -- (-399.969) (-396.474) (-397.107) [-395.575] * [-394.481] (-395.944) (-398.765) (-396.851) -- 0:01:03 73500 -- (-400.711) [-396.614] (-396.787) (-396.377) * (-395.351) (-396.250) [-396.008] (-397.235) -- 0:01:03 74000 -- [-394.162] (-396.819) (-397.395) (-394.003) * [-395.635] (-395.214) (-395.740) (-396.335) -- 0:01:02 74500 -- (-395.977) [-395.298] (-396.810) (-397.553) * (-395.960) (-397.203) [-395.222] (-398.981) -- 0:01:02 75000 -- [-395.789] (-395.733) (-394.739) (-400.766) * [-396.281] (-397.875) (-396.393) (-396.935) -- 0:01:01 Average standard deviation of split frequencies: 0.024811 75500 -- (-398.459) (-396.355) [-397.309] (-395.467) * (-396.792) (-396.284) (-397.289) [-397.123] -- 0:01:01 76000 -- (-396.228) (-399.943) [-396.643] (-401.316) * (-396.736) (-396.054) [-394.738] (-398.447) -- 0:01:00 76500 -- [-394.442] (-395.055) (-397.793) (-401.371) * [-394.639] (-396.591) (-396.864) (-396.492) -- 0:01:00 77000 -- (-395.011) (-396.112) [-395.992] (-398.756) * (-396.027) (-400.376) [-396.829] (-399.519) -- 0:00:59 77500 -- [-395.174] (-398.443) (-397.363) (-396.918) * [-398.393] (-400.201) (-395.094) (-397.792) -- 0:00:59 78000 -- (-395.409) [-395.476] (-396.530) (-399.072) * (-399.219) (-395.271) [-397.001] (-394.733) -- 0:00:59 78500 -- [-395.280] (-395.399) (-396.941) (-398.782) * (-398.576) (-398.228) (-400.669) [-397.676] -- 0:00:58 79000 -- (-398.457) (-397.533) [-397.237] (-397.720) * (-398.550) [-396.932] (-395.454) (-399.375) -- 0:00:58 79500 -- [-397.007] (-398.565) (-395.178) (-395.195) * (-397.825) (-397.687) [-397.002] (-396.626) -- 0:00:57 80000 -- (-394.230) [-394.839] (-394.605) (-397.155) * [-395.305] (-396.360) (-395.843) (-395.517) -- 0:00:57 Average standard deviation of split frequencies: 0.023097 80500 -- (-396.294) (-395.610) [-395.200] (-397.431) * (-395.734) (-400.064) [-396.867] (-395.720) -- 0:00:57 81000 -- (-394.504) (-400.509) [-395.706] (-396.039) * (-396.797) (-394.601) [-395.782] (-395.639) -- 0:00:56 81500 -- [-395.670] (-398.871) (-395.128) (-394.944) * (-399.323) (-396.543) [-396.491] (-395.415) -- 0:00:56 82000 -- (-395.890) (-399.498) [-395.215] (-396.370) * (-398.273) (-401.745) [-395.825] (-396.035) -- 0:00:55 82500 -- (-394.208) [-397.575] (-397.896) (-398.009) * (-399.366) [-395.690] (-398.754) (-395.419) -- 0:00:55 83000 -- [-395.486] (-394.822) (-395.179) (-394.875) * [-396.113] (-395.873) (-396.315) (-395.999) -- 0:00:55 83500 -- (-394.752) (-396.399) [-396.762] (-393.990) * (-396.325) (-396.825) [-394.741] (-396.100) -- 0:01:05 84000 -- (-395.659) (-397.608) (-396.292) [-395.804] * [-395.362] (-399.782) (-396.588) (-395.877) -- 0:01:05 84500 -- [-395.437] (-397.934) (-394.745) (-394.972) * (-400.474) [-395.288] (-398.861) (-399.327) -- 0:01:05 85000 -- (-395.152) [-395.131] (-394.321) (-395.863) * (-396.352) (-396.709) (-398.999) [-398.365] -- 0:01:04 Average standard deviation of split frequencies: 0.022448 85500 -- (-394.876) (-397.140) [-395.575] (-394.873) * [-396.716] (-397.380) (-398.810) (-397.069) -- 0:01:04 86000 -- (-395.706) [-397.399] (-396.191) (-394.433) * (-401.632) (-395.398) (-396.746) [-396.204] -- 0:01:03 86500 -- (-396.395) (-395.903) (-400.210) [-395.008] * (-397.581) (-397.798) [-396.885] (-394.692) -- 0:01:03 87000 -- (-395.462) [-394.513] (-396.247) (-395.899) * (-398.088) (-395.382) [-398.446] (-397.080) -- 0:01:02 87500 -- (-395.895) (-396.807) (-404.230) [-395.584] * (-395.415) [-397.635] (-399.807) (-397.116) -- 0:01:02 88000 -- [-394.940] (-396.118) (-403.085) (-394.941) * [-395.250] (-396.764) (-396.031) (-394.699) -- 0:01:02 88500 -- (-394.710) [-395.874] (-402.601) (-397.458) * (-394.887) (-395.362) [-395.410] (-396.411) -- 0:01:01 89000 -- (-398.369) (-396.853) (-395.425) [-395.321] * (-396.700) (-403.393) (-395.448) [-396.410] -- 0:01:01 89500 -- (-400.472) (-395.089) (-398.641) [-399.101] * (-398.656) (-398.058) (-397.101) [-395.248] -- 0:01:01 90000 -- (-406.295) (-400.703) [-395.609] (-395.758) * (-396.854) (-398.503) (-397.532) [-395.626] -- 0:01:00 Average standard deviation of split frequencies: 0.024342 90500 -- (-398.596) [-396.762] (-395.689) (-399.141) * (-395.182) (-398.471) [-400.459] (-395.830) -- 0:01:00 91000 -- (-397.326) (-396.053) [-396.109] (-397.487) * (-396.870) [-398.758] (-396.407) (-397.927) -- 0:00:59 91500 -- [-397.760] (-396.715) (-398.545) (-395.054) * (-395.563) (-398.736) [-396.487] (-396.489) -- 0:00:59 92000 -- (-394.895) (-394.869) [-398.951] (-395.686) * [-396.320] (-396.186) (-397.507) (-396.430) -- 0:00:59 92500 -- (-395.909) (-400.600) (-396.516) [-395.394] * (-397.430) [-395.698] (-395.090) (-401.718) -- 0:00:58 93000 -- [-397.782] (-395.039) (-397.049) (-399.821) * (-396.093) (-399.506) [-396.651] (-398.375) -- 0:00:58 93500 -- [-400.546] (-399.345) (-396.632) (-396.478) * (-400.423) (-394.388) [-394.707] (-396.547) -- 0:00:58 94000 -- (-398.232) (-397.645) [-396.855] (-397.260) * (-395.516) (-394.435) [-395.197] (-399.369) -- 0:00:57 94500 -- (-394.364) (-398.179) (-402.036) [-397.045] * (-395.397) [-394.899] (-396.619) (-401.218) -- 0:00:57 95000 -- (-395.331) (-396.982) (-397.141) [-397.995] * (-396.992) (-396.286) [-396.647] (-397.058) -- 0:00:57 Average standard deviation of split frequencies: 0.026784 95500 -- (-396.745) (-397.747) [-394.189] (-396.997) * [-394.963] (-396.239) (-396.336) (-396.350) -- 0:00:56 96000 -- (-402.891) [-396.184] (-395.589) (-395.138) * (-395.576) (-396.348) (-395.172) [-396.256] -- 0:00:56 96500 -- (-400.091) (-395.439) [-397.250] (-403.383) * (-395.555) [-394.751] (-394.360) (-395.508) -- 0:00:56 97000 -- (-398.579) (-395.812) (-399.764) [-394.654] * (-396.046) (-395.947) (-398.853) [-395.082] -- 0:00:55 97500 -- [-397.958] (-396.233) (-395.995) (-396.576) * (-396.298) (-396.644) (-398.656) [-394.898] -- 0:00:55 98000 -- [-394.840] (-395.139) (-394.616) (-395.660) * (-398.486) (-396.961) [-396.929] (-396.217) -- 0:00:55 98500 -- [-395.932] (-397.196) (-397.722) (-397.358) * [-395.551] (-400.732) (-397.321) (-395.814) -- 0:00:54 99000 -- (-395.929) [-398.852] (-398.192) (-397.051) * (-397.650) [-395.767] (-397.032) (-395.154) -- 0:00:54 99500 -- (-399.572) (-394.958) [-395.525] (-395.771) * (-395.389) (-395.618) (-395.026) [-395.419] -- 0:00:54 100000 -- [-398.689] (-394.774) (-396.563) (-396.025) * (-397.263) (-398.638) [-399.416] (-396.278) -- 0:00:54 Average standard deviation of split frequencies: 0.026090 100500 -- (-399.076) (-395.634) [-395.737] (-394.974) * [-395.673] (-399.061) (-396.446) (-396.949) -- 0:01:02 101000 -- (-399.719) (-395.220) [-397.602] (-397.576) * (-394.716) [-394.632] (-394.077) (-394.682) -- 0:01:02 101500 -- (-394.875) [-394.696] (-395.402) (-395.512) * (-396.319) (-394.662) [-394.635] (-396.007) -- 0:01:01 102000 -- (-397.743) (-398.207) (-396.620) [-397.542] * (-396.186) [-395.754] (-398.002) (-394.502) -- 0:01:01 102500 -- (-400.289) (-396.172) (-395.856) [-397.141] * [-397.990] (-396.462) (-396.678) (-395.761) -- 0:01:01 103000 -- (-395.990) [-396.682] (-394.881) (-401.060) * (-395.309) (-399.176) [-396.172] (-396.457) -- 0:01:00 103500 -- (-404.993) (-396.294) [-396.781] (-395.039) * (-394.837) (-397.297) [-396.337] (-396.348) -- 0:01:00 104000 -- [-403.663] (-394.922) (-396.525) (-395.322) * [-396.786] (-397.233) (-397.976) (-394.715) -- 0:01:00 104500 -- (-402.827) [-396.761] (-398.014) (-401.760) * [-397.380] (-396.572) (-396.988) (-398.549) -- 0:00:59 105000 -- (-395.494) [-397.982] (-394.977) (-395.700) * (-395.291) [-397.323] (-395.779) (-394.866) -- 0:00:59 Average standard deviation of split frequencies: 0.027088 105500 -- (-394.783) (-396.697) [-394.376] (-395.454) * (-396.829) [-395.018] (-401.382) (-395.896) -- 0:00:59 106000 -- (-397.291) (-395.719) [-394.305] (-395.509) * [-396.445] (-394.567) (-395.628) (-395.112) -- 0:00:59 106500 -- [-394.387] (-395.015) (-404.171) (-397.236) * (-394.802) [-394.639] (-396.086) (-395.407) -- 0:00:58 107000 -- (-394.383) (-396.777) (-398.484) [-395.313] * (-399.893) (-398.281) (-395.561) [-397.230] -- 0:00:58 107500 -- (-396.887) [-396.584] (-395.202) (-400.005) * (-398.966) (-396.243) (-395.474) [-395.484] -- 0:00:58 108000 -- (-395.878) (-397.119) (-395.117) [-397.204] * [-395.865] (-398.198) (-397.073) (-400.458) -- 0:00:57 108500 -- (-394.349) (-397.064) [-395.644] (-397.478) * (-396.286) (-396.419) [-394.686] (-394.934) -- 0:00:57 109000 -- [-395.934] (-396.588) (-395.645) (-397.385) * (-396.174) [-395.031] (-395.864) (-400.184) -- 0:00:57 109500 -- (-395.509) [-396.524] (-397.254) (-395.450) * [-395.112] (-397.091) (-396.741) (-396.462) -- 0:00:56 110000 -- (-398.562) (-397.775) [-397.508] (-395.059) * (-395.228) (-399.845) (-394.487) [-395.677] -- 0:00:56 Average standard deviation of split frequencies: 0.027107 110500 -- (-396.279) [-396.899] (-397.561) (-395.441) * [-394.746] (-403.325) (-394.556) (-395.221) -- 0:00:56 111000 -- (-396.509) (-394.904) (-396.546) [-395.127] * [-396.689] (-398.674) (-396.679) (-395.575) -- 0:00:56 111500 -- [-394.845] (-397.485) (-395.347) (-394.963) * (-394.904) [-397.053] (-399.250) (-395.234) -- 0:00:55 112000 -- [-399.390] (-397.137) (-396.636) (-394.431) * [-396.486] (-394.708) (-397.549) (-395.126) -- 0:00:55 112500 -- [-395.820] (-396.682) (-396.234) (-396.635) * (-394.291) (-397.678) [-395.904] (-395.409) -- 0:00:55 113000 -- [-395.283] (-396.662) (-396.062) (-401.009) * [-396.533] (-397.955) (-396.256) (-396.687) -- 0:00:54 113500 -- (-397.328) (-395.624) [-396.102] (-395.962) * (-399.228) (-395.421) [-394.784] (-396.477) -- 0:00:54 114000 -- (-398.382) (-395.002) [-397.293] (-398.686) * (-399.349) (-395.298) (-394.878) [-396.978] -- 0:00:54 114500 -- (-394.810) (-395.222) [-396.076] (-396.157) * (-395.875) (-396.064) [-394.119] (-396.996) -- 0:00:54 115000 -- (-394.700) (-395.686) (-397.128) [-397.352] * (-395.030) (-394.618) (-394.879) [-399.870] -- 0:00:53 Average standard deviation of split frequencies: 0.025544 115500 -- [-395.572] (-397.274) (-395.006) (-397.977) * (-394.306) (-396.946) (-395.483) [-396.488] -- 0:00:53 116000 -- [-397.694] (-397.367) (-395.222) (-397.514) * (-397.202) [-396.103] (-396.820) (-395.711) -- 0:00:53 116500 -- (-394.461) (-397.938) [-394.754] (-394.740) * [-394.898] (-395.804) (-396.553) (-398.294) -- 0:00:53 117000 -- [-396.083] (-398.358) (-395.397) (-394.644) * [-398.261] (-402.489) (-398.921) (-395.619) -- 0:01:00 117500 -- (-396.232) [-396.670] (-397.146) (-394.971) * (-397.877) (-394.432) (-399.771) [-396.974] -- 0:01:00 118000 -- [-395.206] (-395.583) (-396.853) (-395.041) * (-399.313) (-394.860) (-396.363) [-397.104] -- 0:00:59 118500 -- (-395.946) (-394.431) [-402.083] (-396.399) * [-395.727] (-394.644) (-395.309) (-397.716) -- 0:00:59 119000 -- [-397.081] (-395.435) (-399.452) (-395.842) * (-397.329) (-398.009) (-396.122) [-396.308] -- 0:00:59 119500 -- (-394.298) [-400.902] (-395.537) (-395.655) * (-397.215) [-399.663] (-396.563) (-394.886) -- 0:00:58 120000 -- (-395.831) (-396.774) [-395.584] (-395.906) * (-398.885) (-396.720) (-397.211) [-396.795] -- 0:00:58 Average standard deviation of split frequencies: 0.025300 120500 -- (-396.514) [-396.056] (-394.952) (-395.667) * [-396.653] (-397.855) (-395.331) (-397.408) -- 0:00:58 121000 -- (-394.834) (-395.531) [-396.887] (-395.074) * (-400.334) (-404.273) (-395.707) [-396.924] -- 0:00:58 121500 -- (-395.740) [-396.747] (-394.108) (-396.993) * (-394.861) (-399.178) [-394.807] (-398.051) -- 0:00:57 122000 -- (-395.252) [-394.574] (-394.459) (-397.205) * [-396.899] (-401.362) (-395.325) (-396.330) -- 0:00:57 122500 -- (-397.170) [-394.501] (-396.359) (-396.039) * [-395.870] (-401.795) (-397.508) (-397.288) -- 0:00:57 123000 -- (-396.258) (-398.938) [-395.798] (-397.724) * [-395.916] (-397.455) (-401.960) (-396.658) -- 0:00:57 123500 -- [-395.968] (-395.401) (-400.051) (-401.391) * (-400.236) (-396.491) (-401.931) [-396.085] -- 0:00:56 124000 -- (-399.182) [-396.195] (-397.996) (-400.041) * (-399.145) (-394.715) [-396.732] (-396.796) -- 0:00:56 124500 -- (-405.260) (-395.356) [-395.794] (-394.716) * (-396.797) (-396.162) [-395.675] (-395.002) -- 0:00:56 125000 -- (-399.857) (-399.291) [-398.007] (-395.631) * (-396.325) (-396.379) [-395.973] (-396.168) -- 0:00:56 Average standard deviation of split frequencies: 0.026189 125500 -- (-396.778) [-399.261] (-395.897) (-394.927) * (-398.340) (-397.851) (-398.493) [-395.290] -- 0:00:55 126000 -- (-399.190) (-396.836) [-394.913] (-395.428) * (-395.416) (-395.358) [-395.087] (-394.688) -- 0:00:55 126500 -- (-396.860) (-396.966) (-398.960) [-394.984] * (-397.542) (-394.640) (-394.751) [-396.814] -- 0:00:55 127000 -- (-396.577) [-396.516] (-394.731) (-395.239) * [-395.424] (-394.877) (-395.461) (-395.243) -- 0:00:54 127500 -- (-395.680) (-395.778) (-398.023) [-396.354] * (-394.604) [-396.287] (-397.769) (-395.399) -- 0:00:54 128000 -- (-395.812) (-397.987) [-396.835] (-395.232) * (-396.512) (-396.190) (-400.639) [-396.374] -- 0:00:54 128500 -- (-397.797) (-396.146) (-398.259) [-396.338] * [-395.790] (-396.202) (-397.395) (-400.296) -- 0:00:54 129000 -- (-398.339) (-397.402) [-395.821] (-399.087) * (-396.820) [-397.126] (-395.716) (-396.483) -- 0:00:54 129500 -- (-398.315) (-395.219) [-399.418] (-397.894) * (-401.289) (-397.011) [-394.233] (-395.206) -- 0:00:53 130000 -- [-397.436] (-396.030) (-396.953) (-395.487) * (-397.443) [-396.239] (-394.369) (-395.903) -- 0:00:53 Average standard deviation of split frequencies: 0.024910 130500 -- (-395.324) (-405.476) (-396.352) [-399.384] * (-395.315) [-398.609] (-395.351) (-394.141) -- 0:00:53 131000 -- (-404.285) (-400.628) [-398.906] (-397.600) * (-396.285) [-394.762] (-397.729) (-395.412) -- 0:00:53 131500 -- [-396.633] (-397.444) (-399.115) (-394.085) * (-396.115) [-396.097] (-399.897) (-397.386) -- 0:00:52 132000 -- [-398.922] (-399.602) (-397.447) (-394.643) * (-397.609) [-394.833] (-397.863) (-396.348) -- 0:00:52 132500 -- (-399.278) [-398.353] (-395.525) (-395.496) * (-396.680) (-396.890) [-396.200] (-401.656) -- 0:00:52 133000 -- (-399.821) (-394.159) [-395.806] (-400.514) * [-395.967] (-395.703) (-397.934) (-397.447) -- 0:00:52 133500 -- (-397.152) [-396.842] (-395.932) (-399.658) * (-394.753) [-396.045] (-395.829) (-395.151) -- 0:00:58 134000 -- (-396.060) (-395.756) [-395.309] (-394.555) * (-396.622) (-402.150) [-400.821] (-395.958) -- 0:00:58 134500 -- [-397.849] (-394.812) (-396.949) (-396.036) * (-394.959) (-396.663) (-399.975) [-396.404] -- 0:00:57 135000 -- (-395.984) [-394.787] (-396.333) (-397.343) * (-399.712) (-398.940) [-395.498] (-396.959) -- 0:00:57 Average standard deviation of split frequencies: 0.024594 135500 -- (-401.040) (-397.209) (-397.909) [-396.353] * (-398.557) (-395.991) (-396.277) [-399.297] -- 0:00:57 136000 -- (-399.187) (-396.242) [-395.027] (-395.526) * (-395.638) [-397.088] (-396.418) (-396.626) -- 0:00:57 136500 -- (-397.216) [-395.032] (-398.313) (-395.230) * (-394.295) [-396.799] (-396.226) (-396.902) -- 0:00:56 137000 -- (-397.822) [-396.680] (-396.471) (-394.376) * (-396.446) [-396.228] (-395.639) (-398.849) -- 0:00:56 137500 -- (-394.399) (-397.567) [-396.592] (-394.755) * (-397.612) (-399.994) (-395.656) [-395.476] -- 0:00:56 138000 -- (-396.098) (-399.027) [-402.083] (-396.186) * (-395.130) (-394.612) (-399.665) [-397.855] -- 0:00:56 138500 -- (-395.831) [-396.030] (-397.409) (-396.364) * (-397.911) (-396.547) [-397.131] (-396.344) -- 0:00:55 139000 -- (-397.218) (-394.852) [-396.557] (-394.955) * (-397.834) (-397.812) [-394.304] (-396.508) -- 0:00:55 139500 -- (-395.407) (-394.290) (-395.698) [-396.489] * (-398.268) [-396.170] (-396.357) (-396.771) -- 0:00:55 140000 -- (-395.575) (-394.948) [-395.357] (-399.272) * (-397.511) (-395.365) (-394.768) [-397.208] -- 0:00:55 Average standard deviation of split frequencies: 0.022661 140500 -- (-397.697) (-396.171) (-400.898) [-395.900] * (-397.477) (-394.095) [-395.725] (-395.861) -- 0:00:55 141000 -- (-394.746) (-396.797) (-401.714) [-396.695] * (-395.624) [-394.225] (-396.223) (-396.431) -- 0:00:54 141500 -- (-395.942) [-395.879] (-397.902) (-395.787) * [-396.285] (-395.132) (-395.259) (-395.593) -- 0:00:54 142000 -- (-400.888) [-398.558] (-396.883) (-394.878) * (-402.010) (-396.079) (-394.775) [-395.243] -- 0:00:54 142500 -- (-395.878) (-398.263) [-396.005] (-395.184) * (-395.255) (-395.670) (-395.917) [-394.210] -- 0:00:54 143000 -- (-394.453) [-396.724] (-396.972) (-396.063) * (-398.844) (-395.609) [-396.158] (-394.798) -- 0:00:53 143500 -- (-398.640) [-395.573] (-394.884) (-396.202) * (-395.825) (-404.210) [-397.417] (-394.975) -- 0:00:53 144000 -- (-397.606) [-395.645] (-394.390) (-397.550) * (-397.902) (-396.996) [-398.419] (-394.521) -- 0:00:53 144500 -- (-399.576) (-395.372) [-396.151] (-396.269) * [-395.701] (-396.711) (-394.067) (-397.268) -- 0:00:53 145000 -- (-396.233) [-395.380] (-399.362) (-398.627) * (-395.252) [-394.282] (-398.508) (-396.558) -- 0:00:53 Average standard deviation of split frequencies: 0.019680 145500 -- (-395.039) (-395.968) [-395.314] (-397.596) * [-395.831] (-394.206) (-398.421) (-398.064) -- 0:00:52 146000 -- (-395.485) (-398.240) [-395.354] (-397.478) * (-395.751) [-395.784] (-394.919) (-394.735) -- 0:00:52 146500 -- (-394.814) [-395.113] (-395.776) (-394.918) * [-400.576] (-399.280) (-395.742) (-396.023) -- 0:00:52 147000 -- (-395.450) (-397.081) (-394.917) [-396.337] * (-401.291) (-395.993) [-394.834] (-394.804) -- 0:00:52 147500 -- (-396.088) (-399.669) (-394.568) [-395.013] * (-396.406) (-395.548) (-397.505) [-395.805] -- 0:00:52 148000 -- [-398.058] (-396.051) (-399.930) (-396.241) * [-396.587] (-396.004) (-396.222) (-395.187) -- 0:00:51 148500 -- (-396.110) [-394.975] (-395.942) (-394.358) * (-396.244) (-397.034) [-394.358] (-399.173) -- 0:00:51 149000 -- (-395.195) (-396.857) (-394.251) [-396.804] * (-395.253) [-395.161] (-396.251) (-400.001) -- 0:00:51 149500 -- (-396.137) [-397.555] (-395.263) (-395.608) * (-397.297) (-396.689) [-397.844] (-397.319) -- 0:00:51 150000 -- (-396.660) (-396.092) (-396.729) [-396.505] * (-395.417) (-396.105) (-397.113) [-398.410] -- 0:00:51 Average standard deviation of split frequencies: 0.019086 150500 -- [-394.399] (-398.950) (-399.210) (-396.587) * (-395.460) (-395.233) [-396.933] (-395.057) -- 0:00:56 151000 -- (-395.277) [-398.154] (-394.592) (-400.909) * (-398.103) (-394.509) (-394.113) [-394.693] -- 0:00:56 151500 -- [-394.772] (-396.766) (-396.599) (-400.467) * [-395.712] (-401.571) (-395.581) (-395.120) -- 0:00:56 152000 -- [-399.334] (-394.784) (-395.144) (-397.874) * (-394.409) (-397.720) (-400.620) [-395.559] -- 0:00:55 152500 -- (-395.533) (-398.990) [-395.481] (-396.300) * (-399.172) (-396.682) [-394.536] (-397.723) -- 0:00:55 153000 -- (-397.748) (-394.900) [-396.763] (-394.668) * (-395.853) (-399.436) (-397.809) [-397.071] -- 0:00:55 153500 -- (-402.139) [-394.391] (-394.544) (-397.204) * (-398.287) (-398.132) [-396.200] (-397.320) -- 0:00:55 154000 -- (-398.902) (-396.859) [-394.703] (-394.807) * (-397.446) (-395.280) (-396.587) [-396.653] -- 0:00:54 154500 -- (-397.297) (-397.194) [-395.371] (-399.068) * (-395.359) [-397.702] (-394.873) (-394.944) -- 0:00:54 155000 -- [-395.450] (-397.218) (-396.011) (-398.397) * (-399.584) (-397.556) [-394.601] (-396.728) -- 0:00:54 Average standard deviation of split frequencies: 0.018433 155500 -- [-395.178] (-398.232) (-397.961) (-395.062) * (-395.420) (-399.935) [-396.319] (-395.576) -- 0:00:54 156000 -- [-394.794] (-400.508) (-397.331) (-398.452) * [-395.839] (-400.660) (-396.294) (-394.808) -- 0:00:54 156500 -- (-396.183) (-403.015) (-403.875) [-396.513] * (-395.528) [-396.497] (-395.338) (-395.650) -- 0:00:53 157000 -- (-398.776) (-404.616) (-395.068) [-397.061] * [-394.774] (-397.798) (-400.084) (-398.335) -- 0:00:53 157500 -- (-400.137) [-399.777] (-397.396) (-398.990) * (-394.602) (-397.219) [-396.598] (-397.717) -- 0:00:53 158000 -- (-395.251) [-397.611] (-396.314) (-395.570) * [-395.348] (-396.333) (-395.674) (-395.105) -- 0:00:53 158500 -- [-394.773] (-394.639) (-396.605) (-398.438) * (-398.131) (-397.682) [-396.134] (-394.376) -- 0:00:53 159000 -- (-397.537) [-395.709] (-397.186) (-399.496) * [-396.631] (-397.897) (-395.290) (-397.213) -- 0:00:52 159500 -- [-394.780] (-396.432) (-396.512) (-396.352) * (-397.230) (-395.917) (-396.193) [-397.469] -- 0:00:52 160000 -- (-397.623) (-398.350) (-398.034) [-394.754] * (-396.463) (-397.772) (-397.034) [-396.997] -- 0:00:52 Average standard deviation of split frequencies: 0.018925 160500 -- [-396.284] (-396.033) (-396.522) (-395.083) * [-397.211] (-394.743) (-394.566) (-394.772) -- 0:00:52 161000 -- (-397.558) (-401.917) [-394.969] (-395.177) * (-395.187) [-398.920] (-400.904) (-394.648) -- 0:00:52 161500 -- [-400.619] (-398.742) (-395.332) (-396.527) * (-398.192) (-395.429) (-399.687) [-395.292] -- 0:00:51 162000 -- (-395.377) (-397.274) [-397.246] (-397.150) * (-399.300) (-396.229) (-395.910) [-397.734] -- 0:00:51 162500 -- (-397.850) [-395.083] (-394.556) (-398.767) * (-397.688) [-394.141] (-397.601) (-398.992) -- 0:00:51 163000 -- [-396.198] (-394.875) (-398.149) (-395.955) * (-398.327) [-397.598] (-399.383) (-399.476) -- 0:00:51 163500 -- (-396.178) (-397.119) [-397.214] (-395.779) * (-401.240) (-397.617) (-398.676) [-401.917] -- 0:00:51 164000 -- (-399.304) (-396.690) (-397.003) [-396.894] * [-397.648] (-397.064) (-396.724) (-396.800) -- 0:00:50 164500 -- [-396.400] (-395.807) (-396.205) (-396.642) * (-398.775) (-394.810) [-395.859] (-398.077) -- 0:00:50 165000 -- (-397.288) (-395.461) (-398.221) [-399.692] * (-397.237) (-395.734) (-398.441) [-394.422] -- 0:00:50 Average standard deviation of split frequencies: 0.018175 165500 -- [-394.179] (-396.471) (-396.182) (-395.173) * [-395.565] (-396.141) (-396.978) (-394.417) -- 0:00:50 166000 -- [-394.221] (-394.441) (-395.376) (-398.872) * (-401.841) (-396.655) (-396.731) [-394.184] -- 0:00:50 166500 -- [-396.098] (-396.865) (-395.211) (-399.775) * (-396.332) (-396.057) (-396.874) [-394.916] -- 0:00:50 167000 -- (-399.501) (-394.406) (-394.200) [-397.398] * (-395.950) (-404.177) (-395.281) [-395.587] -- 0:00:54 167500 -- (-396.578) (-397.004) [-394.480] (-394.455) * [-396.836] (-395.483) (-395.974) (-395.996) -- 0:00:54 168000 -- (-396.703) (-394.804) [-396.478] (-395.527) * [-396.048] (-395.803) (-395.228) (-395.608) -- 0:00:54 168500 -- (-401.550) (-395.228) (-396.060) [-396.677] * (-394.902) [-395.302] (-395.548) (-396.084) -- 0:00:54 169000 -- [-395.419] (-397.184) (-394.182) (-396.081) * (-395.512) (-398.393) [-396.648] (-401.372) -- 0:00:54 169500 -- (-395.469) (-394.871) (-394.430) [-395.141] * (-397.181) [-396.362] (-400.355) (-398.430) -- 0:00:53 170000 -- [-396.360] (-395.354) (-396.093) (-395.543) * (-397.063) (-398.369) (-398.070) [-395.321] -- 0:00:53 Average standard deviation of split frequencies: 0.017678 170500 -- (-397.682) (-394.802) [-397.549] (-397.451) * (-394.955) (-404.758) (-398.568) [-394.624] -- 0:00:53 171000 -- (-402.752) (-395.004) [-394.793] (-399.284) * [-395.529] (-396.081) (-395.615) (-395.059) -- 0:00:53 171500 -- (-400.094) [-394.895] (-395.836) (-396.528) * [-397.802] (-400.172) (-397.705) (-397.543) -- 0:00:53 172000 -- (-398.685) (-395.380) [-399.612] (-397.327) * (-398.981) [-398.166] (-397.138) (-396.251) -- 0:00:52 172500 -- (-396.175) (-394.597) (-402.968) [-394.570] * [-395.274] (-397.476) (-395.033) (-397.898) -- 0:00:52 173000 -- (-398.910) (-396.273) (-398.856) [-395.561] * (-396.399) (-399.510) (-395.131) [-397.981] -- 0:00:52 173500 -- (-397.605) (-398.835) (-397.316) [-395.482] * (-397.571) (-396.943) (-400.309) [-395.447] -- 0:00:52 174000 -- (-394.989) (-395.315) (-396.939) [-395.078] * [-394.815] (-398.675) (-394.078) (-394.894) -- 0:00:52 174500 -- (-400.100) (-395.438) (-397.169) [-397.401] * (-395.144) (-397.279) [-395.794] (-394.887) -- 0:00:52 175000 -- [-399.392] (-396.070) (-396.868) (-398.851) * (-396.135) (-396.773) (-398.237) [-396.045] -- 0:00:51 Average standard deviation of split frequencies: 0.017276 175500 -- (-394.651) (-397.734) (-398.510) [-394.979] * (-394.353) (-395.668) (-402.015) [-398.177] -- 0:00:51 176000 -- (-399.321) [-397.598] (-396.643) (-395.075) * (-395.260) (-394.773) (-396.386) [-394.776] -- 0:00:51 176500 -- (-396.101) (-398.737) [-396.487] (-395.204) * (-403.135) (-395.120) [-394.151] (-396.008) -- 0:00:51 177000 -- (-395.429) [-397.950] (-394.831) (-397.431) * (-395.259) (-398.051) (-399.754) [-395.345] -- 0:00:51 177500 -- (-396.213) (-397.258) (-395.987) [-397.116] * (-395.005) (-397.013) (-399.046) [-394.756] -- 0:00:50 178000 -- (-395.584) (-396.698) [-396.796] (-394.413) * (-395.565) (-395.608) [-396.199] (-394.612) -- 0:00:50 178500 -- (-395.982) [-398.335] (-397.662) (-397.889) * (-394.820) [-398.167] (-395.332) (-398.494) -- 0:00:50 179000 -- (-396.578) [-394.603] (-395.564) (-396.309) * (-397.174) [-395.091] (-398.788) (-395.559) -- 0:00:50 179500 -- (-395.790) (-397.826) (-394.274) [-396.934] * (-395.985) [-400.591] (-401.454) (-397.776) -- 0:00:50 180000 -- [-398.257] (-395.606) (-398.370) (-398.464) * (-395.733) [-395.678] (-395.035) (-395.718) -- 0:00:50 Average standard deviation of split frequencies: 0.017221 180500 -- [-395.718] (-399.815) (-396.414) (-397.205) * [-395.925] (-395.863) (-395.957) (-399.090) -- 0:00:49 181000 -- (-395.815) (-395.548) (-395.786) [-398.664] * [-395.344] (-397.691) (-394.540) (-395.049) -- 0:00:49 181500 -- [-395.971] (-395.276) (-396.040) (-396.832) * (-398.278) [-396.882] (-394.628) (-396.861) -- 0:00:49 182000 -- [-394.989] (-396.293) (-394.346) (-395.269) * (-397.936) (-394.861) (-398.848) [-396.312] -- 0:00:49 182500 -- (-395.054) (-396.979) [-395.864] (-395.111) * (-396.541) [-394.473] (-396.681) (-396.796) -- 0:00:49 183000 -- (-396.897) (-396.603) [-394.268] (-402.669) * [-396.189] (-395.354) (-394.886) (-394.651) -- 0:00:49 183500 -- (-398.004) (-394.808) [-396.085] (-395.618) * (-397.281) [-397.293] (-398.186) (-400.191) -- 0:00:48 184000 -- (-396.599) (-395.271) (-394.557) [-395.150] * (-396.678) (-394.573) (-396.326) [-395.684] -- 0:00:53 184500 -- (-399.070) (-398.754) [-397.355] (-398.188) * (-398.215) [-395.652] (-395.268) (-401.971) -- 0:00:53 185000 -- (-393.972) (-395.257) [-394.909] (-395.717) * [-397.197] (-394.729) (-397.539) (-404.282) -- 0:00:52 Average standard deviation of split frequencies: 0.017107 185500 -- (-395.129) (-397.493) [-394.353] (-396.034) * (-395.414) [-395.017] (-399.975) (-401.779) -- 0:00:52 186000 -- (-396.741) (-397.130) (-395.019) [-395.743] * (-394.942) [-395.156] (-395.288) (-403.351) -- 0:00:52 186500 -- (-394.995) (-397.767) (-396.683) [-397.182] * (-394.912) (-397.041) (-395.791) [-399.338] -- 0:00:52 187000 -- (-396.361) (-395.306) (-394.896) [-395.782] * [-399.708] (-397.476) (-398.153) (-397.420) -- 0:00:52 187500 -- [-396.841] (-395.734) (-395.124) (-394.408) * (-399.020) (-395.527) (-395.948) [-398.243] -- 0:00:52 188000 -- (-398.327) (-399.702) (-398.550) [-396.617] * [-398.229] (-396.191) (-395.469) (-398.105) -- 0:00:51 188500 -- (-395.155) (-398.483) (-397.691) [-399.202] * [-397.532] (-398.111) (-398.245) (-397.276) -- 0:00:51 189000 -- (-395.893) [-395.695] (-395.488) (-397.220) * (-394.893) [-395.403] (-396.094) (-394.738) -- 0:00:51 189500 -- (-396.053) [-397.131] (-398.434) (-396.389) * (-396.744) (-396.516) (-395.300) [-395.593] -- 0:00:51 190000 -- (-396.230) (-396.723) (-396.787) [-399.888] * (-396.821) (-395.774) (-396.881) [-395.471] -- 0:00:51 Average standard deviation of split frequencies: 0.016194 190500 -- (-400.865) (-395.010) (-394.490) [-401.202] * (-396.079) (-395.124) (-396.954) [-394.922] -- 0:00:50 191000 -- [-396.254] (-398.032) (-395.781) (-397.212) * (-394.875) [-395.698] (-396.246) (-397.539) -- 0:00:50 191500 -- (-396.630) (-395.811) (-396.679) [-397.762] * (-395.408) (-394.400) (-398.006) [-394.345] -- 0:00:50 192000 -- [-397.411] (-396.967) (-398.430) (-399.195) * (-397.078) [-394.982] (-398.753) (-394.407) -- 0:00:50 192500 -- (-397.101) (-395.820) [-395.407] (-396.039) * (-397.711) (-395.609) (-397.235) [-395.434] -- 0:00:50 193000 -- (-396.231) (-396.618) [-395.175] (-398.977) * (-399.522) (-396.056) [-396.640] (-396.144) -- 0:00:50 193500 -- (-395.179) [-396.706] (-395.559) (-395.292) * (-397.885) (-397.844) [-394.544] (-396.286) -- 0:00:50 194000 -- [-394.919] (-399.057) (-398.983) (-398.073) * (-394.367) (-397.013) (-396.836) [-394.583] -- 0:00:49 194500 -- [-397.207] (-396.544) (-396.397) (-396.014) * (-394.702) (-394.416) (-396.269) [-397.440] -- 0:00:49 195000 -- (-396.744) [-396.660] (-395.573) (-395.244) * (-397.587) (-395.618) (-397.682) [-397.745] -- 0:00:49 Average standard deviation of split frequencies: 0.015950 195500 -- (-395.409) [-397.637] (-397.263) (-398.163) * (-397.874) [-396.300] (-402.433) (-396.827) -- 0:00:49 196000 -- (-401.985) [-395.336] (-403.374) (-395.916) * (-397.139) [-398.315] (-399.981) (-398.282) -- 0:00:49 196500 -- (-396.348) (-395.562) [-395.372] (-395.322) * (-396.643) (-398.397) [-395.068] (-396.210) -- 0:00:49 197000 -- (-395.424) (-394.450) [-398.863] (-395.695) * (-398.599) (-394.810) [-394.753] (-397.346) -- 0:00:48 197500 -- [-395.561] (-396.284) (-397.736) (-394.930) * [-395.665] (-394.012) (-395.787) (-398.384) -- 0:00:48 198000 -- (-398.820) [-396.032] (-394.818) (-401.060) * (-398.826) (-399.178) (-396.364) [-396.653] -- 0:00:48 198500 -- (-397.755) (-396.870) [-396.534] (-397.620) * (-395.125) (-396.474) (-394.835) [-394.489] -- 0:00:48 199000 -- (-396.860) [-394.733] (-397.977) (-399.736) * (-396.205) [-396.007] (-395.960) (-395.295) -- 0:00:48 199500 -- [-395.701] (-394.914) (-398.118) (-397.923) * (-395.143) (-396.581) [-400.066] (-396.973) -- 0:00:48 200000 -- (-395.822) [-397.104] (-397.349) (-395.251) * (-395.732) (-399.194) [-398.489] (-397.875) -- 0:00:48 Average standard deviation of split frequencies: 0.016939 200500 -- (-396.817) (-397.642) [-395.228] (-394.941) * (-396.696) (-401.226) (-397.707) [-394.857] -- 0:00:51 201000 -- (-397.296) [-397.547] (-395.243) (-395.892) * (-394.675) (-397.392) [-396.737] (-396.176) -- 0:00:51 201500 -- (-398.011) (-394.479) (-397.192) [-394.963] * (-395.841) (-395.771) [-395.855] (-394.763) -- 0:00:51 202000 -- [-397.356] (-394.114) (-397.181) (-396.506) * (-398.049) (-398.049) [-397.025] (-399.402) -- 0:00:51 202500 -- [-398.499] (-398.040) (-394.157) (-395.948) * (-398.495) [-396.433] (-394.255) (-396.148) -- 0:00:51 203000 -- [-398.008] (-396.193) (-397.173) (-397.223) * (-397.453) (-397.520) (-398.533) [-395.865] -- 0:00:51 203500 -- [-394.685] (-395.447) (-395.068) (-401.311) * (-395.260) (-397.513) [-397.398] (-398.986) -- 0:00:50 204000 -- (-395.761) (-395.739) [-394.416] (-394.770) * [-397.344] (-396.151) (-394.298) (-394.202) -- 0:00:50 204500 -- (-398.487) (-396.342) (-396.194) [-394.090] * [-395.500] (-397.779) (-396.756) (-397.259) -- 0:00:50 205000 -- (-395.137) (-400.337) [-398.206] (-395.968) * (-396.091) (-398.635) (-396.919) [-398.093] -- 0:00:50 Average standard deviation of split frequencies: 0.015447 205500 -- (-395.641) [-398.267] (-396.901) (-397.620) * (-398.491) (-399.253) [-394.355] (-394.882) -- 0:00:50 206000 -- (-396.584) (-397.813) (-396.431) [-399.829] * (-398.730) (-397.996) (-397.433) [-399.491] -- 0:00:50 206500 -- (-395.275) (-394.685) (-396.994) [-395.441] * (-395.725) (-395.145) (-398.890) [-394.751] -- 0:00:49 207000 -- (-395.170) (-394.423) [-396.342] (-395.634) * (-395.875) [-396.166] (-398.121) (-394.918) -- 0:00:49 207500 -- [-394.488] (-400.175) (-394.804) (-396.348) * (-396.261) (-399.911) (-394.980) [-395.236] -- 0:00:49 208000 -- (-398.027) (-394.984) (-398.293) [-398.261] * (-395.233) (-395.786) (-394.339) [-399.261] -- 0:00:49 208500 -- (-395.856) [-397.291] (-397.146) (-396.574) * (-398.029) [-397.194] (-397.682) (-399.522) -- 0:00:49 209000 -- (-396.044) (-399.789) [-398.104] (-402.919) * (-394.631) (-396.782) (-394.993) [-395.135] -- 0:00:49 209500 -- (-396.308) (-396.243) (-396.536) [-396.063] * (-395.271) (-396.105) (-396.993) [-396.371] -- 0:00:49 210000 -- (-394.215) (-397.852) (-394.184) [-401.096] * (-397.814) [-396.873] (-397.786) (-394.369) -- 0:00:48 Average standard deviation of split frequencies: 0.016253 210500 -- (-399.541) (-396.405) [-398.431] (-397.898) * (-397.267) (-396.370) (-396.576) [-396.367] -- 0:00:48 211000 -- (-397.813) (-396.877) [-394.990] (-396.893) * [-396.950] (-394.628) (-396.575) (-395.614) -- 0:00:48 211500 -- (-403.650) (-395.140) (-396.761) [-400.478] * (-395.649) [-394.345] (-399.664) (-396.914) -- 0:00:48 212000 -- (-396.066) [-395.237] (-396.121) (-397.935) * (-395.632) (-394.892) (-397.122) [-397.149] -- 0:00:48 212500 -- [-394.677] (-403.379) (-394.236) (-397.572) * (-402.151) (-398.238) (-396.808) [-396.212] -- 0:00:48 213000 -- (-395.500) [-397.049] (-400.290) (-396.142) * (-399.781) (-400.039) (-399.757) [-394.775] -- 0:00:48 213500 -- (-395.438) [-398.567] (-397.736) (-394.285) * (-403.199) [-394.587] (-396.597) (-396.285) -- 0:00:47 214000 -- (-398.173) (-401.251) [-396.591] (-395.393) * (-397.666) (-395.842) (-398.455) [-395.695] -- 0:00:47 214500 -- (-398.719) (-395.365) (-400.010) [-395.353] * (-397.508) [-401.023] (-394.888) (-396.890) -- 0:00:47 215000 -- (-397.955) (-394.904) (-395.866) [-396.236] * (-395.449) (-398.959) [-395.637] (-396.812) -- 0:00:47 Average standard deviation of split frequencies: 0.015059 215500 -- [-396.890] (-394.696) (-397.161) (-396.015) * (-397.069) (-399.997) [-397.144] (-396.628) -- 0:00:47 216000 -- (-398.000) [-394.860] (-396.286) (-395.417) * (-398.361) (-397.972) [-396.741] (-398.020) -- 0:00:47 216500 -- (-395.727) (-395.871) (-395.352) [-397.155] * (-394.880) (-395.379) [-395.819] (-400.681) -- 0:00:47 217000 -- (-400.664) (-396.725) (-402.757) [-397.292] * [-395.049] (-399.048) (-396.928) (-396.104) -- 0:00:50 217500 -- (-398.487) (-396.140) [-396.002] (-397.115) * (-395.913) [-395.576] (-396.952) (-394.993) -- 0:00:50 218000 -- (-395.584) [-394.468] (-398.551) (-396.271) * (-395.121) [-394.134] (-397.565) (-401.179) -- 0:00:50 218500 -- (-396.198) [-394.264] (-394.929) (-397.154) * (-394.770) [-394.398] (-394.935) (-395.803) -- 0:00:50 219000 -- (-395.362) (-397.252) (-398.500) [-397.093] * (-396.463) (-398.236) [-396.157] (-394.839) -- 0:00:49 219500 -- (-394.526) (-395.595) (-396.884) [-396.561] * (-396.597) (-396.918) [-396.748] (-394.126) -- 0:00:49 220000 -- [-395.966] (-396.455) (-394.728) (-401.671) * (-396.266) (-396.306) (-398.030) [-395.145] -- 0:00:49 Average standard deviation of split frequencies: 0.015274 220500 -- (-400.637) (-396.072) [-395.282] (-397.834) * [-398.783] (-396.175) (-397.496) (-395.413) -- 0:00:49 221000 -- (-397.301) (-395.783) (-396.958) [-394.622] * (-399.586) (-399.444) (-397.113) [-396.636] -- 0:00:49 221500 -- [-396.411] (-395.303) (-398.061) (-397.831) * (-398.356) (-395.188) [-398.304] (-397.384) -- 0:00:49 222000 -- (-394.888) (-397.423) (-395.772) [-394.699] * [-394.503] (-395.750) (-395.045) (-401.832) -- 0:00:49 222500 -- (-395.322) (-395.612) (-404.163) [-395.355] * (-395.965) (-396.748) [-395.541] (-403.831) -- 0:00:48 223000 -- (-394.718) (-397.894) (-408.603) [-396.501] * (-397.300) (-396.609) [-396.907] (-397.689) -- 0:00:48 223500 -- (-395.927) (-394.606) (-405.039) [-395.017] * (-395.406) [-398.685] (-395.755) (-398.320) -- 0:00:48 224000 -- (-399.764) (-394.900) (-394.941) [-395.533] * (-396.048) [-396.648] (-394.154) (-395.132) -- 0:00:48 224500 -- (-397.710) (-396.073) [-395.434] (-394.572) * [-398.276] (-396.459) (-394.291) (-394.626) -- 0:00:48 225000 -- (-396.350) (-396.643) (-396.704) [-394.038] * (-399.144) (-395.031) [-394.845] (-396.276) -- 0:00:48 Average standard deviation of split frequencies: 0.014810 225500 -- [-398.025] (-398.384) (-395.424) (-395.037) * [-396.718] (-395.360) (-396.673) (-397.515) -- 0:00:48 226000 -- (-395.915) [-395.067] (-395.378) (-395.216) * (-395.499) [-395.680] (-397.150) (-395.970) -- 0:00:47 226500 -- (-397.468) (-398.099) (-396.802) [-394.802] * (-394.848) (-394.760) (-396.313) [-394.637] -- 0:00:47 227000 -- (-396.224) (-397.622) [-397.690] (-394.642) * (-394.567) [-395.703] (-397.057) (-398.802) -- 0:00:47 227500 -- (-395.184) (-400.007) (-395.557) [-394.620] * [-398.363] (-400.529) (-394.819) (-397.732) -- 0:00:47 228000 -- (-396.560) [-400.893] (-394.593) (-396.893) * (-396.669) (-394.464) [-398.141] (-395.377) -- 0:00:47 228500 -- (-396.516) (-397.609) (-398.998) [-394.314] * (-397.508) (-394.679) (-395.844) [-395.956] -- 0:00:47 229000 -- [-398.002] (-394.435) (-396.334) (-394.631) * [-394.758] (-396.771) (-396.517) (-396.075) -- 0:00:47 229500 -- [-394.600] (-395.509) (-396.518) (-395.585) * [-394.467] (-402.114) (-396.723) (-396.102) -- 0:00:47 230000 -- [-397.426] (-396.035) (-395.870) (-395.922) * (-394.463) (-399.095) [-398.474] (-396.603) -- 0:00:46 Average standard deviation of split frequencies: 0.014079 230500 -- (-395.179) (-395.973) [-396.159] (-397.281) * (-399.253) [-395.456] (-396.828) (-396.072) -- 0:00:46 231000 -- [-397.019] (-394.437) (-396.647) (-396.018) * (-396.616) (-396.053) (-400.155) [-400.928] -- 0:00:46 231500 -- (-394.907) [-395.404] (-396.226) (-395.335) * (-396.305) (-394.157) [-400.436] (-395.583) -- 0:00:46 232000 -- (-397.796) (-402.653) (-397.767) [-394.868] * [-397.752] (-394.361) (-395.449) (-397.781) -- 0:00:46 232500 -- [-395.579] (-396.976) (-397.611) (-397.075) * [-396.083] (-394.228) (-397.177) (-397.452) -- 0:00:46 233000 -- (-395.443) (-394.788) (-395.340) [-394.712] * (-395.625) (-397.999) (-396.688) [-397.376] -- 0:00:46 233500 -- (-395.549) [-395.680] (-396.696) (-399.400) * (-395.041) (-399.229) [-398.339] (-395.946) -- 0:00:49 234000 -- (-394.916) [-396.014] (-401.708) (-397.230) * (-394.713) (-398.125) [-400.404] (-395.327) -- 0:00:49 234500 -- [-397.255] (-398.680) (-394.692) (-396.170) * (-396.271) [-396.549] (-397.546) (-395.894) -- 0:00:48 235000 -- (-396.084) [-395.657] (-396.684) (-398.470) * (-397.293) (-397.993) (-394.305) [-394.929] -- 0:00:48 Average standard deviation of split frequencies: 0.013871 235500 -- (-397.043) (-397.093) (-398.024) [-394.750] * (-400.644) (-402.338) (-395.822) [-396.243] -- 0:00:48 236000 -- (-402.803) (-396.546) [-395.718] (-398.579) * (-397.241) [-396.514] (-397.512) (-396.050) -- 0:00:48 236500 -- (-401.328) (-397.919) [-395.086] (-398.839) * (-395.752) (-398.333) [-395.734] (-402.094) -- 0:00:48 237000 -- (-397.863) (-397.141) [-394.790] (-395.645) * (-396.723) (-397.460) (-399.081) [-401.023] -- 0:00:48 237500 -- (-396.982) (-397.751) [-396.682] (-396.495) * (-395.557) (-397.794) (-394.478) [-397.421] -- 0:00:48 238000 -- (-396.448) (-396.255) [-398.834] (-394.724) * (-397.189) [-395.946] (-394.953) (-395.692) -- 0:00:48 238500 -- (-395.225) (-397.062) [-397.050] (-397.570) * (-398.370) (-400.240) (-395.638) [-395.430] -- 0:00:47 239000 -- (-396.366) [-400.884] (-396.910) (-399.808) * [-397.049] (-399.116) (-395.732) (-395.559) -- 0:00:47 239500 -- [-397.227] (-396.518) (-397.675) (-395.509) * [-395.575] (-397.210) (-395.567) (-395.887) -- 0:00:47 240000 -- (-400.611) [-396.659] (-398.254) (-396.323) * [-397.290] (-396.888) (-394.282) (-395.931) -- 0:00:47 Average standard deviation of split frequencies: 0.014473 240500 -- [-395.214] (-396.205) (-397.116) (-395.621) * (-395.903) (-399.776) [-396.774] (-395.417) -- 0:00:47 241000 -- (-397.056) [-400.303] (-395.108) (-396.952) * (-397.691) (-396.264) [-397.941] (-396.314) -- 0:00:47 241500 -- (-395.421) (-394.760) [-396.628] (-395.145) * (-395.119) (-395.507) [-395.931] (-398.073) -- 0:00:47 242000 -- (-395.778) (-395.483) [-398.971] (-397.256) * (-398.214) (-399.889) [-395.148] (-396.102) -- 0:00:46 242500 -- [-395.750] (-402.609) (-397.471) (-401.988) * (-396.630) (-398.865) [-395.527] (-397.665) -- 0:00:46 243000 -- (-395.741) (-401.054) (-396.549) [-394.987] * [-396.996] (-397.753) (-396.798) (-395.374) -- 0:00:46 243500 -- (-396.299) (-400.096) (-396.536) [-401.494] * (-394.153) (-397.078) (-399.122) [-394.815] -- 0:00:46 244000 -- (-394.792) (-395.754) (-397.712) [-399.593] * [-396.426] (-396.162) (-397.081) (-395.596) -- 0:00:46 244500 -- (-394.513) (-397.650) [-395.819] (-397.195) * (-396.487) [-396.597] (-395.045) (-401.074) -- 0:00:46 245000 -- (-398.021) (-397.239) [-395.749] (-395.484) * [-396.542] (-408.110) (-398.849) (-395.943) -- 0:00:46 Average standard deviation of split frequencies: 0.013414 245500 -- (-399.424) (-394.451) [-399.562] (-394.910) * (-397.107) (-399.057) (-398.152) [-395.554] -- 0:00:46 246000 -- (-400.206) [-399.387] (-396.840) (-395.325) * (-397.073) (-396.397) (-399.626) [-395.981] -- 0:00:45 246500 -- [-397.304] (-399.332) (-399.161) (-396.228) * [-395.210] (-397.946) (-396.658) (-396.266) -- 0:00:45 247000 -- [-397.046] (-395.993) (-398.044) (-396.838) * (-396.526) (-399.267) (-397.361) [-398.751] -- 0:00:45 247500 -- [-398.497] (-395.719) (-397.597) (-395.761) * (-397.029) (-397.811) (-394.601) [-395.927] -- 0:00:45 248000 -- (-395.407) (-396.985) (-396.938) [-396.238] * (-397.306) [-395.686] (-395.974) (-397.026) -- 0:00:45 248500 -- [-397.228] (-397.115) (-396.032) (-396.554) * [-397.197] (-396.047) (-396.249) (-396.182) -- 0:00:45 249000 -- [-395.473] (-402.877) (-395.779) (-396.286) * (-395.643) (-395.944) [-397.772] (-395.959) -- 0:00:45 249500 -- [-395.708] (-396.081) (-395.203) (-396.106) * (-401.402) (-395.353) (-397.798) [-398.709] -- 0:00:45 250000 -- (-396.025) [-401.733] (-396.800) (-396.766) * (-397.071) (-395.126) (-401.482) [-400.356] -- 0:00:48 Average standard deviation of split frequencies: 0.012328 250500 -- (-397.173) (-394.908) [-394.605] (-397.825) * (-396.750) (-395.799) [-396.703] (-395.491) -- 0:00:47 251000 -- (-393.993) [-398.688] (-398.852) (-398.538) * (-396.520) [-395.645] (-396.662) (-394.394) -- 0:00:47 251500 -- [-394.681] (-397.081) (-397.473) (-396.193) * (-396.641) (-395.716) (-394.983) [-396.276] -- 0:00:47 252000 -- (-398.871) (-398.070) (-398.072) [-395.170] * (-396.751) [-397.873] (-396.868) (-396.241) -- 0:00:47 252500 -- (-394.756) (-397.101) (-396.409) [-395.704] * (-404.119) (-396.174) [-400.436] (-400.714) -- 0:00:47 253000 -- (-396.459) (-395.962) (-394.876) [-399.935] * [-395.942] (-395.940) (-398.464) (-395.362) -- 0:00:47 253500 -- (-397.576) (-401.001) [-395.742] (-396.488) * [-394.358] (-395.014) (-397.335) (-398.338) -- 0:00:47 254000 -- (-395.041) (-399.118) [-397.260] (-396.066) * (-396.629) [-395.013] (-395.845) (-398.324) -- 0:00:46 254500 -- (-394.588) (-397.122) (-395.383) [-396.622] * (-395.221) [-398.439] (-398.384) (-401.469) -- 0:00:46 255000 -- [-398.517] (-410.369) (-397.134) (-397.016) * [-396.685] (-397.383) (-394.671) (-397.507) -- 0:00:46 Average standard deviation of split frequencies: 0.012174 255500 -- [-396.655] (-404.959) (-396.443) (-397.538) * (-395.263) (-395.392) (-397.122) [-397.311] -- 0:00:46 256000 -- (-397.180) (-397.320) (-397.072) [-395.381] * (-397.272) (-395.969) [-395.052] (-403.400) -- 0:00:46 256500 -- [-401.126] (-396.294) (-400.368) (-397.069) * (-395.648) [-394.778] (-398.141) (-403.740) -- 0:00:46 257000 -- (-401.801) (-397.894) [-400.549] (-399.656) * (-397.037) (-397.071) (-395.927) [-397.167] -- 0:00:46 257500 -- (-399.679) (-395.701) [-394.915] (-395.079) * (-397.737) (-399.248) [-394.748] (-398.577) -- 0:00:46 258000 -- (-397.198) (-395.640) [-395.826] (-397.688) * (-394.764) [-397.221] (-395.980) (-395.602) -- 0:00:46 258500 -- [-395.651] (-400.171) (-396.110) (-396.956) * (-395.940) (-396.733) [-396.132] (-396.384) -- 0:00:45 259000 -- (-395.513) (-397.872) [-396.214] (-396.742) * (-396.479) (-395.774) (-397.766) [-395.080] -- 0:00:45 259500 -- (-396.576) (-398.668) (-396.096) [-396.549] * (-396.850) (-396.882) (-397.414) [-395.053] -- 0:00:45 260000 -- [-395.484] (-399.412) (-397.689) (-397.640) * [-400.064] (-396.928) (-399.856) (-396.347) -- 0:00:45 Average standard deviation of split frequencies: 0.011655 260500 -- (-396.794) (-395.919) (-398.598) [-401.378] * (-394.761) (-394.565) [-397.595] (-397.914) -- 0:00:45 261000 -- (-397.269) [-394.798] (-394.940) (-398.363) * (-394.977) (-394.745) (-398.992) [-394.942] -- 0:00:45 261500 -- (-397.923) [-394.191] (-397.266) (-394.815) * (-397.596) (-399.566) (-397.540) [-395.202] -- 0:00:45 262000 -- (-396.643) (-395.934) [-394.495] (-395.978) * [-394.833] (-397.116) (-397.789) (-398.015) -- 0:00:45 262500 -- (-396.826) (-395.473) [-394.054] (-395.422) * (-396.187) [-400.978] (-397.599) (-395.874) -- 0:00:44 263000 -- (-395.379) [-399.479] (-397.085) (-397.774) * [-395.490] (-395.783) (-395.482) (-396.331) -- 0:00:44 263500 -- (-397.003) (-398.211) (-398.601) [-397.951] * (-395.466) [-395.303] (-395.560) (-399.714) -- 0:00:44 264000 -- (-400.591) (-398.677) (-396.352) [-394.951] * (-396.839) [-395.428] (-396.251) (-398.291) -- 0:00:44 264500 -- (-402.996) (-395.873) (-398.644) [-395.788] * (-396.099) [-396.060] (-395.470) (-395.165) -- 0:00:44 265000 -- (-397.172) (-398.955) [-395.378] (-396.736) * (-396.547) [-396.099] (-395.756) (-398.014) -- 0:00:44 Average standard deviation of split frequencies: 0.012701 265500 -- (-397.689) (-399.137) [-399.576] (-394.959) * [-394.901] (-394.620) (-396.839) (-395.051) -- 0:00:44 266000 -- (-400.701) (-398.308) (-397.927) [-396.262] * (-397.480) [-396.032] (-396.284) (-396.147) -- 0:00:44 266500 -- (-401.651) [-396.326] (-397.547) (-395.411) * (-396.933) (-402.525) [-395.840] (-396.417) -- 0:00:46 267000 -- (-396.204) [-395.682] (-397.187) (-396.281) * [-394.970] (-397.421) (-396.524) (-398.911) -- 0:00:46 267500 -- (-395.054) [-394.770] (-398.149) (-396.251) * [-395.774] (-396.807) (-395.086) (-395.991) -- 0:00:46 268000 -- (-395.087) (-395.567) [-394.087] (-404.133) * (-397.955) (-400.861) (-395.354) [-395.447] -- 0:00:46 268500 -- [-395.805] (-401.372) (-394.100) (-401.362) * (-394.940) [-394.217] (-397.574) (-396.712) -- 0:00:46 269000 -- [-396.584] (-396.688) (-394.920) (-398.452) * (-399.281) (-394.504) [-397.418] (-394.716) -- 0:00:46 269500 -- (-399.109) [-398.636] (-398.071) (-395.013) * (-397.197) (-395.146) (-394.584) [-395.206] -- 0:00:46 270000 -- (-396.915) (-396.268) (-396.798) [-396.726] * (-396.945) (-397.066) [-397.468] (-401.261) -- 0:00:45 Average standard deviation of split frequencies: 0.011708 270500 -- (-397.205) (-396.575) (-396.433) [-395.567] * [-397.725] (-397.469) (-395.482) (-397.678) -- 0:00:45 271000 -- (-400.239) [-394.187] (-394.878) (-397.611) * [-396.651] (-397.472) (-395.413) (-396.329) -- 0:00:45 271500 -- [-400.781] (-395.435) (-395.672) (-396.163) * [-395.327] (-395.397) (-394.850) (-397.716) -- 0:00:45 272000 -- (-396.232) [-396.130] (-400.426) (-396.247) * (-398.606) (-396.925) [-395.624] (-395.903) -- 0:00:45 272500 -- (-395.169) (-396.552) [-398.551] (-397.657) * (-396.695) (-397.369) [-396.065] (-396.970) -- 0:00:45 273000 -- (-397.290) (-398.886) (-398.605) [-397.575] * (-395.630) (-394.984) (-397.133) [-395.598] -- 0:00:45 273500 -- (-395.983) (-395.778) (-394.462) [-399.054] * (-397.695) (-399.235) [-395.139] (-396.220) -- 0:00:45 274000 -- (-395.358) [-395.986] (-394.463) (-398.681) * [-395.501] (-395.449) (-394.797) (-397.491) -- 0:00:45 274500 -- (-395.390) [-394.977] (-394.772) (-402.512) * (-396.666) (-394.035) [-394.809] (-397.576) -- 0:00:44 275000 -- [-395.681] (-398.963) (-394.509) (-397.943) * [-395.456] (-395.525) (-399.077) (-394.965) -- 0:00:44 Average standard deviation of split frequencies: 0.010722 275500 -- (-396.874) (-397.489) (-395.735) [-396.930] * [-395.212] (-397.436) (-398.404) (-400.246) -- 0:00:44 276000 -- [-395.748] (-394.639) (-399.197) (-398.683) * (-394.065) [-396.389] (-394.954) (-399.429) -- 0:00:44 276500 -- (-396.498) [-399.556] (-397.581) (-395.327) * (-395.145) [-394.688] (-397.014) (-395.988) -- 0:00:44 277000 -- [-395.414] (-396.607) (-395.972) (-397.814) * (-398.470) [-395.143] (-395.454) (-396.718) -- 0:00:44 277500 -- [-394.344] (-395.467) (-398.578) (-402.346) * [-397.808] (-396.068) (-394.917) (-403.494) -- 0:00:44 278000 -- (-395.701) (-398.686) [-396.136] (-397.414) * (-396.104) (-397.069) [-396.492] (-397.372) -- 0:00:44 278500 -- [-396.261] (-399.797) (-396.901) (-395.274) * (-394.752) (-395.033) (-397.800) [-395.708] -- 0:00:44 279000 -- [-396.880] (-395.766) (-394.887) (-396.202) * (-394.424) (-396.281) [-398.188] (-395.663) -- 0:00:43 279500 -- (-396.416) (-396.561) (-394.897) [-395.308] * (-397.912) (-395.583) (-396.749) [-397.576] -- 0:00:43 280000 -- (-397.995) (-396.806) (-398.189) [-397.760] * (-395.401) [-396.461] (-398.323) (-398.716) -- 0:00:43 Average standard deviation of split frequencies: 0.010264 280500 -- (-396.451) (-395.183) [-398.734] (-396.634) * (-397.723) (-397.880) [-397.031] (-397.138) -- 0:00:43 281000 -- (-399.338) (-395.289) (-396.541) [-395.719] * [-394.777] (-399.193) (-395.354) (-395.788) -- 0:00:43 281500 -- (-396.613) [-395.335] (-398.119) (-399.365) * (-395.439) (-398.926) [-394.409] (-395.324) -- 0:00:43 282000 -- (-395.462) [-395.997] (-395.488) (-396.151) * (-396.693) (-396.501) [-396.220] (-399.346) -- 0:00:43 282500 -- (-394.933) [-394.232] (-395.147) (-396.315) * (-396.659) [-399.446] (-396.572) (-399.266) -- 0:00:43 283000 -- (-395.819) [-398.156] (-395.614) (-395.023) * (-398.736) (-395.955) (-395.895) [-398.940] -- 0:00:45 283500 -- (-394.695) (-394.693) [-395.003] (-396.701) * (-395.366) (-399.059) (-396.043) [-394.695] -- 0:00:45 284000 -- (-395.234) (-399.125) [-396.403] (-397.085) * (-396.057) (-394.632) [-394.304] (-395.753) -- 0:00:45 284500 -- (-396.886) (-399.859) [-396.440] (-396.151) * (-397.005) (-395.033) [-397.414] (-396.815) -- 0:00:45 285000 -- (-395.520) [-397.522] (-396.480) (-396.470) * [-395.498] (-396.267) (-395.036) (-399.881) -- 0:00:45 Average standard deviation of split frequencies: 0.008608 285500 -- (-395.371) (-394.276) (-397.191) [-395.687] * [-395.036] (-395.041) (-394.819) (-396.167) -- 0:00:45 286000 -- (-395.467) (-394.929) (-395.176) [-394.954] * (-396.283) [-396.828] (-398.523) (-394.938) -- 0:00:44 286500 -- (-397.633) [-394.284] (-396.083) (-396.836) * (-396.450) (-395.716) [-395.312] (-394.631) -- 0:00:44 287000 -- (-395.636) [-396.669] (-398.411) (-395.371) * (-394.358) (-397.095) (-395.049) [-395.145] -- 0:00:44 287500 -- (-396.752) (-396.704) (-394.706) [-395.138] * (-400.518) (-396.993) [-399.033] (-398.447) -- 0:00:44 288000 -- (-399.011) [-394.971] (-404.184) (-403.271) * [-395.449] (-394.870) (-399.030) (-399.358) -- 0:00:44 288500 -- (-398.129) [-395.998] (-397.426) (-395.434) * (-398.214) (-394.471) [-396.370] (-399.644) -- 0:00:44 289000 -- (-397.942) [-396.386] (-398.994) (-394.797) * (-394.729) (-395.949) (-397.502) [-395.615] -- 0:00:44 289500 -- (-394.226) (-395.898) (-396.243) [-395.346] * (-394.448) [-395.210] (-397.374) (-398.834) -- 0:00:44 290000 -- (-397.275) (-396.651) [-395.175] (-396.664) * [-396.987] (-399.052) (-397.099) (-396.873) -- 0:00:44 Average standard deviation of split frequencies: 0.007749 290500 -- (-397.218) [-394.513] (-397.382) (-396.357) * (-395.581) (-397.363) [-394.487] (-399.997) -- 0:00:43 291000 -- (-398.704) (-394.871) (-397.297) [-397.235] * [-397.576] (-394.072) (-397.383) (-397.234) -- 0:00:43 291500 -- (-395.836) (-396.159) (-399.181) [-395.517] * [-395.636] (-395.477) (-394.810) (-397.023) -- 0:00:43 292000 -- (-397.989) (-396.285) (-394.541) [-394.879] * (-396.797) [-395.413] (-397.615) (-396.125) -- 0:00:43 292500 -- [-395.175] (-395.596) (-395.048) (-401.045) * (-395.542) [-394.663] (-398.184) (-396.113) -- 0:00:43 293000 -- (-395.298) [-394.349] (-396.063) (-399.615) * [-398.059] (-395.138) (-397.095) (-396.523) -- 0:00:43 293500 -- (-394.981) (-397.792) (-397.444) [-394.175] * [-399.322] (-396.008) (-394.667) (-396.080) -- 0:00:43 294000 -- [-395.895] (-397.508) (-394.637) (-398.102) * (-397.961) (-395.991) [-395.070] (-396.212) -- 0:00:43 294500 -- [-396.871] (-399.938) (-394.517) (-396.115) * (-400.808) [-396.153] (-395.838) (-396.047) -- 0:00:43 295000 -- (-396.420) (-396.224) [-394.274] (-396.387) * (-396.417) (-396.735) (-398.306) [-396.909] -- 0:00:43 Average standard deviation of split frequencies: 0.007697 295500 -- (-399.657) [-394.221] (-395.185) (-399.200) * (-395.760) (-397.942) (-396.012) [-394.359] -- 0:00:42 296000 -- (-400.486) [-394.859] (-398.196) (-396.994) * (-397.073) [-395.484] (-395.427) (-395.351) -- 0:00:42 296500 -- [-395.391] (-395.316) (-395.585) (-395.595) * (-396.158) (-395.516) [-399.145] (-397.084) -- 0:00:42 297000 -- (-395.361) [-397.023] (-396.214) (-394.411) * (-396.209) (-396.714) (-396.955) [-395.334] -- 0:00:42 297500 -- [-396.458] (-403.645) (-396.535) (-394.459) * (-396.659) [-396.362] (-394.952) (-402.007) -- 0:00:42 298000 -- (-395.890) (-396.431) (-397.156) [-394.034] * (-395.660) (-395.976) [-395.250] (-395.418) -- 0:00:42 298500 -- (-398.582) [-396.667] (-397.243) (-394.408) * (-394.813) (-395.508) (-396.185) [-396.972] -- 0:00:42 299000 -- (-398.024) [-394.817] (-395.516) (-396.471) * [-396.099] (-394.808) (-394.697) (-397.564) -- 0:00:42 299500 -- (-397.734) [-398.505] (-395.645) (-394.693) * [-395.181] (-395.028) (-397.767) (-398.710) -- 0:00:44 300000 -- (-396.627) (-402.524) [-397.328] (-396.786) * (-394.005) (-395.924) (-395.636) [-395.315] -- 0:00:44 Average standard deviation of split frequencies: 0.007747 300500 -- (-394.994) [-399.075] (-397.698) (-397.733) * (-396.981) (-395.296) [-395.975] (-396.786) -- 0:00:44 301000 -- [-396.835] (-394.433) (-394.476) (-395.858) * (-397.903) [-395.626] (-394.388) (-398.081) -- 0:00:44 301500 -- (-396.507) [-398.825] (-402.222) (-394.860) * (-398.877) (-398.572) [-397.403] (-394.728) -- 0:00:44 302000 -- (-403.671) [-396.139] (-396.422) (-394.252) * (-395.123) (-395.809) [-397.056] (-399.470) -- 0:00:43 302500 -- (-395.844) (-396.275) [-395.249] (-395.924) * (-398.207) (-394.950) (-395.574) [-394.670] -- 0:00:43 303000 -- (-396.187) (-395.698) (-395.693) [-397.964] * (-398.328) [-395.330] (-397.017) (-399.691) -- 0:00:43 303500 -- [-394.376] (-396.762) (-394.903) (-399.108) * [-394.767] (-395.701) (-396.840) (-396.281) -- 0:00:43 304000 -- (-394.685) [-394.922] (-394.412) (-396.217) * (-395.267) [-395.030] (-395.265) (-399.944) -- 0:00:43 304500 -- (-396.564) (-395.783) [-396.620] (-396.364) * (-396.338) (-395.390) (-394.661) [-397.202] -- 0:00:43 305000 -- (-396.002) [-394.902] (-397.448) (-394.213) * (-395.325) (-394.262) [-395.693] (-401.916) -- 0:00:43 Average standard deviation of split frequencies: 0.007189 305500 -- (-397.312) (-402.335) (-397.232) [-397.528] * (-395.069) (-398.411) [-397.916] (-405.676) -- 0:00:43 306000 -- [-396.255] (-398.357) (-397.194) (-396.798) * [-394.433] (-397.204) (-394.824) (-402.832) -- 0:00:43 306500 -- (-395.743) (-395.633) (-396.341) [-395.629] * (-394.912) [-395.465] (-394.527) (-399.610) -- 0:00:42 307000 -- (-396.527) (-394.712) (-396.294) [-395.598] * (-395.692) [-400.347] (-395.092) (-394.267) -- 0:00:42 307500 -- (-396.895) (-394.907) (-396.484) [-394.520] * (-395.356) (-397.584) [-394.033] (-395.643) -- 0:00:42 308000 -- (-407.048) (-395.914) (-398.381) [-396.048] * (-395.978) (-398.373) [-396.440] (-396.336) -- 0:00:42 308500 -- [-397.434] (-398.075) (-394.624) (-397.210) * (-394.945) (-396.187) (-395.345) [-395.328] -- 0:00:42 309000 -- [-398.337] (-399.175) (-396.877) (-397.049) * (-394.549) [-395.883] (-394.934) (-395.021) -- 0:00:42 309500 -- (-396.700) (-398.740) (-399.681) [-399.021] * [-394.744] (-395.452) (-396.046) (-398.568) -- 0:00:42 310000 -- (-397.312) [-397.440] (-395.672) (-394.434) * (-395.686) (-394.193) [-398.944] (-396.365) -- 0:00:42 Average standard deviation of split frequencies: 0.007165 310500 -- [-395.308] (-394.991) (-396.072) (-395.935) * [-395.041] (-396.963) (-396.504) (-397.444) -- 0:00:42 311000 -- [-393.985] (-397.823) (-395.384) (-394.678) * [-396.554] (-394.317) (-403.762) (-397.962) -- 0:00:42 311500 -- (-398.778) [-394.949] (-395.425) (-394.882) * (-396.073) [-395.344] (-398.246) (-395.419) -- 0:00:41 312000 -- (-398.290) (-395.676) (-397.175) [-398.000] * (-397.281) (-397.502) [-396.550] (-395.501) -- 0:00:41 312500 -- (-399.157) [-394.512] (-401.065) (-395.954) * [-396.045] (-398.980) (-397.020) (-395.549) -- 0:00:41 313000 -- (-395.061) [-394.742] (-395.637) (-394.868) * (-398.131) (-396.051) [-395.688] (-395.808) -- 0:00:41 313500 -- (-396.040) [-395.461] (-396.935) (-397.375) * (-396.283) (-397.549) (-395.634) [-394.910] -- 0:00:41 314000 -- [-395.324] (-397.605) (-395.914) (-396.341) * [-394.800] (-397.902) (-396.115) (-397.013) -- 0:00:41 314500 -- [-394.258] (-397.050) (-394.947) (-395.983) * (-400.570) [-399.212] (-396.758) (-396.109) -- 0:00:41 315000 -- (-399.475) [-398.299] (-401.088) (-394.630) * (-396.672) [-397.454] (-401.810) (-395.340) -- 0:00:41 Average standard deviation of split frequencies: 0.007045 315500 -- (-402.887) (-395.614) [-394.336] (-396.410) * [-395.742] (-395.352) (-398.479) (-395.183) -- 0:00:41 316000 -- [-397.871] (-395.825) (-396.379) (-395.279) * [-394.510] (-395.137) (-398.225) (-395.506) -- 0:00:43 316500 -- (-394.991) [-395.866] (-398.168) (-396.350) * [-394.790] (-395.648) (-395.907) (-394.724) -- 0:00:43 317000 -- [-394.516] (-399.344) (-396.842) (-400.157) * (-395.694) (-395.086) [-396.625] (-396.335) -- 0:00:43 317500 -- (-395.406) [-395.389] (-398.313) (-399.619) * (-399.193) [-395.594] (-394.779) (-396.074) -- 0:00:42 318000 -- [-395.976] (-395.789) (-396.836) (-397.393) * (-395.269) (-397.288) (-399.225) [-399.131] -- 0:00:42 318500 -- (-396.509) (-396.770) [-398.418] (-398.219) * (-396.697) (-395.960) [-396.046] (-398.719) -- 0:00:42 319000 -- (-402.165) [-395.151] (-396.026) (-396.743) * (-395.443) (-395.800) [-395.147] (-396.813) -- 0:00:42 319500 -- (-395.560) (-395.722) [-395.613] (-396.619) * (-395.921) (-395.062) (-394.916) [-397.208] -- 0:00:42 320000 -- (-396.579) [-396.329] (-395.158) (-395.700) * (-395.443) (-396.170) [-396.276] (-394.678) -- 0:00:42 Average standard deviation of split frequencies: 0.008129 320500 -- [-399.069] (-395.813) (-396.793) (-394.977) * (-395.513) (-394.573) [-396.025] (-398.612) -- 0:00:42 321000 -- [-403.510] (-396.380) (-398.462) (-394.846) * [-398.069] (-396.129) (-395.206) (-397.010) -- 0:00:42 321500 -- (-401.747) (-397.484) (-398.006) [-395.908] * (-396.186) (-395.192) (-394.621) [-396.552] -- 0:00:42 322000 -- (-398.293) (-397.548) [-403.699] (-394.322) * (-395.301) [-395.643] (-394.966) (-397.545) -- 0:00:42 322500 -- [-395.680] (-394.114) (-397.421) (-395.774) * (-396.080) (-397.966) (-393.926) [-396.418] -- 0:00:42 323000 -- [-396.772] (-396.055) (-396.172) (-399.515) * (-400.642) (-396.260) (-394.341) [-395.229] -- 0:00:41 323500 -- (-396.208) (-398.383) (-395.347) [-394.642] * (-394.872) (-397.385) [-401.881] (-397.542) -- 0:00:41 324000 -- [-397.251] (-396.384) (-400.157) (-398.657) * (-396.035) [-396.247] (-397.744) (-395.357) -- 0:00:41 324500 -- [-398.340] (-400.507) (-399.402) (-396.944) * (-397.821) (-397.148) (-394.917) [-394.603] -- 0:00:41 325000 -- (-395.603) (-394.504) [-401.259] (-401.195) * (-399.240) [-397.159] (-396.796) (-394.600) -- 0:00:41 Average standard deviation of split frequencies: 0.008421 325500 -- (-398.062) (-396.358) [-395.562] (-394.921) * (-394.932) [-401.006] (-398.961) (-394.783) -- 0:00:41 326000 -- (-397.036) (-395.226) [-396.670] (-396.755) * [-397.641] (-398.053) (-398.283) (-395.335) -- 0:00:41 326500 -- (-400.885) [-396.240] (-394.925) (-396.696) * (-399.323) (-398.610) (-399.913) [-396.961] -- 0:00:41 327000 -- (-397.601) [-395.170] (-397.055) (-394.885) * (-395.854) (-397.290) (-395.173) [-397.540] -- 0:00:41 327500 -- (-396.110) [-396.401] (-394.384) (-397.387) * (-395.962) (-400.276) (-403.392) [-397.713] -- 0:00:41 328000 -- [-396.724] (-396.131) (-395.828) (-394.904) * (-394.298) (-395.541) (-401.103) [-395.665] -- 0:00:40 328500 -- [-394.808] (-396.078) (-395.432) (-395.979) * (-397.145) [-394.221] (-396.089) (-399.832) -- 0:00:40 329000 -- (-396.385) (-395.594) (-397.124) [-397.955] * [-399.248] (-395.271) (-395.499) (-395.366) -- 0:00:40 329500 -- (-399.429) (-399.424) [-397.508] (-395.095) * [-398.574] (-399.287) (-394.685) (-394.404) -- 0:00:40 330000 -- (-399.568) (-396.039) (-396.121) [-395.293] * (-398.694) (-398.943) (-395.616) [-396.458] -- 0:00:40 Average standard deviation of split frequencies: 0.008134 330500 -- (-397.086) [-396.272] (-402.138) (-399.037) * [-395.508] (-398.513) (-397.299) (-395.864) -- 0:00:40 331000 -- (-397.023) [-395.746] (-395.940) (-395.285) * (-397.583) (-396.777) [-395.306] (-394.908) -- 0:00:40 331500 -- (-396.754) (-395.538) (-396.056) [-396.768] * (-395.242) (-395.456) [-396.812] (-395.948) -- 0:00:40 332000 -- (-396.174) (-395.281) (-394.621) [-394.898] * (-395.305) [-396.592] (-397.393) (-398.088) -- 0:00:40 332500 -- (-395.040) [-395.305] (-396.212) (-397.507) * [-397.697] (-397.334) (-397.916) (-398.282) -- 0:00:42 333000 -- (-395.250) (-395.796) [-397.982] (-398.000) * (-395.621) [-395.322] (-397.255) (-396.260) -- 0:00:42 333500 -- (-400.668) [-395.233] (-396.907) (-394.242) * (-395.637) (-396.000) (-395.608) [-394.631] -- 0:00:41 334000 -- [-397.463] (-397.825) (-397.853) (-394.604) * [-395.640] (-395.692) (-396.426) (-398.699) -- 0:00:41 334500 -- (-397.980) (-395.275) [-396.445] (-394.243) * (-394.640) (-397.886) [-399.163] (-396.523) -- 0:00:41 335000 -- (-398.059) [-397.453] (-395.076) (-395.279) * (-395.107) [-398.461] (-395.040) (-400.056) -- 0:00:41 Average standard deviation of split frequencies: 0.008748 335500 -- (-395.128) (-399.133) (-398.399) [-394.611] * (-397.394) (-395.335) [-394.788] (-397.521) -- 0:00:41 336000 -- [-394.723] (-397.326) (-394.682) (-394.942) * (-396.182) (-395.471) [-394.443] (-394.852) -- 0:00:41 336500 -- (-394.973) (-396.636) (-396.672) [-394.711] * (-395.236) [-397.471] (-395.994) (-394.447) -- 0:00:41 337000 -- (-396.585) (-402.693) [-394.819] (-394.699) * (-394.357) (-396.541) [-395.239] (-395.396) -- 0:00:41 337500 -- (-396.332) [-395.554] (-395.364) (-396.487) * (-394.310) (-396.722) [-395.541] (-395.306) -- 0:00:41 338000 -- (-397.134) [-397.252] (-398.138) (-395.148) * (-395.790) (-396.934) (-395.778) [-401.493] -- 0:00:41 338500 -- (-397.936) [-396.014] (-394.831) (-397.170) * [-394.432] (-396.911) (-395.359) (-397.894) -- 0:00:41 339000 -- (-396.424) (-397.874) (-398.183) [-397.399] * (-394.441) [-396.565] (-397.000) (-395.837) -- 0:00:40 339500 -- (-398.761) [-395.922] (-398.999) (-397.756) * (-396.677) (-395.058) [-397.972] (-400.843) -- 0:00:40 340000 -- (-400.046) [-395.424] (-398.672) (-396.848) * (-396.736) (-398.693) [-398.513] (-395.201) -- 0:00:40 Average standard deviation of split frequencies: 0.008465 340500 -- (-396.794) [-397.525] (-397.497) (-396.378) * (-401.884) [-398.052] (-396.730) (-397.096) -- 0:00:40 341000 -- [-394.649] (-398.892) (-397.728) (-398.086) * (-394.934) (-397.208) [-395.616] (-397.566) -- 0:00:40 341500 -- (-395.801) [-400.393] (-395.539) (-398.013) * (-394.892) (-394.908) [-395.430] (-398.676) -- 0:00:40 342000 -- (-395.461) (-398.753) (-394.870) [-397.081] * (-395.990) (-396.755) (-396.158) [-395.487] -- 0:00:40 342500 -- [-397.229] (-397.561) (-394.115) (-395.817) * (-396.436) (-398.065) [-397.007] (-394.331) -- 0:00:40 343000 -- (-394.467) (-401.585) (-394.494) [-396.619] * (-395.252) (-397.023) [-394.547] (-394.300) -- 0:00:40 343500 -- [-394.958] (-397.124) (-394.450) (-395.635) * (-396.646) (-396.111) [-394.846] (-396.860) -- 0:00:40 344000 -- (-396.461) (-394.274) (-395.195) [-395.763] * (-395.455) [-395.754] (-393.953) (-398.362) -- 0:00:40 344500 -- (-395.276) (-395.433) [-397.460] (-396.572) * (-397.166) [-396.815] (-395.876) (-396.654) -- 0:00:39 345000 -- (-396.939) [-398.458] (-401.067) (-396.568) * [-398.532] (-399.513) (-395.238) (-396.702) -- 0:00:39 Average standard deviation of split frequencies: 0.007645 345500 -- [-399.516] (-396.188) (-397.368) (-398.808) * (-395.798) (-398.614) (-396.796) [-396.825] -- 0:00:39 346000 -- (-399.009) (-396.879) [-398.484] (-397.341) * [-396.023] (-399.362) (-395.467) (-394.633) -- 0:00:39 346500 -- (-396.262) [-397.857] (-395.508) (-396.467) * (-396.596) (-396.854) [-397.779] (-401.783) -- 0:00:39 347000 -- [-396.138] (-395.452) (-396.833) (-398.132) * (-396.086) (-395.792) [-397.268] (-397.856) -- 0:00:39 347500 -- [-395.055] (-395.201) (-398.201) (-396.630) * [-397.607] (-395.753) (-396.605) (-397.392) -- 0:00:39 348000 -- [-398.431] (-396.107) (-394.296) (-397.310) * (-397.027) (-395.490) [-401.874] (-398.685) -- 0:00:39 348500 -- (-396.602) (-398.261) [-396.568] (-395.833) * [-395.682] (-395.378) (-396.842) (-404.226) -- 0:00:39 349000 -- (-398.160) (-394.737) [-396.947] (-396.184) * (-395.776) [-395.705] (-396.373) (-396.327) -- 0:00:41 349500 -- (-395.711) (-396.295) [-395.525] (-396.621) * [-396.977] (-402.840) (-396.473) (-400.352) -- 0:00:40 350000 -- (-395.245) (-397.958) (-395.625) [-396.187] * (-394.651) [-398.535] (-396.978) (-406.069) -- 0:00:40 Average standard deviation of split frequencies: 0.007394 350500 -- (-394.931) (-396.001) [-396.457] (-397.596) * [-395.786] (-395.360) (-396.155) (-397.643) -- 0:00:40 351000 -- [-396.589] (-395.131) (-395.454) (-394.785) * (-396.770) (-398.269) (-395.295) [-400.402] -- 0:00:40 351500 -- (-400.405) (-394.358) [-396.268] (-395.784) * (-394.547) [-398.753] (-395.866) (-397.048) -- 0:00:40 352000 -- (-397.131) [-394.381] (-396.953) (-394.285) * [-395.869] (-396.922) (-395.283) (-395.009) -- 0:00:40 352500 -- (-401.450) (-395.417) (-394.370) [-395.553] * (-397.407) (-395.975) [-394.454] (-395.789) -- 0:00:40 353000 -- (-395.556) [-396.641] (-402.631) (-395.779) * (-396.907) (-396.122) (-398.106) [-395.047] -- 0:00:40 353500 -- (-397.909) (-395.715) (-398.237) [-396.761] * [-396.199] (-394.734) (-396.299) (-395.494) -- 0:00:40 354000 -- [-398.576] (-396.092) (-394.744) (-401.563) * (-395.791) (-395.949) (-394.196) [-395.215] -- 0:00:40 354500 -- (-396.654) (-398.417) [-395.540] (-398.752) * [-396.839] (-394.726) (-395.401) (-397.189) -- 0:00:40 355000 -- [-395.975] (-395.859) (-394.644) (-396.467) * (-398.979) (-394.056) [-394.860] (-396.788) -- 0:00:39 Average standard deviation of split frequencies: 0.007209 355500 -- [-396.233] (-398.228) (-395.215) (-394.689) * [-397.935] (-395.550) (-398.877) (-396.476) -- 0:00:39 356000 -- (-395.555) [-398.162] (-397.872) (-397.200) * [-398.111] (-396.729) (-395.979) (-394.946) -- 0:00:39 356500 -- (-397.004) (-395.376) [-397.736] (-397.729) * [-395.430] (-395.814) (-395.779) (-398.913) -- 0:00:39 357000 -- (-396.522) (-395.589) (-395.425) [-394.723] * (-394.984) (-397.044) (-400.710) [-396.279] -- 0:00:39 357500 -- (-399.423) [-396.053] (-396.683) (-397.063) * (-398.875) (-394.442) [-398.856] (-396.777) -- 0:00:39 358000 -- (-394.976) (-395.983) (-397.402) [-398.752] * [-398.458] (-394.776) (-398.323) (-394.973) -- 0:00:39 358500 -- [-396.176] (-399.515) (-398.966) (-397.873) * (-397.469) (-396.931) (-398.400) [-394.523] -- 0:00:39 359000 -- (-397.322) (-397.465) (-396.073) [-397.964] * (-396.885) (-397.162) (-401.275) [-396.942] -- 0:00:39 359500 -- (-396.162) (-396.712) (-399.471) [-397.593] * (-396.197) [-397.752] (-400.256) (-396.850) -- 0:00:39 360000 -- (-395.096) [-397.140] (-397.093) (-401.311) * (-395.663) (-395.616) [-396.866] (-396.234) -- 0:00:39 Average standard deviation of split frequencies: 0.007552 360500 -- [-395.598] (-394.864) (-395.602) (-395.810) * (-395.267) (-401.827) (-397.150) [-396.678] -- 0:00:39 361000 -- (-394.956) [-395.006] (-397.209) (-396.302) * (-397.280) (-399.780) [-395.821] (-399.546) -- 0:00:38 361500 -- (-396.553) (-395.660) (-395.870) [-395.521] * (-396.341) (-397.190) (-395.562) [-398.076] -- 0:00:38 362000 -- [-399.796] (-397.878) (-394.636) (-396.559) * (-394.591) (-395.651) (-397.511) [-397.361] -- 0:00:38 362500 -- (-396.013) (-396.293) [-396.812] (-396.617) * [-398.147] (-395.686) (-398.134) (-399.706) -- 0:00:38 363000 -- [-395.240] (-398.235) (-397.976) (-397.702) * [-397.154] (-398.923) (-396.790) (-398.496) -- 0:00:38 363500 -- [-395.333] (-395.885) (-395.089) (-398.752) * [-396.128] (-394.515) (-394.273) (-407.060) -- 0:00:38 364000 -- (-397.631) (-398.244) (-400.325) [-397.594] * (-400.766) [-395.408] (-395.132) (-397.215) -- 0:00:38 364500 -- (-395.075) (-399.276) (-395.138) [-396.549] * (-395.442) (-396.378) (-395.974) [-397.071] -- 0:00:38 365000 -- [-395.134] (-397.901) (-395.724) (-394.566) * (-395.669) [-396.635] (-394.059) (-397.808) -- 0:00:38 Average standard deviation of split frequencies: 0.007513 365500 -- (-395.911) (-394.933) (-394.819) [-394.940] * (-394.455) (-394.540) (-401.099) [-395.895] -- 0:00:38 366000 -- [-395.491] (-395.606) (-395.112) (-396.081) * (-395.632) (-396.150) (-403.396) [-397.948] -- 0:00:39 366500 -- [-397.066] (-395.666) (-394.147) (-395.600) * (-396.199) [-396.582] (-398.790) (-400.602) -- 0:00:39 367000 -- (-396.804) (-394.739) (-398.030) [-396.453] * (-399.683) (-394.430) [-396.214] (-396.726) -- 0:00:39 367500 -- (-396.589) [-399.319] (-394.785) (-396.341) * (-400.351) [-396.016] (-398.455) (-396.629) -- 0:00:39 368000 -- (-394.556) (-399.889) [-394.043] (-396.481) * (-399.604) (-397.294) [-396.080] (-395.937) -- 0:00:39 368500 -- [-394.329] (-397.882) (-394.257) (-396.473) * [-398.644] (-394.560) (-396.766) (-396.676) -- 0:00:39 369000 -- (-396.502) [-400.804] (-395.595) (-397.692) * (-398.447) (-395.513) (-397.717) [-397.080] -- 0:00:39 369500 -- (-396.174) (-396.720) [-394.475] (-396.092) * [-395.270] (-396.440) (-398.564) (-396.244) -- 0:00:39 370000 -- (-399.207) [-395.754] (-394.519) (-397.534) * [-396.602] (-396.628) (-400.359) (-400.232) -- 0:00:39 Average standard deviation of split frequencies: 0.008408 370500 -- (-397.051) [-399.005] (-396.907) (-405.214) * (-395.335) [-396.460] (-399.330) (-400.919) -- 0:00:39 371000 -- [-395.871] (-399.776) (-396.396) (-404.088) * (-393.908) (-394.818) (-397.716) [-395.707] -- 0:00:38 371500 -- (-396.301) (-395.105) (-396.209) [-397.318] * (-397.576) (-398.111) (-396.213) [-395.850] -- 0:00:38 372000 -- (-395.073) (-394.659) [-395.532] (-395.730) * (-396.954) [-397.242] (-395.797) (-395.753) -- 0:00:38 372500 -- (-394.832) (-394.586) [-397.455] (-401.325) * (-397.048) [-396.627] (-396.895) (-399.186) -- 0:00:38 373000 -- (-394.701) (-399.366) (-397.170) [-396.173] * [-396.795] (-399.227) (-395.839) (-396.582) -- 0:00:38 373500 -- (-394.919) (-400.836) (-394.507) [-398.884] * (-396.699) (-397.440) [-394.515] (-397.246) -- 0:00:38 374000 -- (-397.273) (-399.408) (-399.076) [-397.194] * (-396.354) (-396.581) [-395.062] (-396.563) -- 0:00:38 374500 -- [-394.297] (-395.869) (-396.128) (-398.974) * (-395.558) (-394.972) (-396.080) [-395.565] -- 0:00:38 375000 -- (-397.546) (-395.495) [-394.928] (-395.387) * (-397.666) (-396.795) (-397.663) [-394.529] -- 0:00:38 Average standard deviation of split frequencies: 0.008149 375500 -- (-394.980) (-401.457) [-395.099] (-395.312) * (-394.264) (-396.744) [-395.783] (-396.882) -- 0:00:38 376000 -- (-397.513) [-403.532] (-395.055) (-394.815) * (-394.275) (-398.170) (-395.909) [-394.965] -- 0:00:38 376500 -- (-395.777) [-400.067] (-395.813) (-401.792) * (-394.244) (-397.944) (-397.331) [-396.428] -- 0:00:38 377000 -- (-396.982) (-397.745) (-397.025) [-398.804] * (-396.931) (-399.855) [-397.658] (-394.609) -- 0:00:38 377500 -- [-398.709] (-396.114) (-398.865) (-394.763) * (-396.130) (-399.597) (-397.356) [-396.596] -- 0:00:37 378000 -- (-395.423) [-397.087] (-400.082) (-395.758) * (-397.521) (-398.832) [-396.827] (-395.827) -- 0:00:37 378500 -- (-395.910) (-400.340) (-398.100) [-397.744] * (-396.001) [-399.650] (-395.138) (-395.740) -- 0:00:37 379000 -- (-400.724) [-402.063] (-396.866) (-398.864) * (-397.881) (-402.838) (-395.259) [-395.908] -- 0:00:37 379500 -- (-396.720) [-395.603] (-395.844) (-395.787) * (-399.226) [-397.530] (-396.818) (-395.420) -- 0:00:37 380000 -- (-398.167) [-397.791] (-395.643) (-394.539) * [-398.756] (-398.165) (-396.500) (-394.243) -- 0:00:37 Average standard deviation of split frequencies: 0.008204 380500 -- (-397.284) (-395.452) [-398.478] (-394.515) * (-397.118) (-398.619) (-395.221) [-397.523] -- 0:00:37 381000 -- (-397.494) (-395.444) [-395.792] (-396.425) * (-396.628) (-396.755) (-396.563) [-395.360] -- 0:00:37 381500 -- [-395.810] (-398.522) (-395.921) (-400.370) * (-394.516) (-395.995) [-394.846] (-400.073) -- 0:00:37 382000 -- (-395.759) [-397.913] (-394.333) (-401.066) * (-396.801) [-394.359] (-395.467) (-394.523) -- 0:00:37 382500 -- (-395.236) (-395.806) [-395.814] (-396.189) * [-396.227] (-395.448) (-395.402) (-401.431) -- 0:00:37 383000 -- (-399.358) (-396.674) [-396.511] (-395.798) * (-395.618) (-395.580) [-397.256] (-396.198) -- 0:00:38 383500 -- (-398.445) (-396.279) [-397.955] (-396.358) * [-400.679] (-395.104) (-403.410) (-394.451) -- 0:00:38 384000 -- [-395.328] (-401.404) (-395.367) (-395.509) * (-399.257) (-399.068) (-397.726) [-394.007] -- 0:00:38 384500 -- (-396.045) [-398.430] (-398.173) (-398.003) * [-395.234] (-396.890) (-396.284) (-400.789) -- 0:00:38 385000 -- (-394.811) [-396.039] (-395.901) (-394.967) * (-396.467) (-397.888) (-395.884) [-398.707] -- 0:00:38 Average standard deviation of split frequencies: 0.008549 385500 -- (-396.518) (-396.650) (-396.765) [-396.602] * (-398.770) [-395.110] (-396.388) (-395.004) -- 0:00:38 386000 -- (-397.993) [-394.698] (-396.041) (-395.425) * (-396.072) [-395.715] (-397.802) (-395.403) -- 0:00:38 386500 -- (-397.815) (-398.901) (-395.733) [-397.025] * (-395.080) (-398.539) [-395.840] (-397.465) -- 0:00:38 387000 -- (-395.746) [-394.968] (-395.062) (-396.808) * (-396.823) (-398.363) [-395.188] (-396.103) -- 0:00:38 387500 -- (-399.272) [-397.565] (-394.060) (-399.312) * (-397.452) (-397.426) (-399.468) [-395.203] -- 0:00:37 388000 -- (-395.250) [-400.618] (-394.726) (-395.032) * (-398.054) (-396.682) [-399.288] (-395.000) -- 0:00:37 388500 -- [-395.340] (-399.878) (-394.688) (-396.460) * (-395.524) (-398.560) (-397.050) [-395.967] -- 0:00:37 389000 -- (-395.548) [-397.530] (-395.165) (-394.832) * (-397.769) (-395.767) (-396.742) [-396.846] -- 0:00:37 389500 -- [-396.287] (-402.446) (-396.102) (-397.212) * (-400.194) [-397.964] (-396.336) (-398.209) -- 0:00:37 390000 -- (-398.281) (-395.263) (-395.165) [-394.387] * (-397.597) (-396.058) [-397.017] (-395.186) -- 0:00:37 Average standard deviation of split frequencies: 0.007542 390500 -- (-395.621) (-396.320) [-396.307] (-398.270) * (-397.562) (-396.427) (-401.858) [-396.427] -- 0:00:37 391000 -- (-396.817) (-395.184) (-395.708) [-395.434] * (-396.108) (-395.454) [-397.782] (-395.727) -- 0:00:37 391500 -- (-396.061) (-397.329) [-397.112] (-396.472) * (-396.120) (-401.593) [-396.421] (-396.413) -- 0:00:37 392000 -- (-399.424) (-398.245) (-397.591) [-396.559] * [-400.802] (-399.865) (-397.554) (-394.796) -- 0:00:37 392500 -- [-399.217] (-399.638) (-395.864) (-400.958) * (-395.686) (-396.289) [-395.071] (-397.853) -- 0:00:37 393000 -- (-398.335) (-399.723) [-396.167] (-396.302) * (-395.353) [-396.240] (-394.612) (-396.372) -- 0:00:37 393500 -- (-397.701) (-394.909) [-395.831] (-396.635) * (-394.914) (-397.026) (-395.182) [-397.093] -- 0:00:36 394000 -- (-397.321) [-395.772] (-395.669) (-395.781) * (-395.027) (-397.803) [-394.660] (-394.249) -- 0:00:36 394500 -- [-394.745] (-397.061) (-397.515) (-398.060) * (-398.280) (-396.506) (-394.333) [-395.165] -- 0:00:36 395000 -- (-401.725) [-397.078] (-399.272) (-399.237) * [-396.536] (-398.430) (-396.122) (-397.605) -- 0:00:36 Average standard deviation of split frequencies: 0.007843 395500 -- (-395.317) [-394.999] (-395.587) (-396.931) * (-399.368) (-396.680) (-397.554) [-397.958] -- 0:00:36 396000 -- (-394.628) (-397.555) [-394.422] (-397.460) * (-395.659) (-396.078) [-396.906] (-396.286) -- 0:00:36 396500 -- (-398.696) [-395.825] (-395.761) (-395.510) * (-395.612) (-394.710) [-397.245] (-395.556) -- 0:00:36 397000 -- (-396.552) (-396.257) [-395.824] (-394.367) * [-394.000] (-395.478) (-395.375) (-397.036) -- 0:00:36 397500 -- (-400.197) [-395.020] (-394.864) (-394.765) * (-396.760) [-397.926] (-396.193) (-397.283) -- 0:00:36 398000 -- [-397.658] (-395.294) (-395.232) (-395.322) * (-399.114) [-396.851] (-398.565) (-396.615) -- 0:00:36 398500 -- (-395.898) [-396.443] (-396.924) (-395.260) * [-396.605] (-396.604) (-398.050) (-395.665) -- 0:00:36 399000 -- [-394.767] (-396.164) (-394.995) (-396.132) * (-397.094) (-402.620) (-395.777) [-396.841] -- 0:00:36 399500 -- (-396.716) (-397.843) (-395.065) [-400.523] * (-395.302) (-402.382) [-396.587] (-396.040) -- 0:00:36 400000 -- (-396.128) (-401.803) (-395.077) [-396.289] * (-397.601) (-396.922) (-396.900) [-396.272] -- 0:00:36 Average standard deviation of split frequencies: 0.007475 400500 -- (-396.058) (-398.987) (-395.818) [-395.447] * (-395.644) (-397.938) (-399.416) [-397.418] -- 0:00:37 401000 -- [-400.366] (-395.698) (-395.855) (-395.077) * (-395.771) (-397.611) [-396.806] (-399.700) -- 0:00:37 401500 -- (-398.310) (-398.735) (-396.976) [-394.994] * [-395.025] (-397.221) (-398.784) (-397.339) -- 0:00:37 402000 -- (-396.321) (-399.213) (-397.068) [-397.880] * (-396.600) (-402.425) (-395.360) [-396.853] -- 0:00:37 402500 -- (-398.423) (-395.598) [-399.153] (-395.670) * (-402.900) (-398.477) [-397.037] (-400.662) -- 0:00:37 403000 -- (-396.641) [-395.913] (-397.387) (-394.857) * [-399.893] (-396.351) (-396.409) (-395.175) -- 0:00:37 403500 -- (-398.969) [-395.196] (-396.939) (-396.138) * [-398.190] (-395.794) (-399.402) (-396.782) -- 0:00:36 404000 -- (-394.961) (-396.309) [-396.244] (-394.658) * (-396.679) (-395.810) (-397.079) [-394.433] -- 0:00:36 404500 -- (-396.024) [-395.861] (-396.099) (-396.860) * [-396.175] (-394.285) (-395.653) (-394.587) -- 0:00:36 405000 -- (-397.205) (-397.194) (-394.333) [-394.424] * (-395.083) [-397.323] (-396.815) (-396.038) -- 0:00:36 Average standard deviation of split frequencies: 0.007934 405500 -- (-399.131) (-398.447) [-398.290] (-396.884) * (-394.864) (-397.051) (-397.004) [-395.942] -- 0:00:36 406000 -- [-396.672] (-396.775) (-400.227) (-398.426) * (-395.841) (-396.885) [-397.852] (-396.902) -- 0:00:36 406500 -- [-395.406] (-396.359) (-399.442) (-396.340) * [-395.865] (-394.430) (-397.930) (-396.188) -- 0:00:36 407000 -- (-394.781) [-396.065] (-394.900) (-394.978) * (-395.484) (-395.763) (-401.023) [-398.143] -- 0:00:36 407500 -- (-394.829) (-397.260) [-394.614] (-394.868) * [-397.390] (-395.582) (-402.983) (-396.761) -- 0:00:36 408000 -- (-396.824) (-397.099) (-394.139) [-399.072] * (-395.646) (-396.035) (-396.489) [-398.837] -- 0:00:36 408500 -- (-399.442) (-398.702) [-394.033] (-401.114) * [-394.701] (-395.624) (-401.646) (-394.877) -- 0:00:36 409000 -- (-395.292) (-397.354) [-394.614] (-403.237) * (-399.351) (-394.602) [-401.318] (-395.412) -- 0:00:36 409500 -- [-394.757] (-395.969) (-394.626) (-399.658) * [-396.505] (-394.664) (-396.556) (-401.366) -- 0:00:36 410000 -- (-398.507) [-394.202] (-394.562) (-396.004) * (-396.735) [-394.734] (-395.754) (-394.681) -- 0:00:35 Average standard deviation of split frequencies: 0.008103 410500 -- [-394.907] (-394.574) (-394.581) (-395.039) * (-394.998) (-400.082) [-396.777] (-396.240) -- 0:00:35 411000 -- (-395.700) (-399.152) (-398.231) [-396.284] * (-395.417) [-397.258] (-394.429) (-397.140) -- 0:00:35 411500 -- (-395.870) (-400.364) (-395.331) [-395.064] * (-399.197) (-396.635) (-395.243) [-396.955] -- 0:00:35 412000 -- (-397.442) (-396.584) [-395.757] (-399.183) * [-398.980] (-395.291) (-396.218) (-395.814) -- 0:00:35 412500 -- (-398.143) [-394.933] (-397.362) (-396.801) * (-397.343) (-395.484) (-396.622) [-395.976] -- 0:00:35 413000 -- (-395.718) [-395.625] (-398.438) (-396.034) * (-400.555) (-396.443) [-395.634] (-395.524) -- 0:00:35 413500 -- (-398.226) (-397.070) (-396.950) [-395.812] * (-396.693) (-395.012) [-395.135] (-395.526) -- 0:00:35 414000 -- (-395.649) (-394.823) [-396.357] (-395.015) * (-395.963) [-395.561] (-401.039) (-396.826) -- 0:00:35 414500 -- [-395.578] (-394.945) (-396.095) (-394.735) * (-396.775) (-399.164) [-396.560] (-396.239) -- 0:00:35 415000 -- (-394.865) (-395.742) [-396.255] (-395.939) * (-395.073) (-395.537) [-396.796] (-400.916) -- 0:00:35 Average standard deviation of split frequencies: 0.007932 415500 -- (-395.270) (-398.015) (-401.583) [-395.436] * (-398.858) (-394.855) [-397.189] (-402.399) -- 0:00:35 416000 -- (-398.155) (-396.822) (-394.790) [-395.440] * (-398.100) (-396.835) [-395.515] (-397.033) -- 0:00:35 416500 -- [-395.965] (-400.925) (-397.792) (-395.878) * (-396.161) (-395.233) [-396.505] (-395.446) -- 0:00:35 417000 -- (-395.159) (-397.466) (-397.374) [-395.662] * (-395.005) [-399.758] (-401.538) (-395.227) -- 0:00:36 417500 -- [-397.535] (-401.521) (-398.780) (-397.502) * (-396.390) [-394.975] (-396.748) (-396.590) -- 0:00:36 418000 -- (-394.600) [-398.539] (-396.486) (-397.634) * [-398.036] (-397.001) (-399.345) (-396.955) -- 0:00:36 418500 -- (-395.559) [-396.098] (-396.197) (-395.507) * [-396.613] (-401.278) (-397.244) (-396.943) -- 0:00:36 419000 -- (-396.765) (-396.056) [-397.218] (-396.101) * (-398.820) [-396.982] (-401.602) (-396.445) -- 0:00:36 419500 -- (-399.997) (-399.996) [-395.518] (-395.058) * (-394.489) [-396.101] (-400.277) (-397.503) -- 0:00:35 420000 -- (-398.008) [-394.532] (-396.146) (-397.903) * [-398.103] (-395.595) (-398.777) (-395.398) -- 0:00:35 Average standard deviation of split frequencies: 0.008265 420500 -- (-397.307) [-395.752] (-396.433) (-396.325) * (-394.928) (-395.022) [-398.831] (-397.844) -- 0:00:35 421000 -- (-395.351) (-396.755) [-398.835] (-394.888) * (-394.338) (-395.127) [-397.327] (-396.049) -- 0:00:35 421500 -- [-395.925] (-395.791) (-395.387) (-395.137) * (-396.458) (-399.876) (-396.741) [-394.550] -- 0:00:35 422000 -- (-395.769) (-395.012) [-400.818] (-393.999) * [-396.687] (-396.917) (-397.869) (-394.872) -- 0:00:35 422500 -- (-395.366) [-395.606] (-395.478) (-394.575) * [-396.160] (-396.047) (-399.838) (-396.021) -- 0:00:35 423000 -- (-398.033) (-397.374) (-400.521) [-394.774] * (-396.324) (-395.686) [-395.818] (-399.859) -- 0:00:35 423500 -- (-396.491) [-396.620] (-400.038) (-397.640) * (-396.245) [-394.977] (-397.383) (-394.850) -- 0:00:35 424000 -- [-396.885] (-394.440) (-397.004) (-398.123) * (-394.320) (-399.919) (-395.099) [-395.663] -- 0:00:35 424500 -- (-401.476) (-397.430) (-395.216) [-400.519] * (-395.472) (-398.112) (-398.627) [-396.402] -- 0:00:35 425000 -- (-395.419) (-401.136) (-396.572) [-395.437] * (-395.865) [-396.934] (-399.781) (-395.239) -- 0:00:35 Average standard deviation of split frequencies: 0.008657 425500 -- [-396.263] (-395.833) (-394.392) (-397.440) * (-398.997) (-396.235) (-397.239) [-397.944] -- 0:00:35 426000 -- (-396.763) (-397.303) [-398.847] (-395.421) * (-397.304) (-397.165) [-396.762] (-396.139) -- 0:00:35 426500 -- (-395.956) (-394.229) (-395.284) [-395.404] * (-398.767) [-396.524] (-394.204) (-394.557) -- 0:00:34 427000 -- (-397.053) (-395.201) [-398.794] (-395.442) * [-398.459] (-397.277) (-395.334) (-397.073) -- 0:00:34 427500 -- (-396.985) (-395.541) [-395.656] (-397.404) * (-395.731) (-396.312) [-394.414] (-396.705) -- 0:00:34 428000 -- (-395.989) (-398.754) (-398.665) [-395.780] * (-395.084) (-398.625) [-395.716] (-401.058) -- 0:00:34 428500 -- [-396.050] (-398.963) (-396.153) (-397.688) * (-397.506) (-398.983) [-396.054] (-395.408) -- 0:00:34 429000 -- (-395.983) (-397.706) [-395.771] (-395.310) * [-400.515] (-395.610) (-394.563) (-396.966) -- 0:00:34 429500 -- (-398.989) (-395.937) [-395.942] (-395.481) * (-395.924) (-394.389) [-398.830] (-396.234) -- 0:00:34 430000 -- (-397.131) (-396.772) [-396.295] (-404.738) * (-395.034) [-398.622] (-399.691) (-396.551) -- 0:00:34 Average standard deviation of split frequencies: 0.008692 430500 -- (-395.703) [-396.235] (-396.074) (-400.318) * (-394.990) (-397.516) (-398.525) [-399.274] -- 0:00:34 431000 -- [-395.991] (-395.809) (-395.454) (-394.993) * (-396.807) [-399.368] (-396.263) (-397.683) -- 0:00:34 431500 -- (-396.691) (-394.794) [-396.924] (-396.520) * (-395.788) (-394.956) (-394.847) [-396.360] -- 0:00:34 432000 -- (-394.676) (-395.806) [-395.064] (-400.577) * (-399.638) (-395.177) [-398.359] (-400.371) -- 0:00:34 432500 -- (-395.129) (-395.679) (-395.383) [-397.769] * (-398.766) (-396.980) [-396.770] (-399.850) -- 0:00:34 433000 -- (-396.585) (-394.920) (-395.090) [-396.003] * [-396.401] (-396.773) (-397.648) (-398.327) -- 0:00:34 433500 -- (-405.219) (-394.521) [-394.082] (-395.781) * (-397.035) [-395.845] (-397.799) (-396.969) -- 0:00:33 434000 -- [-398.846] (-394.705) (-399.659) (-394.760) * (-395.246) (-394.125) [-396.546] (-394.846) -- 0:00:35 434500 -- (-395.998) (-398.045) [-396.003] (-397.131) * [-400.241] (-394.706) (-396.592) (-396.304) -- 0:00:35 435000 -- (-395.465) (-400.954) [-397.592] (-396.695) * (-396.051) (-407.772) (-397.162) [-395.795] -- 0:00:35 Average standard deviation of split frequencies: 0.008204 435500 -- [-394.855] (-395.234) (-397.026) (-398.744) * (-395.924) [-400.087] (-395.371) (-395.106) -- 0:00:34 436000 -- (-394.423) [-397.713] (-396.115) (-396.560) * (-396.216) (-395.326) (-397.789) [-394.969] -- 0:00:34 436500 -- (-394.780) [-398.638] (-395.234) (-396.708) * (-396.209) (-395.654) [-397.512] (-394.483) -- 0:00:34 437000 -- (-395.030) (-398.432) [-398.731] (-395.589) * (-397.272) (-396.865) (-395.146) [-395.609] -- 0:00:34 437500 -- (-395.084) [-395.706] (-399.387) (-406.705) * (-397.938) (-397.339) (-396.326) [-394.309] -- 0:00:34 438000 -- (-396.615) [-395.648] (-401.102) (-397.420) * (-394.963) (-395.706) [-394.992] (-395.756) -- 0:00:34 438500 -- (-397.767) (-395.167) (-395.585) [-396.039] * (-398.226) [-397.575] (-396.694) (-394.705) -- 0:00:34 439000 -- (-396.198) (-395.603) (-400.005) [-397.984] * [-397.521] (-396.555) (-396.896) (-400.408) -- 0:00:34 439500 -- (-396.662) (-398.475) [-395.272] (-396.151) * (-395.201) (-396.042) (-396.938) [-396.492] -- 0:00:34 440000 -- (-394.762) (-397.170) (-395.137) [-394.977] * [-399.895] (-398.825) (-394.692) (-395.748) -- 0:00:34 Average standard deviation of split frequencies: 0.007889 440500 -- [-395.171] (-394.730) (-398.036) (-397.769) * (-399.203) (-394.916) (-395.317) [-395.663] -- 0:00:34 441000 -- (-394.450) [-395.384] (-394.617) (-401.739) * (-396.154) (-396.566) (-394.506) [-394.759] -- 0:00:34 441500 -- (-397.482) [-396.511] (-394.980) (-395.112) * [-394.912] (-397.362) (-397.920) (-398.165) -- 0:00:34 442000 -- (-396.288) [-394.196] (-397.311) (-396.780) * (-395.445) (-395.469) [-395.607] (-396.077) -- 0:00:34 442500 -- (-396.870) [-395.008] (-397.324) (-396.062) * (-395.926) [-398.298] (-394.855) (-397.260) -- 0:00:34 443000 -- (-395.152) (-396.988) [-396.906] (-396.168) * (-395.464) (-397.932) (-394.790) [-395.609] -- 0:00:33 443500 -- [-395.190] (-398.866) (-395.258) (-394.099) * (-397.481) (-396.328) [-396.140] (-395.576) -- 0:00:33 444000 -- [-394.746] (-396.254) (-397.463) (-395.851) * (-396.996) (-396.245) [-398.173] (-396.320) -- 0:00:33 444500 -- (-397.357) (-397.276) [-394.810] (-395.476) * (-395.831) [-396.163] (-397.405) (-395.573) -- 0:00:33 445000 -- (-397.135) (-394.485) [-395.078] (-396.787) * (-396.492) [-398.371] (-399.693) (-398.393) -- 0:00:33 Average standard deviation of split frequencies: 0.008258 445500 -- (-396.728) (-396.833) (-395.357) [-397.356] * [-395.054] (-396.692) (-398.085) (-394.833) -- 0:00:33 446000 -- (-395.198) (-397.094) (-396.192) [-395.452] * (-394.730) (-398.292) [-395.388] (-395.590) -- 0:00:33 446500 -- [-394.664] (-395.989) (-395.268) (-394.204) * [-399.891] (-396.576) (-398.016) (-396.379) -- 0:00:33 447000 -- (-395.636) (-395.513) [-395.336] (-398.075) * (-397.362) [-397.556] (-394.404) (-396.538) -- 0:00:33 447500 -- (-394.573) (-396.932) [-396.329] (-395.312) * (-394.296) [-396.754] (-396.939) (-400.208) -- 0:00:33 448000 -- (-396.217) (-395.575) [-395.098] (-396.270) * (-400.211) (-396.641) (-395.269) [-396.552] -- 0:00:33 448500 -- (-399.591) [-395.144] (-394.221) (-395.526) * (-399.383) (-397.309) [-396.845] (-394.816) -- 0:00:33 449000 -- (-395.164) (-399.515) (-396.058) [-398.258] * (-396.308) (-395.225) (-394.331) [-394.725] -- 0:00:33 449500 -- (-397.190) (-400.150) (-399.902) [-396.433] * (-395.568) [-396.540] (-395.264) (-397.345) -- 0:00:33 450000 -- [-394.514] (-395.964) (-396.521) (-394.663) * (-395.400) [-395.948] (-395.651) (-395.424) -- 0:00:33 Average standard deviation of split frequencies: 0.008957 450500 -- (-394.509) (-394.925) (-396.871) [-395.002] * (-397.967) (-396.810) [-396.928] (-396.962) -- 0:00:34 451000 -- [-394.538] (-400.862) (-395.202) (-395.352) * (-394.955) (-396.675) [-395.626] (-395.444) -- 0:00:34 451500 -- (-396.556) [-395.811] (-394.665) (-396.143) * (-396.473) [-394.442] (-394.923) (-395.191) -- 0:00:34 452000 -- (-394.867) (-396.153) (-396.766) [-396.063] * (-396.389) (-396.992) (-394.203) [-397.632] -- 0:00:33 452500 -- (-396.651) (-395.619) (-397.290) [-396.224] * [-397.648] (-397.428) (-396.826) (-394.444) -- 0:00:33 453000 -- (-395.507) (-397.669) [-398.890] (-402.560) * [-398.429] (-394.911) (-395.093) (-394.295) -- 0:00:33 453500 -- (-394.293) (-396.196) (-396.496) [-400.625] * (-394.873) [-396.451] (-396.820) (-398.615) -- 0:00:33 454000 -- (-398.230) (-394.350) [-398.016] (-396.225) * [-395.356] (-394.609) (-396.820) (-396.351) -- 0:00:33 454500 -- [-396.487] (-394.752) (-394.277) (-394.885) * (-396.359) [-395.430] (-399.521) (-398.124) -- 0:00:33 455000 -- [-396.502] (-395.584) (-395.332) (-394.466) * (-395.996) (-394.501) (-395.797) [-396.990] -- 0:00:33 Average standard deviation of split frequencies: 0.008529 455500 -- [-396.573] (-396.436) (-397.600) (-394.045) * (-394.287) (-394.497) [-395.148] (-394.447) -- 0:00:33 456000 -- (-395.132) (-396.222) [-400.181] (-394.075) * [-394.974] (-394.137) (-396.761) (-396.136) -- 0:00:33 456500 -- [-400.703] (-396.601) (-400.283) (-394.161) * (-394.450) [-394.640] (-395.953) (-397.533) -- 0:00:33 457000 -- (-398.462) [-394.489] (-398.635) (-396.178) * (-395.640) (-397.084) [-397.285] (-399.030) -- 0:00:33 457500 -- (-397.580) (-396.053) [-397.050] (-394.765) * (-396.005) (-398.332) [-398.824] (-397.005) -- 0:00:33 458000 -- (-395.248) (-403.265) [-395.346] (-394.675) * (-398.886) (-401.304) [-395.366] (-398.288) -- 0:00:33 458500 -- [-395.737] (-395.977) (-400.508) (-395.876) * (-398.269) [-398.350] (-398.101) (-395.247) -- 0:00:33 459000 -- (-396.740) (-395.986) (-397.352) [-397.234] * (-395.966) [-395.282] (-396.821) (-397.682) -- 0:00:33 459500 -- (-394.913) [-401.464] (-395.919) (-395.030) * [-398.598] (-399.407) (-398.312) (-397.833) -- 0:00:32 460000 -- (-395.105) [-396.196] (-394.697) (-398.692) * [-395.572] (-399.062) (-396.870) (-396.385) -- 0:00:32 Average standard deviation of split frequencies: 0.008570 460500 -- (-396.931) [-395.967] (-397.856) (-397.683) * (-395.558) [-398.312] (-394.165) (-396.534) -- 0:00:32 461000 -- (-397.817) (-399.938) [-395.644] (-396.717) * (-396.953) (-396.579) [-395.563] (-400.200) -- 0:00:32 461500 -- (-400.105) (-396.778) (-396.361) [-394.491] * (-398.301) [-396.955] (-396.278) (-394.180) -- 0:00:32 462000 -- [-394.906] (-395.085) (-394.830) (-395.566) * (-396.339) [-399.058] (-393.967) (-395.085) -- 0:00:32 462500 -- (-402.281) (-399.348) (-396.502) [-394.508] * (-399.356) (-399.423) (-397.505) [-394.789] -- 0:00:32 463000 -- (-397.391) (-399.624) (-397.190) [-394.754] * (-396.929) (-399.085) (-395.145) [-395.358] -- 0:00:32 463500 -- (-396.173) (-399.738) (-395.128) [-397.067] * (-398.278) (-394.534) (-398.948) [-396.720] -- 0:00:32 464000 -- [-396.619] (-397.738) (-396.149) (-397.625) * (-398.079) [-396.116] (-394.964) (-396.235) -- 0:00:32 464500 -- (-397.420) (-395.838) [-398.089] (-396.255) * [-396.876] (-398.225) (-400.457) (-395.202) -- 0:00:32 465000 -- (-394.703) (-397.777) [-396.333] (-395.431) * [-396.976] (-398.864) (-401.052) (-395.441) -- 0:00:32 Average standard deviation of split frequencies: 0.008472 465500 -- (-395.116) (-396.294) [-399.836] (-403.517) * [-398.189] (-400.573) (-398.595) (-395.159) -- 0:00:32 466000 -- (-394.713) (-396.118) (-400.989) [-398.336] * [-399.436] (-395.270) (-396.906) (-397.144) -- 0:00:32 466500 -- (-395.436) (-397.604) [-396.938] (-394.960) * [-396.404] (-395.391) (-396.396) (-397.594) -- 0:00:32 467000 -- (-396.106) (-397.914) [-395.803] (-394.791) * (-398.351) [-397.202] (-398.312) (-399.172) -- 0:00:33 467500 -- (-396.021) [-395.242] (-395.982) (-398.366) * [-395.956] (-395.652) (-395.022) (-395.057) -- 0:00:33 468000 -- (-395.593) [-395.201] (-395.663) (-394.655) * [-394.414] (-395.989) (-397.612) (-396.489) -- 0:00:32 468500 -- (-397.930) [-394.884] (-397.886) (-398.016) * (-397.251) (-394.820) (-395.362) [-397.241] -- 0:00:32 469000 -- (-397.624) (-395.056) (-396.333) [-395.706] * (-400.275) (-397.555) [-395.703] (-395.259) -- 0:00:32 469500 -- (-396.966) (-395.380) [-395.730] (-398.389) * (-395.388) [-396.452] (-395.034) (-394.351) -- 0:00:32 470000 -- (-397.282) [-395.975] (-395.207) (-395.202) * (-397.463) [-399.644] (-398.138) (-396.090) -- 0:00:32 Average standard deviation of split frequencies: 0.008889 470500 -- (-395.940) [-395.131] (-396.274) (-396.536) * [-395.636] (-395.308) (-397.296) (-400.186) -- 0:00:32 471000 -- (-396.775) [-394.596] (-396.859) (-395.405) * (-395.902) [-395.501] (-396.360) (-398.403) -- 0:00:32 471500 -- (-401.483) (-397.414) [-396.637] (-394.337) * (-398.377) (-397.964) (-396.817) [-394.228] -- 0:00:32 472000 -- [-397.619] (-395.925) (-395.565) (-396.698) * [-395.488] (-400.115) (-395.903) (-396.874) -- 0:00:32 472500 -- (-397.516) (-394.797) (-395.511) [-397.165] * (-396.026) (-398.082) (-395.538) [-394.530] -- 0:00:32 473000 -- (-396.697) (-397.444) (-398.186) [-396.937] * (-403.963) (-397.563) (-398.700) [-395.183] -- 0:00:32 473500 -- (-395.558) (-395.279) [-399.152] (-396.300) * (-402.092) (-397.368) [-397.661] (-394.790) -- 0:00:32 474000 -- (-394.441) (-395.133) [-399.475] (-394.648) * (-398.050) (-401.136) (-397.471) [-395.270] -- 0:00:32 474500 -- [-394.885] (-394.717) (-398.286) (-395.749) * (-394.591) (-397.574) [-395.790] (-396.188) -- 0:00:32 475000 -- (-400.762) [-394.474] (-394.754) (-394.823) * [-396.124] (-400.099) (-398.812) (-395.716) -- 0:00:32 Average standard deviation of split frequencies: 0.008975 475500 -- (-396.456) [-397.209] (-395.757) (-394.842) * (-396.419) [-396.048] (-398.596) (-397.542) -- 0:00:31 476000 -- (-395.561) (-395.915) (-400.253) [-397.316] * (-395.221) (-396.113) (-398.842) [-395.456] -- 0:00:31 476500 -- (-395.036) (-396.109) (-394.851) [-400.501] * (-396.217) (-394.634) (-398.640) [-396.510] -- 0:00:31 477000 -- (-394.361) (-398.365) (-395.521) [-396.008] * (-399.439) (-397.783) [-395.764] (-395.108) -- 0:00:31 477500 -- [-396.006] (-394.732) (-402.510) (-395.186) * (-395.012) [-398.056] (-395.308) (-394.535) -- 0:00:31 478000 -- (-395.290) (-395.617) [-395.243] (-395.180) * (-397.259) [-396.621] (-394.197) (-395.040) -- 0:00:31 478500 -- (-396.480) (-395.429) [-397.332] (-396.112) * (-395.595) (-395.343) [-398.537] (-395.697) -- 0:00:31 479000 -- (-395.676) [-397.534] (-394.726) (-395.396) * (-399.043) (-398.402) (-398.566) [-397.547] -- 0:00:31 479500 -- [-395.053] (-395.981) (-396.224) (-394.816) * (-395.774) (-398.498) [-396.016] (-396.951) -- 0:00:31 480000 -- (-395.562) (-394.994) [-397.535] (-394.769) * (-395.945) [-395.768] (-398.695) (-397.705) -- 0:00:31 Average standard deviation of split frequencies: 0.010052 480500 -- (-395.317) [-396.364] (-397.172) (-396.060) * (-394.971) (-398.247) [-394.678] (-401.483) -- 0:00:31 481000 -- [-396.004] (-395.842) (-399.436) (-399.439) * (-394.962) (-397.496) [-394.843] (-394.577) -- 0:00:31 481500 -- (-395.746) [-394.744] (-395.243) (-397.464) * (-400.096) (-396.812) (-394.264) [-396.781] -- 0:00:31 482000 -- [-396.004] (-396.448) (-394.539) (-397.648) * [-397.543] (-397.483) (-398.605) (-394.877) -- 0:00:31 482500 -- (-401.806) (-395.866) (-396.174) [-397.920] * (-398.768) [-395.693] (-399.787) (-397.217) -- 0:00:31 483000 -- [-397.090] (-403.987) (-394.121) (-394.775) * [-394.681] (-396.366) (-400.559) (-395.602) -- 0:00:31 483500 -- (-395.241) (-400.730) [-399.756] (-397.339) * (-396.742) (-395.862) [-397.996] (-400.401) -- 0:00:32 484000 -- [-398.437] (-397.493) (-396.295) (-399.263) * (-399.026) (-394.929) [-394.789] (-395.720) -- 0:00:31 484500 -- [-396.478] (-397.029) (-395.287) (-395.974) * [-396.674] (-394.781) (-400.117) (-398.447) -- 0:00:31 485000 -- [-398.068] (-397.961) (-397.536) (-399.531) * (-401.050) [-397.962] (-395.971) (-394.596) -- 0:00:31 Average standard deviation of split frequencies: 0.009578 485500 -- [-394.736] (-395.019) (-398.743) (-395.988) * (-399.334) (-397.292) (-396.317) [-395.627] -- 0:00:31 486000 -- (-396.722) (-396.721) [-396.495] (-395.511) * (-399.477) (-397.561) [-395.730] (-397.869) -- 0:00:31 486500 -- (-394.030) [-395.749] (-398.791) (-398.022) * [-400.462] (-398.803) (-396.059) (-397.178) -- 0:00:31 487000 -- (-396.571) (-401.073) [-397.902] (-398.410) * (-396.034) (-397.495) [-396.467] (-397.717) -- 0:00:31 487500 -- [-396.043] (-397.626) (-400.804) (-403.250) * (-398.500) (-395.934) (-395.374) [-397.325] -- 0:00:31 488000 -- [-396.945] (-396.998) (-396.982) (-395.760) * (-396.526) [-396.366] (-394.977) (-396.360) -- 0:00:31 488500 -- (-396.367) [-397.539] (-395.054) (-395.678) * (-395.629) (-396.432) (-396.909) [-395.721] -- 0:00:31 489000 -- [-399.582] (-395.383) (-396.429) (-395.741) * (-394.918) (-395.322) (-397.042) [-396.407] -- 0:00:31 489500 -- (-401.612) (-395.386) [-396.046] (-395.644) * (-395.515) (-397.229) [-398.693] (-398.699) -- 0:00:31 490000 -- (-397.464) (-394.982) (-397.241) [-395.584] * (-396.268) (-399.136) (-399.700) [-395.953] -- 0:00:31 Average standard deviation of split frequencies: 0.009287 490500 -- [-398.829] (-397.327) (-395.754) (-394.870) * (-396.207) (-401.544) (-397.153) [-394.832] -- 0:00:31 491000 -- (-400.252) [-399.878] (-395.921) (-400.414) * (-402.753) (-397.642) (-396.386) [-395.422] -- 0:00:31 491500 -- (-397.327) (-397.847) (-397.662) [-395.061] * (-397.954) (-399.671) [-395.191] (-399.079) -- 0:00:31 492000 -- (-396.125) (-395.495) [-402.381] (-394.636) * (-399.447) (-396.959) [-394.586] (-397.696) -- 0:00:30 492500 -- (-395.068) (-396.496) (-396.004) [-395.761] * (-395.373) [-397.961] (-394.967) (-399.212) -- 0:00:30 493000 -- (-394.716) [-395.944] (-396.984) (-394.701) * (-398.628) (-397.790) [-400.136] (-397.782) -- 0:00:30 493500 -- (-396.261) [-394.919] (-397.581) (-394.913) * (-397.611) (-399.552) (-398.088) [-395.499] -- 0:00:30 494000 -- [-397.634] (-400.110) (-396.007) (-395.714) * (-398.459) [-396.740] (-397.934) (-396.115) -- 0:00:30 494500 -- [-396.495] (-397.794) (-397.586) (-398.680) * (-397.539) [-394.779] (-396.910) (-398.643) -- 0:00:30 495000 -- (-398.505) (-397.290) [-399.624] (-398.617) * (-395.722) (-395.806) [-398.302] (-395.637) -- 0:00:30 Average standard deviation of split frequencies: 0.008300 495500 -- (-398.400) [-395.754] (-397.133) (-397.280) * (-394.837) [-396.164] (-397.708) (-396.700) -- 0:00:30 496000 -- (-399.018) [-395.312] (-395.970) (-396.176) * (-396.430) [-394.878] (-394.764) (-397.166) -- 0:00:30 496500 -- (-398.963) (-397.630) [-401.176] (-395.141) * (-397.556) (-400.972) [-399.572] (-396.879) -- 0:00:30 497000 -- [-394.657] (-398.628) (-397.701) (-397.603) * (-400.537) [-395.821] (-394.793) (-397.306) -- 0:00:30 497500 -- [-396.374] (-398.705) (-395.485) (-395.763) * (-395.401) (-396.245) (-395.567) [-396.000] -- 0:00:30 498000 -- [-395.179] (-395.356) (-395.620) (-396.784) * (-397.903) (-398.092) [-399.993] (-395.334) -- 0:00:30 498500 -- (-396.409) (-396.259) [-395.128] (-395.678) * (-396.712) (-396.976) [-395.217] (-396.367) -- 0:00:30 499000 -- (-396.363) (-398.681) (-395.407) [-394.064] * [-398.623] (-397.450) (-395.317) (-396.377) -- 0:00:30 499500 -- (-394.930) (-398.860) (-396.039) [-395.901] * (-399.246) (-401.310) [-394.028] (-395.114) -- 0:00:30 500000 -- [-396.284] (-395.146) (-394.775) (-395.870) * (-396.750) (-396.130) [-394.169] (-395.397) -- 0:00:30 Average standard deviation of split frequencies: 0.008160 500500 -- (-398.856) [-395.651] (-396.479) (-395.017) * (-396.697) (-396.161) [-395.896] (-395.190) -- 0:00:30 501000 -- [-398.455] (-396.603) (-395.760) (-396.957) * (-394.864) [-395.183] (-397.830) (-395.264) -- 0:00:30 501500 -- (-394.985) (-396.143) [-396.570] (-395.426) * (-394.625) [-395.496] (-395.002) (-399.256) -- 0:00:30 502000 -- (-394.904) (-400.017) [-395.473] (-400.334) * (-394.656) (-396.417) (-396.926) [-401.174] -- 0:00:30 502500 -- (-398.683) (-402.417) (-395.657) [-399.632] * [-394.844] (-394.486) (-398.119) (-397.267) -- 0:00:30 503000 -- (-401.916) (-401.354) (-395.307) [-394.867] * [-395.065] (-398.903) (-395.349) (-398.681) -- 0:00:30 503500 -- (-397.985) (-398.834) [-397.566] (-396.579) * (-394.695) (-400.858) [-394.221] (-400.721) -- 0:00:30 504000 -- (-399.573) (-401.497) [-397.010] (-396.825) * [-396.331] (-396.668) (-394.922) (-397.267) -- 0:00:30 504500 -- (-398.039) (-398.316) [-395.302] (-399.676) * (-399.250) [-395.524] (-395.472) (-396.504) -- 0:00:30 505000 -- (-398.114) [-399.407] (-396.464) (-396.758) * (-396.630) (-395.766) (-397.297) [-394.828] -- 0:00:30 Average standard deviation of split frequencies: 0.008136 505500 -- [-396.318] (-397.641) (-402.153) (-394.787) * (-395.386) (-397.270) (-397.631) [-395.775] -- 0:00:30 506000 -- [-396.593] (-396.065) (-399.948) (-394.905) * (-395.931) (-394.791) (-396.450) [-400.052] -- 0:00:30 506500 -- (-394.420) (-394.647) (-401.577) [-395.629] * (-399.561) [-397.991] (-397.671) (-395.909) -- 0:00:30 507000 -- (-401.065) (-394.544) (-395.633) [-398.012] * (-397.825) (-396.183) (-396.714) [-396.995] -- 0:00:30 507500 -- (-395.864) (-397.886) [-395.433] (-398.266) * (-400.379) (-396.081) [-394.985] (-398.751) -- 0:00:30 508000 -- [-397.067] (-396.156) (-394.950) (-398.322) * (-394.296) [-394.863] (-396.982) (-395.452) -- 0:00:30 508500 -- [-395.022] (-394.388) (-396.092) (-396.196) * [-395.883] (-397.834) (-395.136) (-396.781) -- 0:00:29 509000 -- (-395.440) [-396.143] (-398.202) (-398.827) * (-396.737) [-395.917] (-394.948) (-395.149) -- 0:00:29 509500 -- [-398.801] (-394.499) (-396.098) (-400.359) * [-395.949] (-396.292) (-396.683) (-398.299) -- 0:00:29 510000 -- (-394.564) (-395.098) [-399.056] (-400.152) * (-399.229) [-396.637] (-397.113) (-399.301) -- 0:00:29 Average standard deviation of split frequencies: 0.008000 510500 -- [-395.151] (-395.237) (-394.560) (-402.676) * [-396.804] (-398.450) (-396.303) (-396.325) -- 0:00:29 511000 -- (-396.579) [-399.751] (-398.325) (-396.860) * (-396.558) (-395.426) [-395.948] (-398.664) -- 0:00:29 511500 -- (-397.143) (-397.215) (-399.025) [-398.630] * (-396.307) [-395.021] (-395.417) (-397.739) -- 0:00:29 512000 -- [-396.041] (-397.629) (-395.354) (-395.595) * (-396.882) (-396.464) (-397.438) [-394.008] -- 0:00:29 512500 -- (-399.095) (-395.956) [-395.171] (-400.016) * [-396.221] (-399.689) (-396.628) (-396.100) -- 0:00:29 513000 -- (-400.079) [-395.857] (-396.749) (-398.131) * (-399.350) (-395.874) (-396.522) [-400.169] -- 0:00:29 513500 -- [-399.381] (-398.088) (-396.455) (-397.069) * (-400.984) [-394.814] (-397.564) (-398.317) -- 0:00:29 514000 -- (-397.532) (-395.728) [-395.575] (-397.537) * (-396.306) (-394.630) [-395.120] (-395.375) -- 0:00:29 514500 -- (-394.646) (-395.330) [-395.384] (-396.213) * (-398.650) [-394.645] (-398.162) (-394.923) -- 0:00:29 515000 -- (-395.487) [-396.908] (-397.376) (-394.142) * (-398.950) (-395.884) (-399.540) [-398.188] -- 0:00:29 Average standard deviation of split frequencies: 0.008283 515500 -- (-396.682) (-397.449) (-394.706) [-394.506] * (-397.181) (-395.908) (-395.351) [-395.488] -- 0:00:29 516000 -- (-396.523) (-404.316) (-396.205) [-395.346] * [-395.130] (-396.799) (-398.210) (-394.891) -- 0:00:29 516500 -- (-397.761) [-396.698] (-398.731) (-397.122) * (-398.970) (-395.607) [-396.940] (-396.780) -- 0:00:29 517000 -- (-394.413) (-397.233) [-395.126] (-397.973) * (-395.397) (-396.668) (-395.303) [-396.123] -- 0:00:29 517500 -- (-396.611) (-397.190) (-395.138) [-396.535] * (-396.782) [-396.673] (-400.471) (-396.591) -- 0:00:29 518000 -- (-398.581) (-395.419) (-396.698) [-396.196] * (-396.608) (-395.880) (-395.652) [-396.272] -- 0:00:29 518500 -- (-396.097) (-396.337) (-395.902) [-401.536] * (-396.271) (-399.909) [-395.055] (-396.037) -- 0:00:29 519000 -- (-397.693) (-399.646) [-396.464] (-398.704) * (-395.049) (-397.311) (-396.374) [-394.853] -- 0:00:29 519500 -- (-399.833) (-395.182) (-396.585) [-397.920] * (-400.720) [-395.014] (-396.891) (-398.347) -- 0:00:29 520000 -- [-399.195] (-395.658) (-398.718) (-395.707) * (-395.016) [-398.857] (-397.463) (-399.423) -- 0:00:29 Average standard deviation of split frequencies: 0.008511 520500 -- [-399.314] (-396.123) (-395.358) (-396.258) * (-397.367) (-396.452) [-396.733] (-397.823) -- 0:00:29 521000 -- (-396.075) [-396.493] (-396.522) (-398.463) * (-394.362) (-396.350) [-396.020] (-396.190) -- 0:00:29 521500 -- (-396.599) (-397.738) (-395.457) [-397.772] * (-397.179) (-396.356) [-397.368] (-395.274) -- 0:00:29 522000 -- [-394.648] (-397.226) (-397.495) (-399.472) * (-395.219) [-396.321] (-396.129) (-396.833) -- 0:00:29 522500 -- (-396.255) (-396.881) [-397.345] (-396.566) * (-396.376) (-395.132) (-394.618) [-398.504] -- 0:00:29 523000 -- (-396.847) (-395.407) [-397.636] (-394.722) * (-394.663) (-396.061) (-396.176) [-395.632] -- 0:00:29 523500 -- (-395.345) (-398.757) (-394.616) [-394.712] * (-395.714) [-394.649] (-397.771) (-397.474) -- 0:00:29 524000 -- (-396.992) (-399.666) [-397.782] (-396.808) * (-395.413) (-397.071) (-398.057) [-396.202] -- 0:00:29 524500 -- [-395.960] (-398.873) (-406.587) (-397.298) * (-396.542) [-397.439] (-399.749) (-396.778) -- 0:00:29 525000 -- (-395.087) (-394.844) [-395.567] (-402.724) * [-396.539] (-394.511) (-396.447) (-399.206) -- 0:00:28 Average standard deviation of split frequencies: 0.009022 525500 -- [-394.965] (-394.531) (-395.742) (-394.817) * (-400.005) (-395.755) (-395.580) [-395.913] -- 0:00:28 526000 -- (-394.572) (-395.254) [-397.607] (-398.837) * (-399.266) (-397.562) [-398.700] (-397.033) -- 0:00:28 526500 -- (-394.403) (-397.034) [-394.985] (-395.402) * [-397.646] (-395.811) (-397.971) (-396.313) -- 0:00:28 527000 -- (-395.647) [-399.948] (-400.468) (-396.091) * (-397.966) (-396.045) [-395.623] (-397.166) -- 0:00:28 527500 -- [-396.499] (-398.636) (-397.328) (-396.989) * (-396.930) [-396.050] (-395.042) (-397.613) -- 0:00:28 528000 -- [-399.308] (-398.261) (-396.818) (-396.972) * [-396.564] (-394.657) (-394.471) (-396.573) -- 0:00:28 528500 -- (-397.457) [-394.925] (-398.244) (-397.620) * (-397.875) [-394.994] (-394.739) (-394.598) -- 0:00:28 529000 -- (-396.945) (-396.991) [-398.377] (-397.121) * (-400.515) [-397.186] (-395.108) (-395.411) -- 0:00:28 529500 -- (-398.667) [-397.268] (-397.701) (-394.850) * (-395.237) [-396.079] (-394.549) (-395.664) -- 0:00:28 530000 -- (-399.651) (-396.943) [-395.720] (-394.899) * (-396.190) (-395.096) (-396.027) [-400.794] -- 0:00:28 Average standard deviation of split frequencies: 0.008706 530500 -- [-395.424] (-395.718) (-396.153) (-395.323) * (-396.723) [-396.457] (-396.202) (-395.631) -- 0:00:28 531000 -- (-395.670) [-396.900] (-394.553) (-398.857) * (-395.066) (-394.540) (-395.810) [-396.298] -- 0:00:28 531500 -- (-399.507) (-395.347) [-395.588] (-396.617) * (-395.119) (-397.314) (-394.864) [-394.943] -- 0:00:28 532000 -- (-397.443) (-397.156) (-394.262) [-397.561] * (-394.577) (-399.121) (-406.533) [-396.523] -- 0:00:28 532500 -- (-398.018) [-396.104] (-394.079) (-395.061) * [-397.714] (-396.671) (-395.606) (-395.871) -- 0:00:28 533000 -- (-399.680) (-394.902) [-395.162] (-395.226) * (-397.849) (-394.464) [-396.850] (-396.266) -- 0:00:28 533500 -- (-394.568) (-394.804) [-395.816] (-397.015) * (-395.814) [-395.445] (-395.045) (-396.576) -- 0:00:27 534000 -- (-394.737) (-395.231) [-395.197] (-395.767) * [-394.825] (-400.756) (-397.211) (-396.682) -- 0:00:28 534500 -- [-395.026] (-395.103) (-396.469) (-396.320) * [-395.226] (-395.517) (-396.972) (-398.304) -- 0:00:28 535000 -- [-396.817] (-397.635) (-396.895) (-395.885) * [-396.397] (-396.045) (-395.904) (-396.112) -- 0:00:28 Average standard deviation of split frequencies: 0.008384 535500 -- [-395.126] (-395.369) (-397.468) (-394.648) * (-395.075) (-398.123) (-395.542) [-395.571] -- 0:00:28 536000 -- (-395.767) (-395.497) [-394.668] (-399.719) * (-396.148) (-396.853) [-395.413] (-397.391) -- 0:00:28 536500 -- (-394.982) (-394.451) [-394.909] (-399.501) * (-396.155) (-395.752) [-395.743] (-395.669) -- 0:00:28 537000 -- (-395.401) [-395.177] (-397.468) (-399.187) * (-396.816) (-398.176) (-401.361) [-396.724] -- 0:00:28 537500 -- (-396.517) (-397.342) [-399.785] (-396.777) * (-396.562) (-396.857) [-394.922] (-398.379) -- 0:00:28 538000 -- (-395.541) [-398.336] (-396.025) (-399.092) * (-394.920) (-394.619) [-395.665] (-399.623) -- 0:00:28 538500 -- [-399.012] (-395.441) (-396.022) (-396.810) * (-394.689) [-395.432] (-395.623) (-399.389) -- 0:00:28 539000 -- [-397.274] (-397.519) (-398.186) (-395.521) * (-396.317) (-394.802) (-395.111) [-396.532] -- 0:00:28 539500 -- (-395.593) (-399.339) [-396.358] (-395.585) * (-398.447) (-395.202) [-397.166] (-397.998) -- 0:00:28 540000 -- (-396.248) (-398.675) (-395.005) [-400.399] * (-395.820) (-396.256) [-397.289] (-398.105) -- 0:00:28 Average standard deviation of split frequencies: 0.008661 540500 -- (-394.546) (-399.433) (-396.007) [-400.324] * [-394.683] (-400.107) (-395.899) (-395.348) -- 0:00:28 541000 -- [-394.717] (-396.737) (-395.397) (-399.013) * (-399.460) (-395.644) (-398.999) [-397.184] -- 0:00:27 541500 -- (-400.196) [-397.993] (-398.695) (-396.122) * (-402.698) (-396.728) (-396.869) [-397.420] -- 0:00:27 542000 -- (-402.939) [-397.498] (-404.020) (-396.744) * (-402.222) (-398.563) [-394.437] (-396.353) -- 0:00:27 542500 -- [-396.703] (-396.733) (-396.906) (-399.208) * (-400.227) (-395.686) (-397.745) [-398.988] -- 0:00:27 543000 -- [-397.618] (-399.878) (-396.348) (-396.449) * [-399.053] (-396.510) (-397.031) (-397.553) -- 0:00:27 543500 -- (-395.911) [-396.423] (-396.960) (-395.337) * (-396.526) (-394.485) (-396.984) [-397.136] -- 0:00:27 544000 -- (-395.124) (-395.820) (-395.264) [-394.663] * (-397.239) (-395.192) [-395.292] (-396.458) -- 0:00:27 544500 -- [-395.714] (-394.927) (-398.978) (-399.340) * [-394.777] (-394.556) (-397.941) (-397.334) -- 0:00:27 545000 -- (-398.070) [-398.826] (-395.009) (-395.238) * (-397.075) (-395.596) [-395.329] (-396.788) -- 0:00:27 Average standard deviation of split frequencies: 0.007828 545500 -- [-398.759] (-396.845) (-394.733) (-397.108) * [-395.038] (-394.909) (-395.037) (-397.139) -- 0:00:27 546000 -- (-395.574) [-398.439] (-395.399) (-398.524) * (-395.905) (-396.114) [-395.751] (-397.178) -- 0:00:27 546500 -- (-396.779) [-396.667] (-402.289) (-396.524) * (-394.641) [-396.527] (-399.228) (-398.366) -- 0:00:27 547000 -- (-398.184) (-397.332) (-397.006) [-396.409] * (-395.229) (-398.962) [-394.998] (-395.264) -- 0:00:27 547500 -- (-395.802) (-398.307) [-396.252] (-396.307) * (-394.410) (-394.682) (-395.506) [-394.567] -- 0:00:27 548000 -- (-399.516) (-396.407) [-394.645] (-397.073) * (-394.953) [-396.174] (-395.675) (-394.653) -- 0:00:27 548500 -- [-396.892] (-394.913) (-395.381) (-398.142) * (-395.768) (-400.570) [-394.607] (-395.674) -- 0:00:27 549000 -- (-398.980) [-399.383] (-395.247) (-395.645) * [-395.413] (-397.625) (-394.669) (-396.599) -- 0:00:27 549500 -- [-394.887] (-398.143) (-398.112) (-394.951) * (-394.894) (-401.182) (-394.475) [-395.028] -- 0:00:27 550000 -- (-394.416) [-396.307] (-395.436) (-398.130) * (-399.344) (-398.198) [-395.029] (-395.709) -- 0:00:27 Average standard deviation of split frequencies: 0.007990 550500 -- (-394.840) [-396.375] (-395.244) (-398.429) * [-400.402] (-394.397) (-397.235) (-396.629) -- 0:00:27 551000 -- [-396.027] (-397.375) (-397.744) (-397.615) * (-397.673) [-398.943] (-396.071) (-395.679) -- 0:00:27 551500 -- (-396.501) (-394.720) [-397.871] (-395.817) * (-394.895) [-397.672] (-395.672) (-397.560) -- 0:00:27 552000 -- [-398.711] (-400.402) (-395.178) (-399.493) * (-397.941) (-398.279) [-397.144] (-394.886) -- 0:00:27 552500 -- (-396.046) (-396.171) (-397.978) [-396.026] * [-396.963] (-395.157) (-398.401) (-397.739) -- 0:00:27 553000 -- (-394.624) [-394.842] (-394.962) (-395.894) * [-398.860] (-398.313) (-396.108) (-397.013) -- 0:00:27 553500 -- (-396.101) (-395.705) [-394.644] (-395.715) * [-396.825] (-398.210) (-397.153) (-394.972) -- 0:00:27 554000 -- (-394.510) (-395.658) [-397.230] (-396.907) * (-395.879) (-396.187) (-399.697) [-398.511] -- 0:00:27 554500 -- [-395.038] (-394.816) (-397.503) (-401.052) * [-394.846] (-397.889) (-396.321) (-397.783) -- 0:00:27 555000 -- (-397.624) (-394.660) (-396.273) [-397.394] * [-395.236] (-399.170) (-398.002) (-398.762) -- 0:00:27 Average standard deviation of split frequencies: 0.007687 555500 -- (-397.919) (-395.239) [-394.954] (-394.029) * (-397.092) (-396.873) (-395.302) [-399.112] -- 0:00:27 556000 -- (-395.833) (-395.713) (-397.443) [-395.766] * (-394.893) [-399.652] (-395.747) (-397.026) -- 0:00:27 556500 -- (-396.386) (-398.107) (-400.062) [-396.821] * (-395.257) (-400.347) (-396.307) [-395.063] -- 0:00:27 557000 -- (-397.919) (-396.686) [-397.705] (-397.700) * (-395.751) (-396.367) (-396.108) [-395.062] -- 0:00:27 557500 -- (-396.744) [-398.300] (-397.843) (-396.507) * (-397.473) (-398.719) (-398.467) [-396.802] -- 0:00:26 558000 -- (-395.012) (-395.494) [-397.440] (-396.842) * (-398.651) [-394.302] (-398.498) (-398.973) -- 0:00:26 558500 -- [-394.666] (-399.312) (-402.951) (-397.836) * [-395.415] (-396.973) (-397.229) (-398.799) -- 0:00:26 559000 -- (-396.229) (-397.231) [-397.760] (-396.431) * [-397.213] (-394.562) (-395.899) (-398.106) -- 0:00:26 559500 -- (-398.277) [-395.027] (-397.334) (-397.236) * (-397.808) [-394.797] (-395.678) (-395.785) -- 0:00:26 560000 -- (-395.658) (-395.114) [-397.639] (-397.123) * (-396.114) (-394.509) [-395.896] (-396.366) -- 0:00:26 Average standard deviation of split frequencies: 0.007287 560500 -- (-394.784) (-400.483) (-395.431) [-395.421] * (-395.380) (-395.268) (-396.887) [-395.268] -- 0:00:26 561000 -- (-395.541) [-396.449] (-398.031) (-400.092) * (-394.353) (-396.377) (-395.105) [-395.871] -- 0:00:26 561500 -- (-398.695) [-396.638] (-396.483) (-396.770) * [-395.769] (-397.692) (-394.756) (-396.139) -- 0:00:26 562000 -- (-400.070) [-394.851] (-395.097) (-395.833) * [-395.548] (-396.403) (-395.363) (-395.124) -- 0:00:26 562500 -- (-402.455) (-397.201) [-398.014] (-396.094) * (-396.381) (-396.429) [-397.197] (-399.748) -- 0:00:26 563000 -- (-398.887) (-395.747) (-399.307) [-395.396] * (-395.231) (-396.945) (-399.023) [-397.710] -- 0:00:26 563500 -- (-396.729) (-395.041) [-399.560] (-396.638) * (-395.630) [-394.913] (-396.097) (-399.969) -- 0:00:26 564000 -- [-399.039] (-395.375) (-401.014) (-395.614) * (-396.276) [-395.967] (-396.253) (-394.882) -- 0:00:26 564500 -- (-397.142) [-397.600] (-395.476) (-395.395) * (-394.617) (-398.145) (-397.077) [-394.990] -- 0:00:26 565000 -- (-394.110) (-398.045) [-394.940] (-399.911) * (-396.087) (-394.857) [-396.031] (-398.209) -- 0:00:26 Average standard deviation of split frequencies: 0.007052 565500 -- (-399.990) (-398.739) [-399.567] (-398.318) * [-395.648] (-395.152) (-394.762) (-396.701) -- 0:00:26 566000 -- (-396.426) [-395.597] (-398.381) (-394.978) * [-395.121] (-396.830) (-395.486) (-394.819) -- 0:00:26 566500 -- [-398.483] (-396.287) (-396.366) (-395.178) * (-395.969) (-396.751) [-397.303] (-396.684) -- 0:00:26 567000 -- (-399.412) (-397.074) [-395.008] (-396.450) * (-396.315) (-396.065) (-398.579) [-398.756] -- 0:00:25 567500 -- (-396.745) [-396.439] (-396.643) (-399.482) * [-397.198] (-398.422) (-395.963) (-394.892) -- 0:00:26 568000 -- (-396.631) (-396.507) (-396.294) [-397.253] * (-400.350) (-396.843) (-400.800) [-394.811] -- 0:00:26 568500 -- (-398.395) (-397.774) (-399.686) [-395.694] * (-400.802) (-396.846) (-395.815) [-394.378] -- 0:00:26 569000 -- [-396.807] (-399.313) (-401.363) (-395.079) * [-395.550] (-397.096) (-396.136) (-396.524) -- 0:00:26 569500 -- (-397.827) (-397.045) [-396.124] (-396.929) * [-396.238] (-394.359) (-395.906) (-397.880) -- 0:00:26 570000 -- [-395.502] (-394.649) (-396.627) (-397.501) * (-396.329) (-395.174) [-396.139] (-397.048) -- 0:00:26 Average standard deviation of split frequencies: 0.007269 570500 -- [-396.275] (-395.029) (-395.618) (-395.684) * [-396.670] (-397.794) (-399.829) (-395.551) -- 0:00:26 571000 -- (-396.338) (-396.885) (-395.352) [-396.327] * (-397.573) (-398.470) [-398.177] (-396.947) -- 0:00:26 571500 -- [-395.827] (-396.006) (-397.577) (-396.178) * [-396.424] (-397.608) (-398.990) (-397.514) -- 0:00:26 572000 -- [-396.202] (-395.949) (-400.480) (-395.880) * (-395.463) (-397.877) (-396.140) [-395.359] -- 0:00:26 572500 -- (-395.111) [-395.187] (-398.553) (-395.355) * [-396.762] (-400.533) (-395.981) (-398.622) -- 0:00:26 573000 -- (-394.648) [-395.143] (-396.262) (-397.321) * [-398.758] (-397.254) (-394.264) (-398.063) -- 0:00:26 573500 -- (-394.482) (-394.797) (-397.043) [-397.769] * (-398.065) (-396.653) (-394.362) [-396.956] -- 0:00:26 574000 -- (-395.346) [-395.231] (-396.889) (-399.287) * (-395.819) (-397.040) [-396.310] (-396.971) -- 0:00:25 574500 -- (-399.736) (-398.735) [-396.156] (-397.468) * [-397.665] (-396.392) (-394.016) (-394.562) -- 0:00:25 575000 -- (-394.369) [-395.395] (-394.085) (-398.374) * (-401.918) [-394.017] (-398.228) (-396.225) -- 0:00:25 Average standard deviation of split frequencies: 0.007202 575500 -- [-395.829] (-395.320) (-396.679) (-399.311) * (-397.056) (-395.516) [-396.989] (-395.703) -- 0:00:25 576000 -- (-397.692) (-397.497) [-399.768] (-398.334) * (-397.324) (-402.619) [-394.952] (-394.872) -- 0:00:25 576500 -- [-396.161] (-399.820) (-395.888) (-398.782) * (-396.660) [-396.153] (-396.671) (-394.922) -- 0:00:25 577000 -- (-394.828) (-399.211) [-395.149] (-395.719) * (-395.888) [-396.169] (-399.046) (-395.578) -- 0:00:25 577500 -- (-398.529) [-397.294] (-394.132) (-394.304) * (-397.867) (-395.944) [-396.614] (-397.336) -- 0:00:25 578000 -- (-397.961) (-394.500) (-395.808) [-394.681] * (-395.386) [-398.825] (-394.912) (-398.450) -- 0:00:25 578500 -- (-394.777) (-396.637) (-400.484) [-396.298] * (-394.543) (-399.818) [-395.374] (-396.074) -- 0:00:25 579000 -- (-394.843) (-395.501) [-397.820] (-395.715) * (-397.067) (-399.160) (-396.491) [-396.213] -- 0:00:25 579500 -- (-395.509) (-397.236) [-395.060] (-394.779) * (-397.208) [-394.149] (-397.907) (-397.281) -- 0:00:25 580000 -- [-395.653] (-395.630) (-396.740) (-397.087) * (-398.930) [-395.061] (-398.470) (-397.151) -- 0:00:25 Average standard deviation of split frequencies: 0.007002 580500 -- (-394.504) (-395.941) (-401.058) [-395.207] * (-395.511) [-395.829] (-397.359) (-395.264) -- 0:00:25 581000 -- (-394.557) (-394.364) [-396.359] (-397.828) * (-395.150) (-401.322) (-399.053) [-395.327] -- 0:00:25 581500 -- (-397.596) (-396.571) [-395.072] (-398.192) * [-395.208] (-396.165) (-398.194) (-401.567) -- 0:00:25 582000 -- (-402.987) [-395.261] (-395.143) (-394.776) * [-397.490] (-395.401) (-395.435) (-397.042) -- 0:00:25 582500 -- (-394.668) (-397.115) [-397.046] (-394.042) * [-394.555] (-397.116) (-396.758) (-398.997) -- 0:00:25 583000 -- [-395.584] (-395.285) (-399.214) (-395.800) * (-398.119) (-398.052) (-397.576) [-397.255] -- 0:00:25 583500 -- [-395.559] (-395.206) (-398.047) (-399.218) * (-398.185) (-395.174) [-394.501] (-399.075) -- 0:00:24 584000 -- (-394.878) [-394.954] (-395.903) (-397.288) * (-395.275) (-396.524) [-396.635] (-397.375) -- 0:00:24 584500 -- (-396.961) (-395.756) (-395.923) [-396.124] * [-394.709] (-396.158) (-398.456) (-396.506) -- 0:00:25 585000 -- (-400.230) (-394.821) (-396.819) [-394.973] * [-396.714] (-398.143) (-396.093) (-400.413) -- 0:00:25 Average standard deviation of split frequencies: 0.007089 585500 -- (-397.593) (-395.334) (-395.334) [-395.768] * (-395.902) [-400.689] (-398.176) (-398.726) -- 0:00:25 586000 -- (-396.661) (-396.971) [-395.853] (-397.299) * [-397.746] (-395.685) (-395.791) (-395.105) -- 0:00:25 586500 -- [-394.995] (-395.703) (-394.615) (-396.989) * (-394.311) (-397.506) (-397.389) [-396.308] -- 0:00:25 587000 -- (-396.398) (-396.493) [-397.472] (-394.692) * (-398.512) (-396.535) (-399.348) [-395.110] -- 0:00:25 587500 -- (-396.149) (-397.371) (-395.519) [-397.357] * (-397.429) (-395.685) [-398.605] (-397.255) -- 0:00:25 588000 -- [-396.722] (-396.493) (-396.217) (-396.902) * (-395.938) (-395.744) (-398.476) [-395.862] -- 0:00:25 588500 -- (-396.143) [-395.298] (-395.133) (-394.248) * (-394.842) (-398.179) [-400.672] (-394.713) -- 0:00:25 589000 -- (-396.723) (-396.150) (-397.676) [-400.496] * [-394.989] (-394.879) (-396.504) (-400.198) -- 0:00:25 589500 -- [-397.592] (-398.379) (-394.832) (-399.062) * (-397.790) (-394.785) [-395.790] (-394.798) -- 0:00:25 590000 -- (-397.537) [-396.037] (-395.983) (-400.204) * (-396.235) (-395.532) (-395.271) [-394.271] -- 0:00:25 Average standard deviation of split frequencies: 0.006884 590500 -- (-397.470) (-394.639) [-395.825] (-395.588) * [-395.167] (-395.779) (-397.715) (-395.645) -- 0:00:24 591000 -- (-395.610) (-400.272) [-399.082] (-403.957) * [-395.274] (-396.357) (-396.287) (-394.143) -- 0:00:24 591500 -- (-399.147) (-400.984) [-397.542] (-395.327) * (-397.386) [-398.741] (-397.101) (-402.311) -- 0:00:24 592000 -- (-394.857) (-397.514) (-397.594) [-397.588] * [-398.512] (-397.020) (-396.248) (-402.407) -- 0:00:24 592500 -- (-394.551) (-395.730) [-397.535] (-395.222) * [-397.733] (-394.777) (-394.423) (-396.753) -- 0:00:24 593000 -- (-397.489) (-395.283) (-394.600) [-396.192] * (-397.524) (-396.333) (-395.281) [-396.738] -- 0:00:24 593500 -- [-398.843] (-396.907) (-402.434) (-401.785) * (-394.690) (-398.561) [-396.775] (-398.841) -- 0:00:24 594000 -- (-397.084) (-396.218) (-395.041) [-397.612] * [-395.490] (-396.985) (-395.141) (-397.155) -- 0:00:24 594500 -- (-395.089) [-394.934] (-398.343) (-397.547) * (-397.519) (-395.154) [-395.458] (-398.144) -- 0:00:24 595000 -- (-395.668) (-394.576) (-394.718) [-398.410] * (-397.269) (-394.920) (-397.137) [-398.055] -- 0:00:24 Average standard deviation of split frequencies: 0.006674 595500 -- (-394.692) (-395.495) [-397.512] (-395.928) * [-395.702] (-396.278) (-397.983) (-396.288) -- 0:00:24 596000 -- [-394.949] (-395.640) (-397.376) (-395.382) * [-394.483] (-396.566) (-395.115) (-395.794) -- 0:00:24 596500 -- (-395.786) [-395.938] (-394.992) (-396.374) * (-399.833) [-394.764] (-396.545) (-397.952) -- 0:00:24 597000 -- (-397.937) [-397.996] (-400.331) (-396.078) * (-396.121) (-394.957) [-394.405] (-394.596) -- 0:00:24 597500 -- (-401.553) (-396.798) [-395.681] (-395.636) * (-396.311) (-396.006) [-399.107] (-395.466) -- 0:00:24 598000 -- (-398.251) (-399.472) [-395.854] (-400.629) * (-397.417) (-398.810) (-398.714) [-397.215] -- 0:00:24 598500 -- (-396.867) [-394.838] (-394.479) (-397.651) * (-398.401) (-395.008) [-400.785] (-397.621) -- 0:00:24 599000 -- [-398.743] (-399.610) (-396.532) (-395.045) * (-395.554) [-395.019] (-396.515) (-395.126) -- 0:00:24 599500 -- (-395.339) (-396.695) [-399.345] (-396.957) * (-395.632) (-396.544) (-395.789) [-398.659] -- 0:00:24 600000 -- [-394.204] (-397.933) (-399.620) (-397.171) * (-396.492) (-396.999) [-395.345] (-396.682) -- 0:00:24 Average standard deviation of split frequencies: 0.006622 600500 -- (-396.349) (-397.555) (-395.419) [-394.521] * (-396.177) [-394.071] (-395.356) (-396.184) -- 0:00:23 601000 -- (-395.933) (-397.213) [-395.369] (-395.800) * (-394.812) [-394.984] (-395.983) (-397.507) -- 0:00:24 601500 -- (-399.469) (-395.801) [-395.097] (-395.579) * (-396.699) (-394.873) [-397.714] (-397.061) -- 0:00:24 602000 -- (-395.653) (-398.052) [-395.966] (-397.316) * [-394.361] (-395.941) (-400.232) (-395.381) -- 0:00:24 602500 -- (-396.804) (-397.428) (-396.990) [-395.371] * (-400.256) [-395.995] (-397.196) (-396.245) -- 0:00:24 603000 -- (-406.878) (-396.090) [-394.776] (-395.817) * (-394.363) (-394.948) [-398.989] (-395.104) -- 0:00:24 603500 -- (-398.220) (-399.628) (-396.620) [-396.769] * (-394.694) (-394.934) (-396.218) [-395.183] -- 0:00:24 604000 -- (-399.506) (-398.040) (-395.175) [-397.561] * (-395.554) [-397.897] (-395.920) (-397.711) -- 0:00:24 604500 -- (-394.462) [-394.665] (-395.897) (-396.061) * (-394.333) (-399.169) [-395.414] (-396.876) -- 0:00:24 605000 -- (-395.947) (-396.230) (-394.229) [-395.451] * (-397.029) (-398.999) [-394.300] (-396.533) -- 0:00:24 Average standard deviation of split frequencies: 0.006855 605500 -- [-399.908] (-396.217) (-397.213) (-395.397) * [-396.689] (-397.530) (-396.757) (-396.645) -- 0:00:24 606000 -- (-397.334) [-401.338] (-396.344) (-397.867) * [-396.274] (-397.383) (-398.130) (-397.785) -- 0:00:24 606500 -- (-396.403) (-405.851) (-395.845) [-396.358] * (-405.807) (-396.592) (-396.919) [-396.414] -- 0:00:24 607000 -- (-395.076) (-398.096) [-396.811] (-398.722) * (-397.718) [-397.206] (-397.547) (-396.935) -- 0:00:23 607500 -- (-396.047) (-402.180) (-398.029) [-395.696] * (-398.417) [-395.919] (-395.827) (-396.597) -- 0:00:23 608000 -- (-397.093) (-397.685) (-398.385) [-397.549] * (-395.997) (-395.659) (-399.106) [-399.415] -- 0:00:23 608500 -- (-398.217) [-395.617] (-396.570) (-394.814) * (-395.783) [-396.438] (-399.463) (-397.662) -- 0:00:23 609000 -- (-396.912) (-397.378) [-398.100] (-394.992) * (-394.922) [-394.222] (-396.691) (-395.904) -- 0:00:23 609500 -- (-397.387) (-399.467) [-397.242] (-396.387) * (-395.598) (-394.188) [-395.383] (-396.285) -- 0:00:23 610000 -- (-397.399) (-397.435) [-394.494] (-397.654) * (-395.515) (-399.148) [-395.961] (-398.590) -- 0:00:23 Average standard deviation of split frequencies: 0.007141 610500 -- (-394.332) (-394.908) [-396.500] (-396.691) * (-394.699) (-398.143) (-396.602) [-395.845] -- 0:00:23 611000 -- (-394.522) [-397.910] (-398.873) (-395.568) * [-394.516] (-397.958) (-394.639) (-397.028) -- 0:00:23 611500 -- (-395.490) (-394.740) [-395.583] (-394.098) * (-396.667) (-399.406) [-397.125] (-400.006) -- 0:00:23 612000 -- (-396.247) [-394.268] (-396.354) (-395.244) * [-395.454] (-398.596) (-395.480) (-395.953) -- 0:00:23 612500 -- (-396.379) (-396.840) (-395.404) [-396.107] * (-398.971) (-394.848) [-394.590] (-399.483) -- 0:00:23 613000 -- (-394.541) (-396.728) (-395.667) [-397.370] * (-395.317) (-398.037) [-394.879] (-395.951) -- 0:00:23 613500 -- (-395.049) (-397.042) [-397.113] (-394.823) * [-394.316] (-394.428) (-397.057) (-395.592) -- 0:00:23 614000 -- (-394.815) [-396.663] (-395.530) (-396.191) * (-395.125) [-396.207] (-394.696) (-394.377) -- 0:00:23 614500 -- [-394.985] (-395.948) (-396.674) (-396.348) * (-396.357) (-395.211) (-396.926) [-397.072] -- 0:00:23 615000 -- (-394.825) [-396.439] (-395.416) (-395.355) * [-396.967] (-399.407) (-394.913) (-398.408) -- 0:00:23 Average standard deviation of split frequencies: 0.007461 615500 -- [-395.585] (-395.183) (-394.578) (-398.928) * (-395.872) (-395.621) [-395.398] (-397.102) -- 0:00:23 616000 -- (-395.580) (-398.806) (-398.595) [-396.605] * (-398.588) (-398.248) [-398.624] (-397.751) -- 0:00:23 616500 -- (-395.454) [-394.578] (-395.836) (-394.775) * (-399.027) (-400.637) (-396.215) [-395.008] -- 0:00:23 617000 -- (-395.848) (-396.360) (-398.333) [-394.695] * (-397.003) [-395.575] (-396.445) (-397.859) -- 0:00:22 617500 -- (-396.237) (-396.437) (-398.666) [-394.859] * [-399.168] (-396.008) (-397.628) (-397.340) -- 0:00:23 618000 -- (-394.920) [-397.145] (-399.752) (-395.762) * (-399.144) (-394.785) [-397.394] (-401.629) -- 0:00:23 618500 -- (-398.321) (-395.792) [-397.216] (-396.149) * (-403.035) [-396.745] (-395.511) (-402.499) -- 0:00:23 619000 -- [-395.823] (-395.432) (-400.498) (-396.474) * [-400.395] (-398.895) (-397.034) (-400.781) -- 0:00:23 619500 -- (-398.181) (-396.644) [-400.939] (-395.984) * (-396.951) (-394.378) [-395.625] (-397.565) -- 0:00:23 620000 -- (-399.151) [-396.928] (-400.190) (-397.833) * (-398.253) [-394.473] (-396.141) (-398.955) -- 0:00:23 Average standard deviation of split frequencies: 0.007738 620500 -- (-396.726) [-394.679] (-398.805) (-397.543) * (-399.354) (-398.175) (-394.781) [-394.411] -- 0:00:23 621000 -- (-399.501) [-394.921] (-400.697) (-400.816) * [-396.912] (-397.717) (-396.022) (-394.793) -- 0:00:23 621500 -- (-402.421) [-395.486] (-399.147) (-396.622) * (-395.145) [-396.329] (-396.259) (-395.048) -- 0:00:23 622000 -- (-397.541) (-397.650) (-395.070) [-397.545] * (-395.679) [-396.120] (-397.984) (-396.168) -- 0:00:23 622500 -- [-397.048] (-398.107) (-395.157) (-398.149) * (-395.038) [-394.899] (-398.173) (-396.467) -- 0:00:23 623000 -- [-395.695] (-396.026) (-394.624) (-394.667) * (-395.268) (-395.151) (-399.562) [-397.808] -- 0:00:22 623500 -- (-394.824) [-394.891] (-396.580) (-395.327) * (-404.767) [-399.944] (-396.140) (-397.584) -- 0:00:22 624000 -- (-395.013) (-398.357) [-397.289] (-396.144) * (-398.917) (-396.369) (-396.864) [-397.401] -- 0:00:22 624500 -- [-395.326] (-398.507) (-397.741) (-395.994) * (-396.644) [-394.344] (-398.460) (-397.638) -- 0:00:22 625000 -- [-395.944] (-396.225) (-396.834) (-395.535) * (-396.926) (-396.495) (-400.575) [-396.013] -- 0:00:22 Average standard deviation of split frequencies: 0.008001 625500 -- (-398.453) (-397.187) [-399.801] (-398.865) * (-400.336) (-394.382) (-399.913) [-396.097] -- 0:00:22 626000 -- (-394.372) [-394.706] (-401.500) (-397.352) * (-395.579) (-395.306) (-398.656) [-396.325] -- 0:00:22 626500 -- (-396.360) [-397.159] (-395.251) (-401.920) * [-399.108] (-396.579) (-396.383) (-398.471) -- 0:00:22 627000 -- (-397.158) (-396.181) (-396.440) [-395.288] * (-395.021) (-400.293) (-396.976) [-396.906] -- 0:00:22 627500 -- (-396.117) [-397.949] (-396.277) (-398.041) * (-396.116) [-397.840] (-397.395) (-397.419) -- 0:00:22 628000 -- (-395.075) [-394.743] (-396.952) (-395.375) * [-398.009] (-395.913) (-397.769) (-398.613) -- 0:00:22 628500 -- (-396.535) (-399.072) (-397.492) [-394.597] * (-395.359) (-398.352) [-395.220] (-395.262) -- 0:00:22 629000 -- (-397.987) (-397.538) [-397.316] (-394.120) * (-397.804) [-395.390] (-394.984) (-395.900) -- 0:00:22 629500 -- (-399.425) (-396.936) (-394.141) [-394.074] * (-394.411) (-396.703) [-395.365] (-399.050) -- 0:00:22 630000 -- (-394.979) [-396.725] (-395.657) (-396.242) * (-394.439) [-396.526] (-396.811) (-400.336) -- 0:00:22 Average standard deviation of split frequencies: 0.008175 630500 -- [-395.321] (-396.313) (-395.973) (-396.573) * (-394.290) (-397.463) (-395.405) [-394.395] -- 0:00:22 631000 -- [-394.704] (-396.671) (-395.028) (-395.680) * (-395.410) (-396.947) [-395.411] (-394.397) -- 0:00:22 631500 -- (-396.601) (-395.356) (-396.261) [-394.509] * [-399.412] (-394.935) (-401.286) (-394.370) -- 0:00:22 632000 -- (-397.311) (-397.974) (-395.260) [-394.566] * (-396.983) (-394.896) (-400.467) [-397.533] -- 0:00:22 632500 -- (-395.899) (-396.891) [-398.581] (-394.979) * (-394.797) (-397.274) [-396.952] (-395.045) -- 0:00:22 633000 -- (-397.486) (-394.085) [-396.074] (-395.305) * (-394.715) (-396.800) [-397.035] (-395.610) -- 0:00:22 633500 -- [-397.203] (-395.188) (-397.892) (-394.495) * (-396.809) [-400.789] (-395.660) (-395.524) -- 0:00:21 634000 -- [-397.042] (-396.406) (-395.790) (-394.789) * (-398.547) (-398.374) (-398.904) [-395.361] -- 0:00:21 634500 -- (-395.815) (-396.809) [-399.138] (-396.033) * [-396.198] (-398.119) (-400.418) (-397.129) -- 0:00:22 635000 -- (-396.486) (-403.450) [-395.569] (-396.374) * (-395.216) [-394.539] (-395.820) (-398.680) -- 0:00:22 Average standard deviation of split frequencies: 0.008616 635500 -- [-395.714] (-397.817) (-396.478) (-399.031) * (-395.077) [-395.298] (-399.825) (-397.411) -- 0:00:22 636000 -- [-396.928] (-397.454) (-396.016) (-397.846) * (-396.319) [-394.739] (-398.670) (-394.659) -- 0:00:22 636500 -- (-399.855) (-394.485) [-396.129] (-399.524) * [-396.438] (-395.869) (-398.826) (-395.261) -- 0:00:22 637000 -- (-398.807) (-395.472) [-395.060] (-395.139) * (-400.671) (-394.942) (-394.483) [-394.592] -- 0:00:22 637500 -- (-404.256) (-394.486) (-394.484) [-399.687] * (-398.412) [-395.200] (-394.182) (-398.401) -- 0:00:22 638000 -- [-394.581] (-398.548) (-400.394) (-394.048) * (-395.088) [-395.216] (-394.004) (-395.194) -- 0:00:22 638500 -- (-396.356) [-399.776] (-402.056) (-396.233) * (-394.238) (-396.804) (-396.446) [-397.360] -- 0:00:22 639000 -- (-396.601) (-397.206) [-395.712] (-397.776) * [-394.340] (-398.120) (-400.110) (-397.461) -- 0:00:22 639500 -- (-397.722) (-399.842) [-396.170] (-400.641) * (-397.912) (-395.775) [-397.140] (-398.140) -- 0:00:21 640000 -- (-398.114) (-394.609) (-396.163) [-395.793] * (-405.370) (-407.454) [-395.296] (-396.630) -- 0:00:21 Average standard deviation of split frequencies: 0.008646 640500 -- (-397.030) (-399.478) (-397.774) [-398.730] * (-397.930) (-402.913) (-399.608) [-395.587] -- 0:00:21 641000 -- (-396.435) (-396.042) (-396.590) [-394.756] * (-396.216) [-400.921] (-397.706) (-395.869) -- 0:00:21 641500 -- (-401.508) (-394.986) (-396.744) [-394.322] * (-397.324) (-395.070) [-398.429] (-398.113) -- 0:00:21 642000 -- (-399.395) (-396.181) [-398.393] (-398.245) * (-394.516) (-398.489) (-397.722) [-396.061] -- 0:00:21 642500 -- (-397.134) [-395.392] (-396.712) (-395.313) * [-396.152] (-395.181) (-399.700) (-394.292) -- 0:00:21 643000 -- [-397.750] (-400.796) (-396.969) (-397.170) * (-399.276) (-395.348) (-402.132) [-396.853] -- 0:00:21 643500 -- (-397.181) (-397.136) (-394.959) [-396.995] * [-401.089] (-398.330) (-398.087) (-396.319) -- 0:00:21 644000 -- [-395.249] (-395.659) (-395.140) (-394.452) * [-396.558] (-396.658) (-396.639) (-396.521) -- 0:00:21 644500 -- (-396.068) (-399.753) (-395.051) [-395.120] * (-398.563) (-398.204) [-396.027] (-395.074) -- 0:00:21 645000 -- (-395.391) (-398.102) [-395.370] (-396.039) * (-396.675) (-399.131) (-398.038) [-397.469] -- 0:00:21 Average standard deviation of split frequencies: 0.008346 645500 -- (-396.949) (-397.747) [-397.019] (-395.465) * (-396.524) [-397.200] (-395.889) (-398.338) -- 0:00:21 646000 -- (-399.500) (-398.624) (-396.481) [-396.002] * (-394.960) (-395.724) [-394.920] (-395.184) -- 0:00:21 646500 -- (-395.014) [-400.318] (-400.821) (-394.866) * [-395.315] (-395.972) (-399.924) (-400.923) -- 0:00:21 647000 -- [-396.298] (-399.963) (-396.578) (-397.707) * [-394.931] (-396.607) (-394.783) (-395.060) -- 0:00:21 647500 -- (-395.860) [-397.494] (-397.295) (-395.653) * (-398.099) (-398.958) (-397.674) [-395.445] -- 0:00:21 648000 -- (-396.742) (-396.908) (-398.003) [-396.746] * [-397.904] (-395.570) (-394.261) (-395.487) -- 0:00:21 648500 -- (-397.027) (-395.892) (-396.162) [-395.219] * (-397.208) [-400.517] (-395.315) (-396.402) -- 0:00:21 649000 -- (-399.979) (-394.912) [-394.579] (-398.512) * (-394.561) [-398.548] (-395.260) (-402.350) -- 0:00:21 649500 -- (-401.365) (-397.011) (-394.887) [-398.439] * (-396.908) [-398.745] (-398.492) (-399.119) -- 0:00:21 650000 -- (-396.674) [-397.101] (-394.770) (-398.192) * (-395.463) [-395.098] (-395.264) (-397.356) -- 0:00:21 Average standard deviation of split frequencies: 0.008784 650500 -- (-394.903) (-398.372) [-395.550] (-400.871) * [-394.480] (-395.188) (-395.150) (-396.111) -- 0:00:20 651000 -- (-395.231) (-400.828) (-399.644) [-395.109] * (-397.968) (-396.994) [-394.443] (-398.354) -- 0:00:20 651500 -- [-394.777] (-394.616) (-399.263) (-394.874) * [-394.402] (-397.620) (-395.103) (-399.697) -- 0:00:21 652000 -- [-394.311] (-395.817) (-397.622) (-396.001) * (-395.846) (-397.591) [-395.825] (-401.160) -- 0:00:21 652500 -- (-395.074) [-396.894] (-397.352) (-395.862) * (-395.339) [-397.393] (-396.291) (-398.410) -- 0:00:21 653000 -- (-400.249) (-395.627) [-394.619] (-394.365) * (-396.956) [-402.273] (-396.366) (-397.141) -- 0:00:21 653500 -- (-395.129) [-395.137] (-394.780) (-396.437) * (-400.555) [-396.170] (-395.230) (-396.756) -- 0:00:21 654000 -- (-395.463) [-395.663] (-394.809) (-395.723) * (-396.746) (-397.506) [-397.199] (-395.299) -- 0:00:21 654500 -- (-395.722) [-396.819] (-394.694) (-395.808) * [-396.796] (-399.869) (-394.587) (-398.490) -- 0:00:21 655000 -- [-394.440] (-396.754) (-394.766) (-396.476) * (-396.449) (-395.461) (-397.051) [-397.046] -- 0:00:21 Average standard deviation of split frequencies: 0.008219 655500 -- (-394.526) (-395.671) [-394.022] (-397.010) * [-395.689] (-394.965) (-399.031) (-396.006) -- 0:00:21 656000 -- (-395.800) [-394.405] (-394.731) (-395.513) * (-396.244) (-396.461) [-395.168] (-395.552) -- 0:00:20 656500 -- [-395.570] (-396.301) (-395.309) (-398.559) * [-395.769] (-394.439) (-397.492) (-395.541) -- 0:00:20 657000 -- [-394.393] (-399.199) (-394.491) (-397.123) * [-394.427] (-399.484) (-401.429) (-396.885) -- 0:00:20 657500 -- [-395.409] (-396.046) (-395.176) (-396.396) * (-394.554) (-396.668) [-396.892] (-396.241) -- 0:00:20 658000 -- (-396.370) (-397.000) (-396.893) [-395.054] * [-396.392] (-395.969) (-397.660) (-395.595) -- 0:00:20 658500 -- (-396.558) (-399.273) (-395.992) [-397.095] * [-402.208] (-395.078) (-397.893) (-394.887) -- 0:00:20 659000 -- [-396.144] (-396.803) (-396.383) (-396.721) * [-394.938] (-395.111) (-395.789) (-395.070) -- 0:00:20 659500 -- (-395.454) (-395.293) (-397.360) [-396.766] * (-395.358) (-394.203) (-394.665) [-394.462] -- 0:00:20 660000 -- (-398.678) (-396.214) [-395.643] (-394.403) * (-396.693) (-394.341) [-394.940] (-395.846) -- 0:00:20 Average standard deviation of split frequencies: 0.008072 660500 -- (-395.932) [-397.276] (-397.897) (-395.413) * [-397.213] (-397.735) (-398.196) (-396.441) -- 0:00:20 661000 -- (-395.960) (-398.838) [-395.477] (-398.437) * [-401.563] (-403.458) (-394.870) (-398.401) -- 0:00:20 661500 -- (-399.501) (-399.050) [-395.542] (-401.519) * (-395.051) [-394.922] (-394.879) (-398.124) -- 0:00:20 662000 -- (-398.924) [-397.637] (-395.216) (-397.109) * (-393.996) [-394.896] (-395.125) (-399.163) -- 0:00:20 662500 -- [-395.954] (-396.186) (-397.724) (-396.566) * (-393.996) [-395.594] (-395.586) (-396.176) -- 0:00:20 663000 -- [-394.946] (-399.175) (-397.496) (-400.366) * (-394.189) (-397.269) [-395.886] (-395.420) -- 0:00:20 663500 -- (-395.586) [-395.938] (-399.799) (-399.038) * (-400.393) (-401.884) [-395.779] (-394.901) -- 0:00:20 664000 -- (-395.869) (-397.526) (-398.284) [-395.540] * [-396.687] (-397.064) (-397.554) (-395.768) -- 0:00:20 664500 -- [-395.456] (-397.273) (-395.816) (-399.192) * [-397.096] (-394.529) (-395.974) (-395.487) -- 0:00:20 665000 -- (-399.489) (-395.312) (-395.348) [-398.130] * [-396.531] (-396.142) (-395.752) (-394.108) -- 0:00:20 Average standard deviation of split frequencies: 0.007742 665500 -- (-398.704) (-397.311) [-397.395] (-394.536) * [-397.131] (-396.315) (-397.727) (-396.591) -- 0:00:20 666000 -- (-397.669) (-396.328) [-396.966] (-398.383) * [-394.522] (-398.004) (-395.168) (-395.755) -- 0:00:20 666500 -- [-396.761] (-395.115) (-398.649) (-396.376) * [-395.002] (-395.665) (-397.181) (-394.262) -- 0:00:20 667000 -- (-396.060) (-395.156) [-397.108] (-395.132) * (-396.173) [-395.545] (-394.507) (-395.193) -- 0:00:19 667500 -- (-396.783) [-394.745] (-395.716) (-395.724) * (-395.650) (-394.592) (-398.621) [-397.469] -- 0:00:19 668000 -- (-397.426) (-394.599) [-397.990] (-396.398) * (-395.468) (-400.013) (-399.023) [-400.068] -- 0:00:20 668500 -- (-397.827) (-394.653) [-397.255] (-396.982) * [-395.124] (-396.261) (-396.669) (-398.403) -- 0:00:20 669000 -- [-396.247] (-395.984) (-395.573) (-396.398) * (-394.624) [-394.888] (-396.374) (-395.515) -- 0:00:20 669500 -- (-395.613) (-398.230) [-395.496] (-394.283) * (-396.613) (-394.771) [-394.500] (-396.638) -- 0:00:20 670000 -- (-394.939) (-395.621) [-396.061] (-397.769) * (-395.881) [-394.274] (-397.451) (-395.018) -- 0:00:20 Average standard deviation of split frequencies: 0.007556 670500 -- [-395.026] (-398.121) (-398.392) (-398.476) * (-396.867) (-396.282) [-396.573] (-394.831) -- 0:00:20 671000 -- (-397.190) (-397.063) (-395.223) [-395.410] * (-397.262) [-394.958] (-396.237) (-394.611) -- 0:00:20 671500 -- (-394.699) [-401.472] (-396.498) (-396.147) * [-395.988] (-394.947) (-397.685) (-396.859) -- 0:00:20 672000 -- [-396.730] (-397.481) (-394.648) (-396.390) * (-394.123) (-397.985) [-395.088] (-397.550) -- 0:00:20 672500 -- (-396.132) (-395.150) (-395.542) [-398.041] * (-394.950) (-395.228) [-395.494] (-396.525) -- 0:00:19 673000 -- (-397.004) (-394.866) [-396.648] (-397.279) * (-398.757) (-396.592) (-394.131) [-397.913] -- 0:00:19 673500 -- (-398.570) (-399.855) (-398.533) [-395.259] * (-402.344) (-396.409) [-394.813] (-399.639) -- 0:00:19 674000 -- [-394.754] (-397.742) (-397.598) (-395.794) * (-399.577) (-397.167) (-395.485) [-395.091] -- 0:00:19 674500 -- [-396.890] (-397.309) (-395.524) (-394.556) * (-397.607) (-394.739) [-395.547] (-394.934) -- 0:00:19 675000 -- (-399.597) (-395.769) [-394.757] (-395.175) * (-396.293) (-395.912) [-395.171] (-395.107) -- 0:00:19 Average standard deviation of split frequencies: 0.007017 675500 -- (-398.230) (-400.654) (-394.432) [-394.223] * (-395.712) (-398.332) [-396.156] (-395.113) -- 0:00:19 676000 -- (-398.287) (-397.547) (-396.853) [-394.213] * (-397.176) (-396.236) (-399.450) [-399.530] -- 0:00:19 676500 -- (-397.193) [-394.886] (-398.032) (-394.213) * [-395.878] (-395.627) (-399.126) (-396.804) -- 0:00:19 677000 -- (-401.372) [-399.990] (-395.708) (-395.940) * (-401.817) (-395.691) (-397.365) [-395.000] -- 0:00:19 677500 -- [-395.696] (-396.999) (-396.333) (-396.243) * [-396.717] (-396.144) (-398.049) (-398.349) -- 0:00:19 678000 -- [-396.748] (-396.084) (-397.625) (-398.662) * (-394.085) (-399.204) (-394.394) [-396.562] -- 0:00:19 678500 -- (-395.483) (-394.291) (-395.092) [-398.524] * (-398.954) [-397.514] (-401.059) (-397.221) -- 0:00:19 679000 -- (-397.575) (-394.412) (-394.640) [-396.443] * (-397.467) (-395.916) (-401.999) [-401.379] -- 0:00:19 679500 -- (-397.219) (-398.980) [-394.559] (-395.021) * (-395.936) [-395.536] (-401.511) (-398.968) -- 0:00:19 680000 -- (-396.912) (-397.100) [-398.398] (-396.703) * (-396.510) [-396.461] (-396.581) (-397.531) -- 0:00:19 Average standard deviation of split frequencies: 0.006882 680500 -- (-397.784) [-397.599] (-397.195) (-396.200) * (-395.811) (-395.845) (-397.863) [-394.940] -- 0:00:19 681000 -- (-395.466) [-398.788] (-395.559) (-396.045) * (-395.960) [-394.135] (-397.505) (-394.720) -- 0:00:19 681500 -- (-395.243) (-396.747) (-396.549) [-397.142] * (-396.766) (-395.576) [-397.038] (-394.683) -- 0:00:19 682000 -- [-396.162] (-396.711) (-394.535) (-396.054) * (-396.747) [-396.215] (-394.824) (-396.449) -- 0:00:19 682500 -- [-395.641] (-402.870) (-395.535) (-395.499) * [-396.469] (-398.613) (-394.514) (-397.962) -- 0:00:19 683000 -- (-396.000) [-395.550] (-396.888) (-395.981) * (-398.144) (-399.376) (-395.496) [-395.741] -- 0:00:19 683500 -- [-395.799] (-398.586) (-397.919) (-396.791) * [-398.342] (-396.199) (-398.471) (-402.046) -- 0:00:18 684000 -- [-397.157] (-398.452) (-397.360) (-395.059) * (-395.674) (-400.653) (-395.525) [-401.202] -- 0:00:19 684500 -- (-397.607) (-395.255) (-397.724) [-395.682] * [-394.776] (-400.853) (-395.149) (-404.686) -- 0:00:19 685000 -- (-398.750) [-394.834] (-397.032) (-395.409) * [-395.795] (-401.846) (-394.471) (-400.016) -- 0:00:19 Average standard deviation of split frequencies: 0.006786 685500 -- [-395.824] (-398.705) (-396.272) (-395.022) * [-396.621] (-394.949) (-394.889) (-397.045) -- 0:00:19 686000 -- (-396.483) [-397.006] (-395.483) (-397.410) * (-396.657) (-394.546) (-395.355) [-396.399] -- 0:00:19 686500 -- (-394.739) (-395.175) [-397.118] (-395.882) * (-395.034) (-396.855) [-395.223] (-397.106) -- 0:00:19 687000 -- (-394.816) (-396.383) [-396.329] (-396.857) * (-394.813) (-395.906) [-396.045] (-398.671) -- 0:00:19 687500 -- (-394.626) (-395.177) [-396.511] (-395.605) * (-395.121) [-399.047] (-400.287) (-404.564) -- 0:00:19 688000 -- (-397.626) (-394.630) (-397.814) [-396.981] * (-394.453) (-397.534) (-395.109) [-397.340] -- 0:00:19 688500 -- (-398.128) [-397.514] (-397.844) (-396.172) * (-399.857) (-396.252) (-397.991) [-395.347] -- 0:00:19 689000 -- [-398.578] (-398.067) (-397.300) (-396.680) * (-394.981) (-396.315) (-395.756) [-397.461] -- 0:00:18 689500 -- [-396.709] (-395.896) (-398.504) (-395.155) * (-394.981) (-396.853) (-394.066) [-396.738] -- 0:00:18 690000 -- (-396.071) [-396.555] (-399.858) (-395.587) * (-395.251) [-395.533] (-393.971) (-396.038) -- 0:00:18 Average standard deviation of split frequencies: 0.006740 690500 -- (-395.266) (-394.313) [-398.220] (-399.255) * (-395.869) (-395.074) [-395.997] (-395.534) -- 0:00:18 691000 -- [-398.283] (-395.180) (-395.600) (-396.750) * [-395.100] (-395.127) (-395.635) (-395.876) -- 0:00:18 691500 -- (-399.567) [-397.916] (-396.350) (-394.874) * (-398.407) (-395.636) [-394.865] (-398.362) -- 0:00:18 692000 -- (-395.121) [-395.604] (-396.611) (-394.419) * (-397.346) [-396.234] (-396.105) (-399.561) -- 0:00:18 692500 -- [-395.795] (-395.151) (-395.134) (-395.546) * (-396.170) [-395.050] (-396.696) (-397.363) -- 0:00:18 693000 -- [-395.718] (-400.370) (-397.938) (-396.566) * [-394.185] (-399.078) (-395.764) (-398.583) -- 0:00:18 693500 -- (-395.278) (-395.225) [-394.729] (-397.713) * (-394.152) (-396.121) [-394.859] (-394.436) -- 0:00:18 694000 -- (-394.695) [-395.231] (-395.282) (-397.830) * (-396.743) (-401.136) (-395.525) [-394.859] -- 0:00:18 694500 -- [-394.065] (-396.465) (-398.201) (-400.941) * (-395.231) (-396.993) (-397.371) [-396.442] -- 0:00:18 695000 -- [-394.428] (-396.980) (-396.325) (-401.687) * [-395.919] (-398.580) (-397.883) (-396.737) -- 0:00:18 Average standard deviation of split frequencies: 0.006813 695500 -- (-394.398) (-395.709) (-394.897) [-394.811] * (-400.891) (-395.706) (-395.796) [-395.598] -- 0:00:18 696000 -- (-396.991) (-394.897) (-395.108) [-398.473] * (-396.072) (-398.326) [-395.703] (-394.969) -- 0:00:18 696500 -- (-396.377) (-396.394) (-394.587) [-396.010] * (-394.480) [-395.558] (-394.554) (-398.423) -- 0:00:18 697000 -- (-397.268) (-401.815) [-396.495] (-395.631) * (-396.037) (-396.653) [-395.028] (-397.438) -- 0:00:18 697500 -- (-398.596) (-403.974) [-399.440] (-395.617) * (-395.432) (-395.712) (-399.362) [-399.041] -- 0:00:18 698000 -- (-395.882) (-397.938) [-395.240] (-396.885) * (-397.102) (-396.064) (-395.206) [-397.608] -- 0:00:18 698500 -- [-396.876] (-396.042) (-397.993) (-395.794) * (-395.556) [-397.263] (-398.827) (-399.189) -- 0:00:18 699000 -- [-399.221] (-396.256) (-394.695) (-396.055) * [-396.337] (-395.705) (-397.780) (-395.635) -- 0:00:18 699500 -- (-395.498) (-401.981) (-395.581) [-395.683] * (-400.251) [-399.573] (-395.438) (-395.426) -- 0:00:18 700000 -- [-399.022] (-394.529) (-398.642) (-395.802) * (-399.529) [-398.587] (-399.189) (-394.424) -- 0:00:18 Average standard deviation of split frequencies: 0.006807 700500 -- (-399.371) (-395.377) [-395.039] (-394.172) * (-395.830) (-396.147) (-395.429) [-396.454] -- 0:00:18 701000 -- (-394.338) (-396.236) (-397.069) [-394.191] * [-395.965] (-395.929) (-398.062) (-398.653) -- 0:00:18 701500 -- (-396.623) (-396.626) (-394.713) [-397.844] * (-396.101) (-402.330) [-395.742] (-395.947) -- 0:00:18 702000 -- [-396.089] (-395.253) (-396.468) (-395.226) * (-395.217) (-398.285) (-396.778) [-397.157] -- 0:00:18 702500 -- (-397.551) (-396.234) [-395.266] (-395.204) * (-395.977) (-397.479) (-396.316) [-396.574] -- 0:00:18 703000 -- [-397.021] (-396.359) (-396.024) (-397.432) * (-399.143) (-398.546) (-395.652) [-395.249] -- 0:00:18 703500 -- (-396.512) (-395.059) (-395.043) [-397.015] * [-396.770] (-398.911) (-397.669) (-395.240) -- 0:00:18 704000 -- (-394.928) (-396.149) [-394.716] (-397.761) * [-395.702] (-397.689) (-398.329) (-394.742) -- 0:00:18 704500 -- (-396.114) (-395.738) (-394.192) [-395.099] * [-395.812] (-395.531) (-395.241) (-399.884) -- 0:00:18 705000 -- (-397.162) (-395.544) (-394.794) [-398.175] * (-396.775) (-395.886) (-395.903) [-396.379] -- 0:00:17 Average standard deviation of split frequencies: 0.006874 705500 -- (-396.689) (-397.798) (-395.031) [-396.624] * [-394.646] (-397.186) (-397.817) (-398.332) -- 0:00:17 706000 -- (-395.760) (-394.684) [-396.143] (-399.938) * [-396.841] (-399.068) (-396.062) (-396.288) -- 0:00:17 706500 -- (-396.512) [-395.371] (-394.639) (-397.674) * (-398.092) [-394.486] (-396.849) (-395.908) -- 0:00:17 707000 -- (-399.518) (-395.641) [-394.999] (-396.645) * (-397.603) [-395.924] (-395.521) (-396.907) -- 0:00:17 707500 -- [-396.641] (-396.055) (-396.077) (-396.261) * (-395.468) (-395.700) [-396.401] (-395.769) -- 0:00:17 708000 -- (-398.817) (-395.233) [-394.348] (-397.433) * [-394.951] (-398.744) (-395.004) (-398.213) -- 0:00:17 708500 -- (-395.905) [-395.084] (-394.555) (-397.658) * (-396.036) [-395.511] (-395.652) (-396.496) -- 0:00:17 709000 -- [-396.076] (-398.192) (-397.709) (-396.160) * (-395.449) (-395.490) (-397.689) [-397.349] -- 0:00:17 709500 -- (-396.594) (-397.905) (-395.060) [-395.394] * [-395.491] (-399.480) (-400.660) (-397.482) -- 0:00:17 710000 -- (-401.584) [-397.112] (-396.241) (-394.495) * (-395.085) (-397.328) [-395.119] (-398.957) -- 0:00:17 Average standard deviation of split frequencies: 0.007062 710500 -- (-396.555) (-396.673) [-401.101] (-394.730) * (-395.090) [-394.975] (-396.362) (-397.924) -- 0:00:17 711000 -- (-402.917) (-394.387) [-397.758] (-397.043) * (-397.145) (-399.386) (-395.436) [-395.562] -- 0:00:17 711500 -- (-400.370) (-394.975) (-395.434) [-395.267] * [-396.965] (-400.190) (-395.071) (-398.005) -- 0:00:17 712000 -- (-394.532) [-397.724] (-395.523) (-399.604) * (-395.782) (-395.793) [-395.152] (-398.884) -- 0:00:17 712500 -- (-398.427) [-396.380] (-399.212) (-396.225) * [-394.847] (-395.339) (-396.373) (-395.974) -- 0:00:17 713000 -- (-396.334) (-396.013) (-396.337) [-399.286] * (-394.893) (-396.024) (-394.900) [-396.053] -- 0:00:17 713500 -- (-396.884) (-396.608) [-398.198] (-398.292) * (-398.205) (-395.069) [-397.786] (-398.728) -- 0:00:17 714000 -- (-396.350) (-396.975) [-395.696] (-396.014) * (-396.759) (-397.143) [-395.917] (-395.847) -- 0:00:17 714500 -- (-396.819) (-394.104) (-396.243) [-396.882] * (-398.155) [-396.266] (-396.974) (-394.468) -- 0:00:17 715000 -- [-398.267] (-398.531) (-395.291) (-398.242) * (-401.895) [-397.182] (-395.945) (-398.812) -- 0:00:17 Average standard deviation of split frequencies: 0.006995 715500 -- (-397.224) (-395.447) [-394.783] (-396.874) * (-395.728) (-396.268) (-395.115) [-396.681] -- 0:00:17 716000 -- (-402.889) (-396.435) [-396.430] (-395.800) * (-394.053) [-395.554] (-394.334) (-397.128) -- 0:00:17 716500 -- [-397.977] (-397.806) (-396.303) (-396.144) * [-397.070] (-394.808) (-395.867) (-397.464) -- 0:00:17 717000 -- (-397.453) (-397.651) (-400.413) [-395.318] * (-395.850) (-395.528) [-396.608] (-397.644) -- 0:00:16 717500 -- (-402.139) (-397.992) (-396.938) [-395.040] * (-400.883) (-394.374) (-396.908) [-395.378] -- 0:00:17 718000 -- (-396.041) (-397.091) (-397.831) [-395.764] * (-399.546) (-399.783) [-394.658] (-394.868) -- 0:00:17 718500 -- (-396.049) (-395.559) (-396.442) [-394.964] * (-397.574) (-398.421) (-395.602) [-399.719] -- 0:00:17 719000 -- (-394.740) [-397.656] (-396.908) (-396.774) * (-395.506) (-397.317) (-396.692) [-395.327] -- 0:00:17 719500 -- [-395.483] (-397.490) (-397.929) (-398.794) * (-396.028) (-395.363) (-396.545) [-399.489] -- 0:00:17 720000 -- (-397.834) (-396.072) [-395.025] (-395.932) * (-397.452) (-395.128) [-395.659] (-396.106) -- 0:00:17 Average standard deviation of split frequencies: 0.007154 720500 -- (-402.739) (-395.971) [-397.749] (-397.786) * (-395.334) [-395.112] (-394.933) (-394.755) -- 0:00:17 721000 -- (-398.155) [-396.455] (-395.761) (-397.296) * (-400.207) (-394.822) [-396.240] (-395.704) -- 0:00:17 721500 -- (-395.746) (-396.359) [-395.632] (-398.009) * (-397.075) (-396.285) (-396.136) [-395.823] -- 0:00:16 722000 -- (-399.019) [-394.644] (-397.327) (-397.940) * (-395.464) (-398.323) [-395.923] (-398.570) -- 0:00:16 722500 -- (-396.501) [-398.059] (-394.567) (-395.876) * (-395.134) [-397.547] (-395.869) (-394.561) -- 0:00:16 723000 -- [-397.455] (-394.219) (-394.099) (-395.071) * (-394.786) (-396.249) [-395.467] (-397.445) -- 0:00:16 723500 -- (-397.748) (-393.960) [-394.311] (-395.205) * (-396.203) (-398.546) [-397.445] (-395.772) -- 0:00:16 724000 -- (-396.683) [-396.001] (-397.834) (-397.551) * (-397.764) (-397.688) [-396.628] (-396.736) -- 0:00:16 724500 -- (-398.941) (-400.088) [-394.106] (-399.227) * (-396.112) [-396.430] (-396.555) (-395.744) -- 0:00:16 725000 -- (-399.339) (-399.842) [-397.505] (-395.734) * (-396.547) (-395.980) (-395.102) [-396.105] -- 0:00:16 Average standard deviation of split frequencies: 0.007061 725500 -- [-397.492] (-396.706) (-396.133) (-394.915) * [-395.874] (-395.749) (-395.218) (-397.385) -- 0:00:16 726000 -- (-396.578) (-398.800) (-396.266) [-395.411] * (-398.178) [-399.064] (-397.513) (-397.617) -- 0:00:16 726500 -- (-395.886) (-397.057) [-394.297] (-394.025) * (-397.092) (-400.316) (-395.201) [-397.997] -- 0:00:16 727000 -- (-398.976) [-395.263] (-395.190) (-395.694) * (-396.579) (-397.651) [-395.876] (-398.055) -- 0:00:16 727500 -- (-399.842) [-396.893] (-398.260) (-396.375) * (-394.928) (-395.691) [-394.755] (-396.210) -- 0:00:16 728000 -- (-405.211) [-399.161] (-398.077) (-400.669) * [-395.341] (-396.035) (-394.130) (-394.845) -- 0:00:16 728500 -- (-403.486) (-395.005) (-400.371) [-395.643] * (-396.086) (-396.060) [-395.588] (-396.678) -- 0:00:16 729000 -- (-395.504) (-395.294) [-402.290] (-394.618) * [-397.883] (-397.145) (-397.491) (-398.182) -- 0:00:16 729500 -- (-398.520) (-394.633) (-398.101) [-396.590] * [-398.694] (-394.900) (-396.569) (-398.524) -- 0:00:16 730000 -- (-400.992) (-394.936) [-395.102] (-396.873) * (-396.573) (-395.257) (-400.319) [-398.865] -- 0:00:16 Average standard deviation of split frequencies: 0.007419 730500 -- (-396.223) (-396.897) [-397.722] (-399.682) * (-397.543) [-395.953] (-397.108) (-399.752) -- 0:00:16 731000 -- (-397.059) (-399.653) [-395.128] (-396.989) * (-397.190) (-394.846) (-395.852) [-395.420] -- 0:00:16 731500 -- (-394.842) (-396.592) [-394.314] (-398.297) * (-396.442) (-396.143) (-395.270) [-396.065] -- 0:00:16 732000 -- (-403.640) [-395.115] (-394.426) (-399.169) * (-396.468) (-397.977) (-394.715) [-396.330] -- 0:00:16 732500 -- (-402.551) (-396.341) [-397.663] (-397.159) * (-395.975) (-396.384) [-395.970] (-394.753) -- 0:00:16 733000 -- (-403.118) (-396.136) (-398.863) [-397.945] * (-394.832) (-398.983) [-395.996] (-395.476) -- 0:00:16 733500 -- (-403.802) [-395.892] (-396.598) (-396.289) * (-395.643) [-395.904] (-394.772) (-395.394) -- 0:00:16 734000 -- (-399.696) (-394.934) (-396.227) [-395.906] * (-395.146) [-396.061] (-397.404) (-395.396) -- 0:00:16 734500 -- (-397.155) (-394.086) (-395.185) [-396.019] * (-396.273) (-398.128) [-395.918] (-398.994) -- 0:00:16 735000 -- (-397.999) (-395.733) (-396.524) [-394.540] * (-394.948) [-396.724] (-395.398) (-395.219) -- 0:00:16 Average standard deviation of split frequencies: 0.007326 735500 -- (-399.950) (-399.424) (-397.447) [-395.838] * (-395.497) (-400.571) (-402.331) [-400.346] -- 0:00:16 736000 -- (-394.924) [-395.020] (-396.981) (-398.582) * (-394.204) (-397.281) (-405.751) [-394.541] -- 0:00:16 736500 -- (-397.404) [-395.015] (-395.873) (-394.866) * [-394.789] (-394.502) (-409.130) (-395.092) -- 0:00:16 737000 -- (-398.182) [-396.852] (-395.304) (-395.333) * [-395.359] (-396.435) (-398.053) (-403.954) -- 0:00:16 737500 -- [-396.841] (-395.903) (-395.328) (-395.200) * (-399.339) (-396.499) (-395.625) [-399.326] -- 0:00:16 738000 -- [-395.814] (-396.885) (-398.049) (-394.294) * [-400.483] (-394.730) (-395.306) (-397.553) -- 0:00:15 738500 -- (-396.571) (-395.459) (-397.436) [-396.010] * (-396.153) (-396.908) [-394.846] (-400.340) -- 0:00:15 739000 -- (-394.932) [-396.565] (-397.187) (-394.460) * [-394.344] (-400.398) (-395.104) (-395.326) -- 0:00:15 739500 -- (-396.398) (-395.413) [-395.872] (-394.225) * (-394.851) (-398.221) [-396.779] (-399.191) -- 0:00:15 740000 -- (-400.048) (-395.438) [-396.362] (-395.656) * (-396.269) (-399.829) (-394.587) [-397.808] -- 0:00:15 Average standard deviation of split frequencies: 0.006921 740500 -- (-397.487) [-395.800] (-399.573) (-395.059) * (-396.301) [-394.454] (-398.240) (-397.144) -- 0:00:15 741000 -- (-395.788) (-396.502) (-402.769) [-395.108] * (-396.259) [-394.933] (-394.648) (-396.163) -- 0:00:15 741500 -- (-395.217) (-396.789) (-394.791) [-394.329] * (-399.689) [-398.203] (-398.386) (-395.523) -- 0:00:15 742000 -- (-395.745) [-397.023] (-396.300) (-394.106) * (-396.517) [-397.687] (-397.471) (-395.266) -- 0:00:15 742500 -- [-397.913] (-398.345) (-400.985) (-394.419) * (-402.018) [-394.731] (-397.440) (-395.263) -- 0:00:15 743000 -- (-397.465) (-395.059) [-397.559] (-394.603) * (-396.675) (-395.875) (-398.322) [-395.267] -- 0:00:15 743500 -- (-398.946) [-396.532] (-398.239) (-394.603) * (-396.294) [-398.980] (-394.726) (-395.636) -- 0:00:15 744000 -- (-394.458) (-394.673) [-397.678] (-395.544) * (-397.819) (-394.876) [-396.025] (-395.277) -- 0:00:15 744500 -- [-394.729] (-395.007) (-396.250) (-395.912) * (-401.792) (-397.023) (-395.520) [-396.358] -- 0:00:15 745000 -- (-397.326) (-395.823) (-395.123) [-397.922] * (-396.727) (-397.781) [-394.426] (-396.910) -- 0:00:15 Average standard deviation of split frequencies: 0.006912 745500 -- (-396.345) [-395.729] (-395.430) (-395.566) * (-397.642) (-397.881) (-394.947) [-397.237] -- 0:00:15 746000 -- (-397.015) [-400.344] (-398.086) (-396.887) * (-397.740) [-395.987] (-394.995) (-397.736) -- 0:00:15 746500 -- (-397.589) (-396.733) [-395.956] (-397.529) * [-397.525] (-399.006) (-395.363) (-394.773) -- 0:00:15 747000 -- (-395.494) [-394.506] (-395.959) (-395.109) * [-395.015] (-396.785) (-395.181) (-395.649) -- 0:00:15 747500 -- [-395.664] (-395.954) (-399.276) (-396.671) * [-394.535] (-400.028) (-397.846) (-398.060) -- 0:00:15 748000 -- (-395.932) (-394.483) (-396.306) [-396.904] * (-394.563) [-395.451] (-398.164) (-398.342) -- 0:00:15 748500 -- (-398.011) [-394.149] (-395.029) (-398.176) * [-394.198] (-394.865) (-398.786) (-395.689) -- 0:00:15 749000 -- (-395.985) (-397.364) (-394.576) [-400.736] * (-394.270) (-394.689) [-398.420] (-394.644) -- 0:00:15 749500 -- [-396.861] (-395.653) (-395.464) (-398.902) * [-395.812] (-395.078) (-395.511) (-397.351) -- 0:00:15 750000 -- (-398.496) (-396.189) (-397.457) [-395.376] * (-394.719) (-395.137) [-396.687] (-397.666) -- 0:00:15 Average standard deviation of split frequencies: 0.006790 750500 -- (-398.151) (-398.153) [-397.253] (-396.876) * (-396.136) (-396.246) [-395.220] (-396.726) -- 0:00:15 751000 -- (-397.442) (-396.553) [-394.953] (-394.479) * (-398.825) (-399.496) (-397.509) [-396.239] -- 0:00:15 751500 -- (-397.210) (-395.962) (-395.237) [-395.558] * (-397.574) (-397.210) (-399.928) [-396.137] -- 0:00:15 752000 -- (-395.184) (-395.214) (-398.915) [-397.660] * (-397.792) (-396.283) (-408.632) [-395.537] -- 0:00:15 752500 -- (-398.639) (-396.788) (-396.474) [-396.690] * (-394.585) (-398.226) (-396.002) [-394.469] -- 0:00:15 753000 -- (-397.647) [-394.001] (-397.811) (-395.823) * [-395.228] (-397.409) (-396.588) (-395.422) -- 0:00:15 753500 -- (-397.839) [-395.283] (-396.865) (-396.164) * (-397.658) (-396.381) (-396.135) [-395.715] -- 0:00:15 754000 -- [-398.454] (-397.379) (-398.067) (-394.206) * [-397.658] (-394.980) (-394.352) (-394.810) -- 0:00:15 754500 -- (-398.676) (-394.314) (-396.118) [-394.759] * (-397.674) (-394.372) [-394.970] (-396.415) -- 0:00:14 755000 -- [-394.826] (-396.876) (-398.939) (-394.678) * (-398.233) (-396.669) (-396.952) [-396.249] -- 0:00:14 Average standard deviation of split frequencies: 0.006526 755500 -- (-395.993) [-396.625] (-396.668) (-398.541) * (-399.493) (-398.870) (-396.646) [-394.918] -- 0:00:14 756000 -- (-395.033) [-395.051] (-397.149) (-396.427) * (-394.921) [-398.613] (-398.306) (-394.865) -- 0:00:14 756500 -- (-394.997) [-395.519] (-395.528) (-395.495) * (-396.444) [-394.632] (-396.348) (-400.086) -- 0:00:14 757000 -- (-395.428) (-396.341) (-395.269) [-394.030] * (-397.147) (-397.081) [-397.506] (-396.652) -- 0:00:14 757500 -- (-395.539) (-394.735) (-394.598) [-394.113] * (-396.189) (-395.345) (-399.741) [-395.360] -- 0:00:14 758000 -- (-395.555) (-394.891) [-394.695] (-394.886) * (-395.230) [-394.717] (-399.795) (-397.179) -- 0:00:14 758500 -- (-396.124) (-395.894) (-400.271) [-394.219] * (-398.725) (-397.096) (-398.538) [-394.575] -- 0:00:14 759000 -- (-399.754) (-396.225) (-395.027) [-394.216] * (-402.775) [-394.881] (-400.304) (-394.740) -- 0:00:14 759500 -- [-399.681] (-395.813) (-394.609) (-395.411) * (-396.632) [-394.690] (-401.576) (-396.182) -- 0:00:14 760000 -- (-397.488) (-395.315) (-396.104) [-397.281] * (-400.355) (-395.509) (-397.357) [-396.718] -- 0:00:14 Average standard deviation of split frequencies: 0.006858 760500 -- (-398.268) [-396.089] (-398.065) (-399.382) * (-399.276) (-395.235) (-396.165) [-395.631] -- 0:00:14 761000 -- (-397.168) (-394.590) (-399.479) [-395.798] * [-399.584] (-398.011) (-398.905) (-395.587) -- 0:00:14 761500 -- (-395.418) (-397.760) [-402.228] (-394.979) * (-394.811) [-396.613] (-395.797) (-396.783) -- 0:00:14 762000 -- (-394.883) (-394.374) [-394.929] (-396.424) * (-398.412) (-395.793) [-399.569] (-397.307) -- 0:00:14 762500 -- (-396.456) (-394.685) (-397.068) [-398.197] * [-395.384] (-397.115) (-395.299) (-401.803) -- 0:00:14 763000 -- [-396.053] (-395.900) (-396.657) (-395.691) * (-397.588) (-401.416) (-396.160) [-396.064] -- 0:00:14 763500 -- (-397.354) [-394.720] (-395.903) (-397.127) * (-394.093) [-402.771] (-398.182) (-398.266) -- 0:00:14 764000 -- (-395.487) (-397.417) [-394.687] (-398.566) * (-395.542) (-397.551) (-399.850) [-395.831] -- 0:00:14 764500 -- [-394.533] (-396.785) (-397.139) (-397.570) * (-394.780) (-395.606) [-398.654] (-395.251) -- 0:00:14 765000 -- [-396.862] (-395.422) (-396.143) (-398.472) * [-396.498] (-395.587) (-397.099) (-395.135) -- 0:00:14 Average standard deviation of split frequencies: 0.007508 765500 -- (-398.188) (-394.387) (-400.405) [-395.170] * (-395.669) [-398.405] (-394.324) (-396.474) -- 0:00:14 766000 -- (-402.437) (-396.145) [-402.929] (-396.804) * (-398.079) [-396.354] (-395.308) (-396.166) -- 0:00:14 766500 -- [-398.613] (-395.985) (-401.477) (-396.427) * (-400.466) [-396.192] (-395.463) (-396.668) -- 0:00:14 767000 -- (-396.316) (-394.992) (-398.320) [-394.609] * [-395.258] (-395.796) (-395.579) (-394.592) -- 0:00:14 767500 -- (-396.110) [-396.481] (-395.487) (-394.933) * (-395.887) (-395.873) (-396.415) [-395.625] -- 0:00:14 768000 -- [-395.699] (-395.621) (-396.878) (-395.059) * (-398.367) (-395.603) (-396.413) [-396.419] -- 0:00:14 768500 -- [-395.027] (-396.026) (-396.925) (-394.210) * (-399.055) (-395.948) (-396.448) [-395.331] -- 0:00:14 769000 -- (-397.831) (-395.559) (-403.371) [-400.083] * (-396.891) (-397.701) (-395.520) [-397.575] -- 0:00:14 769500 -- (-395.094) (-394.528) (-397.063) [-396.358] * [-397.136] (-395.729) (-401.013) (-396.713) -- 0:00:14 770000 -- (-395.617) (-401.165) (-394.599) [-396.104] * (-395.682) (-397.636) (-396.751) [-394.853] -- 0:00:14 Average standard deviation of split frequencies: 0.006810 770500 -- (-395.241) [-396.110] (-397.898) (-398.447) * (-399.196) (-398.140) [-397.519] (-394.419) -- 0:00:13 771000 -- [-395.255] (-395.055) (-399.667) (-397.266) * (-395.225) [-394.289] (-395.901) (-397.358) -- 0:00:13 771500 -- (-400.018) (-397.298) [-402.176] (-395.871) * [-395.561] (-394.318) (-394.833) (-396.487) -- 0:00:13 772000 -- (-395.643) [-396.297] (-398.330) (-395.089) * [-396.832] (-395.118) (-395.287) (-397.365) -- 0:00:13 772500 -- (-394.742) [-395.513] (-396.759) (-395.623) * [-394.978] (-394.948) (-396.318) (-400.099) -- 0:00:13 773000 -- (-397.702) [-395.436] (-395.855) (-394.406) * [-395.066] (-395.168) (-396.688) (-397.128) -- 0:00:13 773500 -- [-396.689] (-400.694) (-394.392) (-394.863) * [-396.806] (-401.077) (-397.770) (-399.964) -- 0:00:13 774000 -- (-397.469) [-397.521] (-396.439) (-398.898) * (-396.917) (-397.076) [-396.989] (-404.484) -- 0:00:13 774500 -- (-400.082) [-395.959] (-397.253) (-396.247) * [-398.368] (-399.492) (-399.623) (-399.645) -- 0:00:13 775000 -- (-398.839) (-396.683) (-396.909) [-396.367] * (-396.714) [-396.201] (-396.215) (-395.350) -- 0:00:13 Average standard deviation of split frequencies: 0.006601 775500 -- [-396.952] (-394.227) (-396.739) (-396.678) * (-400.350) (-395.865) [-395.881] (-397.472) -- 0:00:13 776000 -- (-399.533) (-397.012) [-395.833] (-403.032) * (-401.526) (-395.620) [-394.627] (-395.671) -- 0:00:13 776500 -- (-395.244) (-399.198) (-396.597) [-397.622] * (-395.622) [-397.513] (-396.191) (-395.300) -- 0:00:13 777000 -- [-400.528] (-397.458) (-396.673) (-395.773) * (-396.403) (-395.185) [-395.075] (-395.091) -- 0:00:13 777500 -- [-396.780] (-394.700) (-402.422) (-397.146) * (-396.688) (-399.922) (-395.177) [-394.314] -- 0:00:13 778000 -- (-394.998) (-394.831) (-400.943) [-397.233] * (-397.069) (-395.175) (-397.530) [-395.367] -- 0:00:13 778500 -- [-394.438] (-396.703) (-397.602) (-396.661) * (-397.260) (-397.285) [-394.884] (-396.104) -- 0:00:13 779000 -- (-398.445) (-399.383) [-396.397] (-397.880) * (-398.658) (-397.509) [-394.559] (-401.768) -- 0:00:13 779500 -- (-394.987) (-400.859) (-396.378) [-395.861] * (-395.751) (-395.572) [-395.557] (-396.509) -- 0:00:13 780000 -- [-395.534] (-394.496) (-397.429) (-397.147) * (-398.680) [-401.638] (-395.525) (-397.755) -- 0:00:13 Average standard deviation of split frequencies: 0.006441 780500 -- [-394.611] (-395.113) (-395.762) (-395.899) * (-395.615) [-395.196] (-398.519) (-396.857) -- 0:00:13 781000 -- [-395.650] (-397.277) (-394.728) (-396.982) * (-397.492) [-395.473] (-394.990) (-397.227) -- 0:00:13 781500 -- (-394.855) (-397.779) [-397.989] (-395.758) * [-396.266] (-396.637) (-395.153) (-398.296) -- 0:00:13 782000 -- (-394.886) (-395.649) [-396.354] (-397.151) * [-396.884] (-394.505) (-394.961) (-397.228) -- 0:00:13 782500 -- (-395.802) [-397.435] (-394.538) (-396.659) * (-395.164) (-397.043) (-394.834) [-394.435] -- 0:00:13 783000 -- (-396.022) (-397.065) (-395.784) [-400.796] * (-394.803) (-395.086) [-396.240] (-394.686) -- 0:00:13 783500 -- (-394.824) [-395.858] (-395.939) (-395.339) * (-394.282) [-394.787] (-395.896) (-395.470) -- 0:00:13 784000 -- (-400.247) [-394.666] (-395.454) (-396.125) * (-394.765) (-398.043) [-394.734] (-395.345) -- 0:00:13 784500 -- (-394.144) [-397.250] (-395.896) (-395.970) * (-395.724) (-396.866) [-396.495] (-396.107) -- 0:00:13 785000 -- (-396.812) [-396.411] (-395.999) (-401.251) * (-394.948) [-396.618] (-399.019) (-399.221) -- 0:00:13 Average standard deviation of split frequencies: 0.006437 785500 -- (-395.399) (-395.952) (-397.328) [-397.567] * (-403.364) (-394.858) [-395.789] (-396.089) -- 0:00:13 786000 -- [-395.039] (-395.310) (-395.164) (-395.287) * (-395.030) (-397.911) [-396.273] (-398.887) -- 0:00:13 786500 -- (-398.422) (-395.556) (-398.563) [-401.217] * (-400.133) (-399.154) [-396.659] (-396.154) -- 0:00:13 787000 -- (-397.669) [-398.088] (-396.124) (-397.817) * (-395.955) (-396.159) [-395.969] (-398.535) -- 0:00:12 787500 -- (-396.916) (-398.091) [-397.800] (-394.830) * (-398.612) [-396.609] (-397.213) (-397.610) -- 0:00:12 788000 -- [-397.383] (-395.096) (-403.379) (-398.759) * (-395.947) (-398.936) (-397.559) [-395.742] -- 0:00:12 788500 -- (-399.458) [-394.298] (-398.748) (-396.403) * (-395.420) (-395.894) [-399.430] (-395.027) -- 0:00:12 789000 -- [-397.271] (-396.302) (-396.214) (-397.460) * [-395.608] (-396.419) (-397.738) (-395.659) -- 0:00:12 789500 -- (-394.988) [-395.943] (-397.307) (-398.277) * [-395.490] (-396.906) (-400.655) (-395.514) -- 0:00:12 790000 -- (-396.513) [-397.441] (-396.018) (-397.173) * [-396.262] (-396.046) (-395.837) (-395.117) -- 0:00:12 Average standard deviation of split frequencies: 0.006876 790500 -- (-397.018) [-395.282] (-395.994) (-398.544) * (-394.887) (-396.842) [-396.934] (-395.733) -- 0:00:12 791000 -- (-396.233) (-398.967) [-395.832] (-395.485) * [-394.511] (-396.134) (-394.861) (-401.427) -- 0:00:12 791500 -- (-398.190) (-396.854) [-396.655] (-394.532) * [-394.916] (-395.712) (-395.308) (-408.653) -- 0:00:12 792000 -- (-397.713) [-395.812] (-397.916) (-396.266) * [-396.947] (-395.320) (-396.072) (-398.729) -- 0:00:12 792500 -- (-396.444) [-398.836] (-395.769) (-397.041) * [-397.137] (-395.214) (-401.216) (-395.390) -- 0:00:12 793000 -- (-403.159) (-396.511) [-395.139] (-398.120) * (-402.477) (-398.661) [-394.965] (-394.387) -- 0:00:12 793500 -- (-396.969) (-396.349) [-397.871] (-396.755) * (-399.319) [-396.623] (-395.105) (-397.587) -- 0:00:12 794000 -- (-395.328) (-396.980) [-396.582] (-398.960) * (-396.616) (-397.580) (-395.580) [-396.325] -- 0:00:12 794500 -- (-396.691) (-399.467) [-396.532] (-395.692) * (-396.474) (-397.675) [-397.141] (-398.313) -- 0:00:12 795000 -- (-402.616) (-397.461) [-395.953] (-395.147) * [-397.314] (-394.403) (-399.845) (-400.359) -- 0:00:12 Average standard deviation of split frequencies: 0.007146 795500 -- (-396.927) (-398.931) [-396.102] (-397.595) * [-395.880] (-394.949) (-397.366) (-395.650) -- 0:00:12 796000 -- (-400.009) (-395.885) [-396.572] (-398.567) * (-394.705) (-397.133) (-397.193) [-395.356] -- 0:00:12 796500 -- [-400.305] (-395.996) (-399.311) (-398.073) * [-394.682] (-398.275) (-397.153) (-397.341) -- 0:00:12 797000 -- (-396.398) (-395.670) [-397.957] (-396.553) * (-395.726) (-396.601) (-396.503) [-396.405] -- 0:00:12 797500 -- (-394.492) (-397.520) (-395.190) [-395.273] * (-396.971) (-400.626) (-394.680) [-397.802] -- 0:00:12 798000 -- (-394.486) (-397.758) (-396.794) [-394.802] * (-399.185) (-397.013) [-394.332] (-400.364) -- 0:00:12 798500 -- (-396.131) (-397.982) [-395.883] (-395.093) * (-395.330) [-395.109] (-394.665) (-394.283) -- 0:00:12 799000 -- [-395.845] (-395.370) (-395.225) (-395.129) * (-395.217) [-396.866] (-396.724) (-394.430) -- 0:00:12 799500 -- (-399.273) (-396.732) [-395.765] (-396.637) * [-395.220] (-395.709) (-402.061) (-394.579) -- 0:00:12 800000 -- [-397.164] (-395.413) (-395.595) (-397.563) * (-397.732) [-396.352] (-397.090) (-394.630) -- 0:00:12 Average standard deviation of split frequencies: 0.007497 800500 -- (-395.688) (-400.217) (-400.796) [-395.880] * [-396.630] (-397.547) (-396.505) (-395.179) -- 0:00:12 801000 -- [-397.633] (-396.970) (-395.793) (-394.987) * [-395.872] (-396.164) (-399.369) (-398.630) -- 0:00:12 801500 -- [-397.591] (-396.462) (-396.892) (-395.348) * [-397.666] (-401.562) (-398.610) (-395.506) -- 0:00:12 802000 -- (-396.652) (-398.496) (-397.711) [-395.057] * (-397.811) [-394.989] (-398.567) (-394.984) -- 0:00:12 802500 -- (-394.809) [-398.712] (-395.629) (-397.812) * [-397.101] (-396.376) (-400.251) (-395.079) -- 0:00:12 803000 -- (-395.475) (-397.122) (-395.797) [-399.267] * (-397.539) (-397.391) (-395.921) [-398.965] -- 0:00:12 803500 -- (-394.487) [-395.385] (-395.653) (-396.321) * (-396.704) (-396.581) [-394.969] (-395.335) -- 0:00:11 804000 -- (-395.068) (-400.277) [-394.490] (-394.173) * (-397.451) (-394.322) [-395.587] (-398.389) -- 0:00:11 804500 -- (-395.334) [-396.631] (-395.209) (-395.801) * [-397.000] (-398.272) (-395.474) (-395.287) -- 0:00:11 805000 -- (-395.857) (-394.537) (-396.684) [-394.713] * [-396.672] (-394.796) (-397.249) (-396.692) -- 0:00:11 Average standard deviation of split frequencies: 0.007057 805500 -- (-394.265) [-397.186] (-397.384) (-399.038) * [-398.402] (-396.811) (-396.312) (-398.952) -- 0:00:11 806000 -- [-396.312] (-397.097) (-396.611) (-400.093) * (-398.236) [-396.555] (-395.469) (-397.773) -- 0:00:11 806500 -- (-395.227) [-396.542] (-399.176) (-394.639) * (-397.278) (-395.258) (-395.896) [-395.155] -- 0:00:11 807000 -- (-398.512) (-395.864) [-395.075] (-394.432) * [-394.754] (-394.829) (-396.065) (-394.427) -- 0:00:11 807500 -- (-396.046) (-398.931) [-397.065] (-395.368) * (-394.891) (-398.896) [-396.022] (-395.391) -- 0:00:11 808000 -- (-394.365) (-396.615) [-395.339] (-396.766) * (-400.523) (-396.192) (-396.755) [-395.312] -- 0:00:11 808500 -- (-398.636) (-395.775) (-396.683) [-394.910] * (-396.950) (-394.606) [-400.510] (-396.201) -- 0:00:11 809000 -- (-396.936) (-395.910) (-397.232) [-394.671] * (-395.998) [-397.455] (-398.984) (-395.295) -- 0:00:11 809500 -- (-396.238) [-397.384] (-395.751) (-396.586) * (-395.673) (-397.848) (-401.041) [-396.049] -- 0:00:11 810000 -- (-396.378) (-400.999) [-401.152] (-395.623) * (-398.570) (-395.241) (-397.176) [-395.762] -- 0:00:11 Average standard deviation of split frequencies: 0.007133 810500 -- (-394.347) (-396.915) [-396.636] (-399.269) * (-398.236) [-394.836] (-399.915) (-397.498) -- 0:00:11 811000 -- [-394.733] (-399.402) (-395.449) (-398.740) * (-395.513) (-395.199) [-396.549] (-394.856) -- 0:00:11 811500 -- (-397.567) [-394.661] (-397.746) (-400.669) * [-396.517] (-396.766) (-395.224) (-399.198) -- 0:00:11 812000 -- (-395.913) (-398.441) [-401.540] (-394.440) * (-398.890) (-397.339) [-395.297] (-397.528) -- 0:00:11 812500 -- (-398.318) (-398.989) (-396.088) [-394.471] * (-394.461) (-396.628) [-396.651] (-398.437) -- 0:00:11 813000 -- (-399.180) (-400.261) (-397.832) [-394.866] * (-394.771) (-396.955) [-400.815] (-398.607) -- 0:00:11 813500 -- (-395.527) (-400.004) (-395.046) [-395.703] * (-397.881) (-398.155) (-395.844) [-394.964] -- 0:00:11 814000 -- (-398.241) (-395.361) [-394.499] (-397.746) * (-396.941) [-394.662] (-396.493) (-397.037) -- 0:00:11 814500 -- (-399.270) [-397.718] (-395.235) (-394.290) * (-395.687) [-397.700] (-395.441) (-394.729) -- 0:00:11 815000 -- (-401.144) (-398.252) (-397.575) [-394.689] * (-398.407) [-396.142] (-395.618) (-395.034) -- 0:00:11 Average standard deviation of split frequencies: 0.007356 815500 -- (-396.842) [-397.109] (-400.197) (-395.162) * (-396.288) [-397.960] (-396.984) (-396.365) -- 0:00:11 816000 -- [-395.710] (-397.832) (-399.827) (-394.735) * (-399.232) [-395.885] (-396.541) (-396.224) -- 0:00:11 816500 -- (-397.040) (-396.019) [-396.348] (-394.590) * (-400.026) (-397.932) [-396.703] (-396.011) -- 0:00:11 817000 -- [-396.262] (-397.582) (-396.025) (-394.734) * [-395.814] (-400.654) (-396.964) (-396.606) -- 0:00:11 817500 -- [-398.747] (-400.586) (-397.094) (-395.347) * (-396.648) [-396.041] (-396.872) (-397.100) -- 0:00:11 818000 -- [-396.369] (-396.899) (-399.784) (-396.486) * (-398.787) (-395.164) (-395.808) [-394.686] -- 0:00:11 818500 -- (-394.835) [-396.277] (-394.631) (-396.261) * [-394.530] (-400.857) (-396.616) (-393.974) -- 0:00:11 819000 -- (-395.970) (-401.630) (-401.859) [-396.170] * (-395.062) (-397.463) (-399.498) [-395.875] -- 0:00:11 819500 -- (-395.431) (-396.569) (-397.121) [-399.652] * (-394.605) (-397.281) [-395.123] (-400.058) -- 0:00:11 820000 -- [-396.341] (-398.597) (-399.023) (-399.701) * (-395.966) (-394.308) (-396.155) [-394.070] -- 0:00:10 Average standard deviation of split frequencies: 0.007735 820500 -- [-396.992] (-399.269) (-397.791) (-398.411) * (-395.651) (-394.141) (-394.311) [-396.288] -- 0:00:10 821000 -- [-401.164] (-396.231) (-397.603) (-397.093) * (-395.546) [-394.481] (-397.189) (-396.890) -- 0:00:10 821500 -- (-398.426) (-403.028) (-395.032) [-398.465] * (-395.430) [-394.648] (-394.723) (-395.943) -- 0:00:10 822000 -- (-395.294) [-395.760] (-396.949) (-395.555) * [-396.001] (-396.318) (-400.887) (-397.768) -- 0:00:10 822500 -- (-399.178) (-395.044) [-397.524] (-395.112) * [-394.798] (-396.930) (-399.874) (-396.794) -- 0:00:10 823000 -- (-397.175) (-396.834) (-395.999) [-395.403] * (-394.747) [-396.489] (-399.366) (-396.979) -- 0:00:10 823500 -- [-395.801] (-396.301) (-396.116) (-394.837) * (-396.685) (-396.504) [-396.399] (-396.419) -- 0:00:10 824000 -- (-396.218) [-394.648] (-396.598) (-394.286) * [-394.254] (-396.284) (-398.241) (-395.347) -- 0:00:10 824500 -- (-396.540) (-397.960) (-396.657) [-395.473] * [-394.487] (-397.324) (-395.188) (-395.284) -- 0:00:10 825000 -- (-397.273) [-395.274] (-396.097) (-398.695) * (-396.446) (-394.179) (-396.259) [-395.515] -- 0:00:10 Average standard deviation of split frequencies: 0.007305 825500 -- (-395.468) (-397.631) (-396.352) [-399.107] * [-396.615] (-395.888) (-396.538) (-395.482) -- 0:00:10 826000 -- (-397.666) [-395.849] (-395.128) (-398.200) * [-396.262] (-397.638) (-395.483) (-394.237) -- 0:00:10 826500 -- (-399.068) (-394.933) [-397.093] (-395.891) * (-395.379) (-397.438) [-394.693] (-394.529) -- 0:00:10 827000 -- (-394.930) (-396.978) [-394.455] (-398.172) * (-400.279) (-399.026) (-395.751) [-397.156] -- 0:00:10 827500 -- [-398.245] (-394.585) (-399.520) (-402.372) * [-396.133] (-398.218) (-398.201) (-396.858) -- 0:00:10 828000 -- (-394.706) (-395.544) (-397.561) [-399.352] * (-395.330) (-396.437) [-396.970] (-395.044) -- 0:00:10 828500 -- (-394.985) (-396.984) [-398.349] (-400.482) * (-395.435) (-398.336) [-395.504] (-394.689) -- 0:00:10 829000 -- (-394.635) [-396.079] (-398.332) (-395.647) * (-395.431) (-397.785) [-396.192] (-399.608) -- 0:00:10 829500 -- (-395.084) (-396.026) [-396.286] (-397.154) * [-394.484] (-397.543) (-394.955) (-397.804) -- 0:00:10 830000 -- (-393.919) (-394.516) [-395.284] (-395.158) * (-396.658) (-397.279) (-398.305) [-397.302] -- 0:00:10 Average standard deviation of split frequencies: 0.007151 830500 -- (-397.282) (-396.106) [-394.894] (-397.124) * [-394.058] (-401.017) (-396.416) (-397.329) -- 0:00:10 831000 -- (-396.053) (-396.086) [-396.310] (-394.558) * (-394.322) [-396.348] (-399.638) (-394.014) -- 0:00:10 831500 -- (-395.465) [-395.103] (-399.001) (-394.874) * [-400.282] (-396.750) (-398.815) (-395.669) -- 0:00:10 832000 -- (-395.741) (-398.749) [-395.785] (-397.684) * (-397.506) [-394.778] (-399.825) (-397.860) -- 0:00:10 832500 -- (-394.864) (-395.197) [-395.789] (-396.522) * (-395.345) (-397.095) (-396.299) [-397.552] -- 0:00:10 833000 -- (-394.946) (-396.219) [-394.880] (-395.978) * (-398.128) [-396.135] (-395.779) (-398.656) -- 0:00:10 833500 -- (-397.118) [-394.347] (-397.001) (-397.820) * (-398.736) (-396.513) (-395.719) [-394.390] -- 0:00:10 834000 -- [-395.456] (-397.129) (-398.863) (-399.642) * (-398.269) (-397.419) (-395.064) [-394.894] -- 0:00:10 834500 -- [-395.408] (-396.309) (-394.920) (-400.014) * (-400.666) (-395.333) [-395.124] (-397.518) -- 0:00:10 835000 -- (-398.992) (-397.381) [-395.320] (-394.633) * (-397.495) (-395.347) (-395.242) [-395.337] -- 0:00:10 Average standard deviation of split frequencies: 0.006804 835500 -- (-400.881) (-395.117) (-394.080) [-395.808] * (-397.243) [-395.748] (-395.287) (-396.957) -- 0:00:10 836000 -- [-396.659] (-396.651) (-394.194) (-395.446) * (-395.847) (-397.363) [-396.790] (-395.560) -- 0:00:10 836500 -- (-397.524) (-396.105) (-395.675) [-394.182] * (-397.319) (-396.565) (-397.063) [-396.505] -- 0:00:09 837000 -- (-396.833) (-396.577) [-397.384] (-394.395) * [-398.349] (-400.921) (-397.981) (-401.807) -- 0:00:09 837500 -- [-395.077] (-398.479) (-400.417) (-394.900) * (-397.649) (-401.686) (-395.138) [-397.073] -- 0:00:09 838000 -- (-396.126) [-394.173] (-396.782) (-395.294) * [-398.552] (-395.405) (-400.485) (-400.234) -- 0:00:09 838500 -- (-398.085) (-401.155) [-395.996] (-394.916) * (-396.105) (-396.811) [-396.379] (-398.439) -- 0:00:09 839000 -- [-395.395] (-402.725) (-394.933) (-396.227) * (-398.125) [-395.031] (-400.783) (-395.800) -- 0:00:09 839500 -- (-394.321) (-398.686) (-395.609) [-402.502] * (-394.493) [-396.375] (-395.608) (-400.629) -- 0:00:09 840000 -- (-397.562) (-398.494) [-396.249] (-395.771) * (-394.990) (-395.143) (-397.900) [-399.411] -- 0:00:09 Average standard deviation of split frequencies: 0.006654 840500 -- [-397.264] (-394.194) (-399.318) (-396.178) * (-394.504) (-395.133) [-395.594] (-396.501) -- 0:00:09 841000 -- [-394.665] (-394.417) (-397.300) (-394.628) * (-396.180) (-396.951) [-394.284] (-399.080) -- 0:00:09 841500 -- (-396.913) (-395.090) [-398.462] (-396.450) * (-397.058) (-396.531) (-395.911) [-397.167] -- 0:00:09 842000 -- (-401.182) (-398.281) (-395.595) [-398.819] * (-400.593) (-401.742) (-395.679) [-394.101] -- 0:00:09 842500 -- (-397.861) (-396.012) (-403.072) [-403.117] * (-395.567) (-397.859) (-395.262) [-395.339] -- 0:00:09 843000 -- [-395.435] (-395.202) (-398.398) (-399.380) * (-396.422) [-399.722] (-396.066) (-398.650) -- 0:00:09 843500 -- (-399.381) [-396.663] (-395.579) (-395.375) * (-395.109) (-400.085) (-399.304) [-397.228] -- 0:00:09 844000 -- (-397.564) (-394.701) (-397.126) [-397.805] * [-395.726] (-398.159) (-397.710) (-395.048) -- 0:00:09 844500 -- (-398.495) [-394.602] (-396.597) (-398.771) * [-397.808] (-395.890) (-396.487) (-396.306) -- 0:00:09 845000 -- (-398.208) (-397.574) [-398.367] (-397.772) * (-397.887) (-394.368) [-394.684] (-395.447) -- 0:00:09 Average standard deviation of split frequencies: 0.006761 845500 -- (-399.938) (-395.868) (-399.988) [-394.464] * [-394.431] (-398.532) (-399.111) (-394.784) -- 0:00:09 846000 -- (-399.317) [-395.488] (-396.830) (-394.516) * (-396.882) (-394.727) [-397.686] (-394.159) -- 0:00:09 846500 -- (-395.939) [-395.675] (-398.321) (-395.786) * (-397.373) (-395.851) [-399.147] (-395.991) -- 0:00:09 847000 -- (-394.522) (-395.663) (-400.612) [-395.774] * [-395.981] (-395.795) (-401.406) (-396.976) -- 0:00:09 847500 -- (-397.619) (-396.318) (-398.600) [-397.319] * (-395.963) [-395.349] (-395.446) (-396.699) -- 0:00:09 848000 -- [-394.198] (-397.684) (-396.511) (-395.382) * (-396.311) [-394.922] (-397.383) (-396.565) -- 0:00:09 848500 -- [-394.792] (-396.537) (-396.840) (-394.879) * (-394.684) [-397.382] (-395.453) (-395.089) -- 0:00:09 849000 -- (-395.228) (-396.180) [-397.434] (-399.968) * (-397.352) [-394.661] (-401.178) (-395.290) -- 0:00:09 849500 -- (-394.853) [-397.142] (-398.983) (-394.425) * (-396.921) [-396.927] (-399.475) (-397.043) -- 0:00:09 850000 -- (-396.521) [-395.729] (-398.042) (-395.598) * [-395.791] (-394.706) (-396.345) (-394.882) -- 0:00:09 Average standard deviation of split frequencies: 0.007093 850500 -- (-395.526) [-395.791] (-396.483) (-397.186) * (-395.591) (-395.175) (-395.415) [-398.245] -- 0:00:09 851000 -- (-395.067) [-395.444] (-397.968) (-397.240) * [-396.108] (-395.445) (-396.767) (-396.192) -- 0:00:09 851500 -- (-394.384) (-395.597) (-395.717) [-397.037] * (-399.397) [-395.584] (-395.373) (-394.353) -- 0:00:09 852000 -- (-398.043) (-396.134) [-396.202] (-395.868) * (-398.692) (-395.370) [-394.537] (-394.776) -- 0:00:09 852500 -- (-396.219) (-395.922) (-395.463) [-394.738] * (-395.642) (-398.519) (-400.960) [-395.796] -- 0:00:08 853000 -- (-398.667) [-395.672] (-396.785) (-399.078) * (-395.957) (-396.152) [-395.494] (-395.579) -- 0:00:08 853500 -- [-399.683] (-395.955) (-398.256) (-397.228) * (-395.622) [-396.691] (-399.755) (-397.851) -- 0:00:08 854000 -- [-395.034] (-394.618) (-395.023) (-398.041) * (-396.779) (-394.947) (-397.095) [-398.660] -- 0:00:08 854500 -- [-395.229] (-396.617) (-398.852) (-402.193) * (-395.126) (-397.215) (-394.575) [-398.327] -- 0:00:08 855000 -- (-394.848) (-395.654) (-397.343) [-398.029] * (-396.876) (-397.518) (-398.231) [-395.047] -- 0:00:08 Average standard deviation of split frequencies: 0.006865 855500 -- [-396.848] (-395.649) (-398.824) (-397.629) * (-395.509) [-396.252] (-400.676) (-397.993) -- 0:00:08 856000 -- (-396.957) (-395.916) [-399.136] (-396.104) * (-395.424) [-396.190] (-402.316) (-403.341) -- 0:00:08 856500 -- (-399.417) [-394.518] (-395.892) (-399.613) * (-395.553) (-395.147) (-398.761) [-396.319] -- 0:00:08 857000 -- (-397.614) (-396.491) (-398.225) [-395.813] * (-396.504) [-395.646] (-395.609) (-395.657) -- 0:00:08 857500 -- (-395.498) (-395.626) (-394.930) [-396.443] * (-396.298) (-397.546) [-399.329] (-397.638) -- 0:00:08 858000 -- (-394.385) [-395.016] (-396.586) (-396.153) * (-394.619) [-396.562] (-399.492) (-402.537) -- 0:00:08 858500 -- (-397.544) (-395.130) [-395.513] (-395.273) * (-396.318) (-399.055) (-395.834) [-394.847] -- 0:00:08 859000 -- [-395.475] (-397.321) (-398.623) (-398.938) * (-395.412) (-398.093) (-396.382) [-397.318] -- 0:00:08 859500 -- [-395.140] (-395.492) (-395.075) (-400.072) * (-397.933) [-399.257] (-398.246) (-398.909) -- 0:00:08 860000 -- (-397.342) (-395.001) [-395.122] (-397.515) * (-395.544) (-400.764) [-395.234] (-395.286) -- 0:00:08 Average standard deviation of split frequencies: 0.006682 860500 -- (-397.698) (-396.534) [-396.289] (-396.924) * (-394.935) (-397.150) [-394.714] (-395.991) -- 0:00:08 861000 -- (-396.317) [-396.803] (-394.692) (-395.387) * (-396.760) (-396.393) (-396.314) [-396.449] -- 0:00:08 861500 -- (-397.057) [-396.929] (-396.583) (-394.257) * (-401.639) [-395.479] (-394.879) (-398.665) -- 0:00:08 862000 -- (-396.131) [-395.552] (-399.310) (-395.610) * (-396.087) (-398.250) [-396.418] (-396.151) -- 0:00:08 862500 -- [-395.195] (-395.462) (-395.180) (-397.661) * [-400.566] (-397.922) (-398.169) (-396.229) -- 0:00:08 863000 -- (-395.022) (-398.521) (-397.980) [-394.794] * [-397.517] (-397.159) (-398.288) (-395.713) -- 0:00:08 863500 -- (-394.951) (-398.897) [-398.998] (-396.468) * [-395.053] (-396.084) (-395.977) (-395.417) -- 0:00:08 864000 -- (-394.912) (-395.078) (-396.066) [-394.693] * (-395.407) [-398.557] (-398.031) (-398.152) -- 0:00:08 864500 -- (-394.843) (-396.145) (-398.644) [-396.250] * [-396.621] (-396.328) (-398.972) (-396.740) -- 0:00:08 865000 -- (-395.800) (-394.525) (-396.872) [-394.115] * (-397.084) (-394.846) [-397.333] (-395.522) -- 0:00:08 Average standard deviation of split frequencies: 0.006351 865500 -- (-396.456) (-394.457) [-397.709] (-394.198) * [-397.058] (-395.258) (-394.405) (-396.475) -- 0:00:08 866000 -- (-394.532) (-398.444) (-401.125) [-395.235] * [-396.648] (-395.616) (-398.196) (-395.633) -- 0:00:08 866500 -- (-395.519) (-396.671) [-397.403] (-395.658) * [-396.136] (-394.606) (-400.194) (-396.936) -- 0:00:08 867000 -- (-402.281) [-397.188] (-394.398) (-399.923) * (-395.850) (-396.951) (-394.891) [-397.037] -- 0:00:08 867500 -- (-397.350) (-394.803) [-395.392] (-398.242) * (-398.148) (-394.725) [-395.397] (-395.363) -- 0:00:08 868000 -- (-395.552) (-398.252) [-395.159] (-395.959) * [-395.010] (-396.332) (-396.659) (-398.026) -- 0:00:08 868500 -- [-394.760] (-395.667) (-395.339) (-398.310) * (-397.025) (-395.065) [-396.665] (-396.503) -- 0:00:08 869000 -- [-396.725] (-394.476) (-395.596) (-396.164) * (-394.347) (-396.369) [-396.700] (-395.763) -- 0:00:07 869500 -- (-395.937) (-395.170) [-396.585] (-396.069) * (-398.479) (-398.899) (-397.717) [-396.802] -- 0:00:07 870000 -- [-396.327] (-396.038) (-396.150) (-394.195) * [-394.526] (-399.293) (-396.752) (-395.156) -- 0:00:07 Average standard deviation of split frequencies: 0.006425 870500 -- (-394.992) [-396.006] (-395.853) (-394.298) * [-396.292] (-397.287) (-395.799) (-396.016) -- 0:00:07 871000 -- (-396.971) [-395.770] (-398.506) (-395.327) * (-396.124) (-396.166) (-397.815) [-396.172] -- 0:00:07 871500 -- [-395.797] (-395.818) (-394.152) (-401.583) * (-398.084) (-394.946) [-397.303] (-397.698) -- 0:00:07 872000 -- (-398.150) [-398.441] (-394.513) (-396.375) * (-399.521) [-395.186] (-395.044) (-398.372) -- 0:00:07 872500 -- [-397.170] (-397.312) (-394.085) (-398.623) * (-398.546) (-396.007) (-395.552) [-399.467] -- 0:00:07 873000 -- (-399.521) (-400.156) [-395.820] (-398.939) * (-396.164) (-404.466) [-395.922] (-400.888) -- 0:00:07 873500 -- (-395.094) (-397.897) (-395.559) [-395.757] * (-395.133) (-399.071) [-397.285] (-401.277) -- 0:00:07 874000 -- (-394.870) (-397.565) [-396.269] (-399.988) * [-394.580] (-398.988) (-395.362) (-403.113) -- 0:00:07 874500 -- (-398.424) (-394.773) (-400.238) [-397.182] * (-395.576) (-397.624) (-396.735) [-394.537] -- 0:00:07 875000 -- (-395.675) [-397.892] (-395.923) (-397.914) * (-396.620) (-399.264) (-396.908) [-395.316] -- 0:00:07 Average standard deviation of split frequencies: 0.006673 875500 -- [-396.116] (-395.727) (-400.142) (-397.691) * [-396.885] (-397.895) (-396.598) (-400.940) -- 0:00:07 876000 -- [-395.775] (-400.834) (-396.296) (-396.449) * (-396.233) (-397.700) (-395.667) [-397.201] -- 0:00:07 876500 -- [-399.996] (-394.835) (-395.477) (-396.578) * (-395.260) [-395.840] (-394.862) (-395.358) -- 0:00:07 877000 -- (-398.255) (-395.751) [-396.212] (-395.308) * (-395.559) [-394.805] (-394.629) (-394.139) -- 0:00:07 877500 -- (-398.350) (-399.968) [-397.518] (-396.298) * (-399.011) (-394.879) (-397.661) [-395.660] -- 0:00:07 878000 -- [-394.950] (-394.977) (-394.854) (-395.419) * (-396.915) [-395.758] (-400.252) (-396.474) -- 0:00:07 878500 -- (-402.507) [-394.310] (-394.419) (-396.736) * (-396.486) (-396.074) [-395.704] (-397.586) -- 0:00:07 879000 -- (-395.654) (-403.884) [-394.203] (-396.093) * [-397.228] (-397.974) (-400.064) (-395.908) -- 0:00:07 879500 -- (-396.218) [-399.289] (-395.196) (-394.764) * (-394.979) (-397.489) (-397.434) [-394.656] -- 0:00:07 880000 -- (-394.191) (-400.982) [-397.562] (-395.814) * (-396.188) [-396.830] (-397.095) (-396.685) -- 0:00:07 Average standard deviation of split frequencies: 0.006816 880500 -- [-394.192] (-395.711) (-396.027) (-397.890) * (-398.517) (-396.853) [-395.288] (-397.260) -- 0:00:07 881000 -- (-396.134) [-399.496] (-394.657) (-396.567) * (-396.156) (-399.262) (-396.655) [-396.168] -- 0:00:07 881500 -- (-394.157) (-396.792) (-396.758) [-397.699] * (-396.373) (-397.992) (-398.401) [-398.970] -- 0:00:07 882000 -- (-394.238) (-394.960) [-394.936] (-396.661) * [-396.823] (-397.559) (-398.330) (-395.415) -- 0:00:07 882500 -- (-394.214) [-395.914] (-399.748) (-399.888) * (-395.429) (-397.607) [-395.359] (-394.907) -- 0:00:07 883000 -- (-401.299) (-394.495) (-395.195) [-394.943] * (-396.580) (-395.263) (-395.133) [-394.888] -- 0:00:07 883500 -- (-402.406) [-397.198] (-395.167) (-396.824) * [-396.849] (-395.609) (-396.991) (-398.471) -- 0:00:07 884000 -- (-400.564) (-398.809) [-395.282] (-399.140) * (-395.816) (-395.453) (-399.150) [-395.288] -- 0:00:07 884500 -- (-398.485) (-398.776) [-395.613] (-395.606) * (-395.948) (-395.573) (-398.419) [-395.473] -- 0:00:07 885000 -- (-397.641) (-400.382) [-399.657] (-398.041) * (-396.501) (-399.219) (-397.928) [-396.023] -- 0:00:07 Average standard deviation of split frequencies: 0.006704 885500 -- (-397.864) (-398.343) [-396.912] (-394.433) * (-400.455) (-397.934) (-397.190) [-397.302] -- 0:00:06 886000 -- (-397.909) [-394.589] (-394.927) (-398.281) * (-400.560) (-398.489) (-394.942) [-397.536] -- 0:00:06 886500 -- [-395.666] (-395.482) (-395.790) (-398.561) * (-398.535) (-396.389) [-395.703] (-395.586) -- 0:00:06 887000 -- (-395.738) (-397.507) (-395.286) [-397.014] * (-396.735) (-398.022) [-395.634] (-394.992) -- 0:00:06 887500 -- (-395.851) [-396.326] (-397.030) (-405.393) * (-399.630) (-405.533) [-395.744] (-397.836) -- 0:00:06 888000 -- (-397.553) [-395.109] (-395.038) (-396.514) * (-399.671) [-400.620] (-395.411) (-394.815) -- 0:00:06 888500 -- [-394.808] (-396.008) (-396.844) (-399.796) * (-401.725) [-399.668] (-395.862) (-398.302) -- 0:00:06 889000 -- (-397.402) (-396.637) [-394.868] (-397.922) * [-394.798] (-397.859) (-402.240) (-397.463) -- 0:00:06 889500 -- (-398.930) (-396.955) (-397.685) [-395.138] * (-396.021) [-400.469] (-399.736) (-394.361) -- 0:00:06 890000 -- (-395.652) (-396.247) (-395.493) [-398.772] * (-394.791) (-398.039) (-395.163) [-396.366] -- 0:00:06 Average standard deviation of split frequencies: 0.006739 890500 -- [-398.302] (-396.720) (-395.683) (-401.086) * (-395.535) (-400.353) (-397.531) [-394.928] -- 0:00:06 891000 -- [-395.722] (-400.551) (-394.882) (-395.137) * (-397.713) (-396.911) [-397.426] (-400.746) -- 0:00:06 891500 -- [-395.782] (-397.097) (-396.854) (-395.416) * [-395.340] (-395.370) (-397.045) (-396.642) -- 0:00:06 892000 -- (-399.621) [-396.077] (-399.485) (-397.342) * [-399.072] (-396.836) (-400.191) (-394.336) -- 0:00:06 892500 -- (-401.664) (-395.400) (-397.528) [-398.537] * (-398.410) (-397.738) (-395.913) [-397.402] -- 0:00:06 893000 -- (-399.950) (-397.045) (-400.034) [-397.908] * (-396.936) (-397.828) [-394.491] (-395.557) -- 0:00:06 893500 -- [-395.978] (-396.951) (-394.755) (-396.972) * (-394.717) (-395.906) (-395.542) [-396.097] -- 0:00:06 894000 -- [-396.068] (-396.799) (-401.821) (-396.069) * (-399.152) (-398.402) (-399.002) [-398.021] -- 0:00:06 894500 -- (-394.375) (-396.982) [-397.964] (-395.237) * (-395.704) (-399.521) [-396.422] (-398.624) -- 0:00:06 895000 -- [-396.252] (-397.953) (-394.390) (-397.098) * (-395.389) (-396.676) [-398.357] (-398.869) -- 0:00:06 Average standard deviation of split frequencies: 0.006840 895500 -- (-398.583) [-396.014] (-395.871) (-397.504) * [-397.523] (-394.611) (-396.084) (-396.551) -- 0:00:06 896000 -- (-395.408) (-396.415) (-400.165) [-400.705] * (-394.789) (-394.459) [-396.745] (-394.853) -- 0:00:06 896500 -- (-396.343) (-395.930) [-396.631] (-400.930) * [-394.557] (-395.683) (-396.238) (-396.804) -- 0:00:06 897000 -- [-396.577] (-398.848) (-396.852) (-397.775) * (-397.569) [-399.982] (-395.558) (-397.780) -- 0:00:06 897500 -- [-396.312] (-395.267) (-394.982) (-396.626) * [-395.407] (-394.571) (-400.056) (-397.394) -- 0:00:06 898000 -- (-395.998) [-394.761] (-395.541) (-398.316) * [-396.417] (-394.514) (-397.011) (-395.372) -- 0:00:06 898500 -- [-395.493] (-395.668) (-397.708) (-394.632) * (-395.163) (-396.346) [-398.212] (-395.701) -- 0:00:06 899000 -- (-395.854) [-394.846] (-397.685) (-396.021) * (-394.613) (-399.480) [-399.029] (-398.765) -- 0:00:06 899500 -- (-394.517) (-396.393) [-396.509] (-396.944) * [-395.565] (-395.748) (-397.623) (-400.251) -- 0:00:06 900000 -- [-395.490] (-398.847) (-396.847) (-394.126) * (-398.237) (-396.647) (-400.280) [-397.687] -- 0:00:06 Average standard deviation of split frequencies: 0.006525 900500 -- [-397.319] (-398.373) (-397.524) (-395.246) * (-397.861) (-394.956) (-398.063) [-394.474] -- 0:00:06 901000 -- [-396.311] (-396.822) (-394.994) (-396.010) * (-398.952) [-395.559] (-395.449) (-395.375) -- 0:00:06 901500 -- (-398.052) [-395.214] (-396.981) (-397.740) * [-395.531] (-398.228) (-397.303) (-397.794) -- 0:00:06 902000 -- (-402.064) [-395.202] (-395.060) (-397.619) * (-396.805) (-396.136) (-396.112) [-398.595] -- 0:00:05 902500 -- (-401.578) (-399.351) (-394.673) [-395.777] * (-396.965) [-396.542] (-395.929) (-398.153) -- 0:00:05 903000 -- (-396.373) [-398.478] (-395.697) (-397.291) * (-395.846) (-398.374) (-396.501) [-396.757] -- 0:00:05 903500 -- (-397.569) [-397.967] (-394.843) (-401.704) * (-395.092) [-396.585] (-396.691) (-396.760) -- 0:00:05 904000 -- [-395.442] (-394.445) (-395.289) (-395.328) * (-396.457) (-395.056) (-394.443) [-396.301] -- 0:00:05 904500 -- (-397.576) (-396.293) [-395.678] (-394.667) * (-397.824) (-397.475) (-397.521) [-395.904] -- 0:00:05 905000 -- (-394.655) (-396.864) (-394.836) [-397.127] * [-397.472] (-397.618) (-397.893) (-397.110) -- 0:00:05 Average standard deviation of split frequencies: 0.006001 905500 -- [-396.895] (-397.543) (-396.336) (-395.962) * (-399.452) (-398.520) (-396.079) [-394.414] -- 0:00:05 906000 -- (-395.109) (-395.662) (-394.571) [-396.688] * (-400.239) [-397.209] (-398.029) (-394.462) -- 0:00:05 906500 -- (-399.206) [-394.856] (-398.512) (-394.669) * (-394.893) (-400.373) (-396.504) [-396.381] -- 0:00:05 907000 -- [-395.103] (-397.130) (-396.694) (-395.142) * (-395.482) (-395.051) [-395.176] (-396.983) -- 0:00:05 907500 -- (-395.949) (-400.408) (-397.440) [-395.816] * (-397.027) (-395.320) [-395.045] (-404.663) -- 0:00:05 908000 -- (-396.297) (-396.720) [-395.352] (-395.831) * (-400.001) (-395.705) (-398.824) [-397.758] -- 0:00:05 908500 -- (-395.666) (-396.674) [-396.514] (-400.444) * (-403.150) [-395.426] (-396.811) (-399.643) -- 0:00:05 909000 -- [-394.901] (-395.666) (-395.876) (-398.534) * (-398.368) (-398.322) (-398.794) [-395.838] -- 0:00:05 909500 -- (-398.612) (-394.871) [-395.401] (-396.235) * (-397.177) (-397.219) [-396.066] (-397.543) -- 0:00:05 910000 -- (-395.418) (-396.127) (-397.614) [-396.693] * (-398.145) (-397.465) (-396.797) [-396.515] -- 0:00:05 Average standard deviation of split frequencies: 0.006005 910500 -- [-394.363] (-394.704) (-397.810) (-394.663) * (-397.562) (-397.902) [-397.275] (-396.467) -- 0:00:05 911000 -- (-396.069) (-397.357) [-395.110] (-402.248) * (-396.537) (-397.243) (-398.382) [-395.950] -- 0:00:05 911500 -- (-402.432) (-394.532) [-395.515] (-400.570) * (-396.372) [-397.094] (-395.106) (-396.831) -- 0:00:05 912000 -- (-397.465) [-395.810] (-394.713) (-396.244) * (-396.069) (-401.190) [-400.104] (-396.094) -- 0:00:05 912500 -- (-397.243) (-395.679) [-395.161] (-395.770) * (-394.220) (-395.978) (-396.563) [-394.900] -- 0:00:05 913000 -- (-399.765) (-397.045) [-396.203] (-398.031) * (-395.761) (-394.298) (-396.911) [-395.211] -- 0:00:05 913500 -- (-400.156) (-399.168) (-396.514) [-396.537] * (-398.235) [-394.939] (-396.924) (-395.168) -- 0:00:05 914000 -- (-400.643) [-396.988] (-396.945) (-395.640) * (-395.108) (-400.461) [-395.216] (-396.082) -- 0:00:05 914500 -- (-402.624) (-394.944) (-398.623) [-396.941] * (-395.651) (-397.117) (-395.800) [-396.722] -- 0:00:05 915000 -- [-397.678] (-396.259) (-396.147) (-399.349) * [-395.955] (-397.679) (-395.088) (-395.754) -- 0:00:05 Average standard deviation of split frequencies: 0.005833 915500 -- (-395.164) (-394.389) (-395.857) [-396.516] * [-395.459] (-397.463) (-399.629) (-395.232) -- 0:00:05 916000 -- (-396.166) [-395.218] (-395.684) (-398.608) * [-394.720] (-398.520) (-397.496) (-395.617) -- 0:00:05 916500 -- (-395.570) [-396.916] (-395.226) (-395.461) * [-395.737] (-395.531) (-397.428) (-395.288) -- 0:00:05 917000 -- [-395.434] (-395.565) (-395.711) (-395.479) * (-395.506) [-397.011] (-398.737) (-397.597) -- 0:00:05 917500 -- (-395.398) [-397.196] (-396.036) (-398.490) * (-399.216) (-399.237) [-395.824] (-404.869) -- 0:00:05 918000 -- (-394.212) (-398.327) (-394.906) [-396.744] * [-399.847] (-396.639) (-396.623) (-403.616) -- 0:00:05 918500 -- (-394.212) (-399.585) (-396.884) [-396.545] * (-397.731) [-395.985] (-397.000) (-402.301) -- 0:00:04 919000 -- (-394.798) (-397.390) [-395.078] (-395.772) * (-396.717) (-396.231) (-394.342) [-395.198] -- 0:00:04 919500 -- (-400.119) [-400.180] (-394.958) (-395.168) * (-396.609) [-397.814] (-394.740) (-396.375) -- 0:00:04 920000 -- (-396.638) (-396.462) [-395.065] (-397.134) * (-398.015) (-396.662) [-395.323] (-397.978) -- 0:00:04 Average standard deviation of split frequencies: 0.006247 920500 -- (-399.394) (-395.119) (-394.940) [-398.454] * (-395.219) (-396.342) (-396.075) [-395.762] -- 0:00:04 921000 -- [-399.799] (-396.767) (-396.129) (-399.425) * (-396.685) (-396.583) (-397.801) [-396.491] -- 0:00:04 921500 -- [-395.656] (-399.844) (-396.166) (-394.540) * (-399.748) [-395.475] (-399.701) (-401.160) -- 0:00:04 922000 -- [-394.493] (-397.380) (-396.312) (-396.357) * (-395.843) (-394.960) [-396.141] (-399.200) -- 0:00:04 922500 -- [-397.800] (-401.192) (-394.838) (-397.174) * (-395.793) (-397.150) [-396.947] (-400.265) -- 0:00:04 923000 -- [-394.867] (-399.457) (-399.224) (-400.758) * (-397.068) (-394.763) [-395.543] (-399.620) -- 0:00:04 923500 -- [-398.122] (-399.172) (-399.731) (-397.584) * [-397.613] (-399.262) (-397.008) (-396.737) -- 0:00:04 924000 -- (-398.916) (-398.249) (-396.210) [-395.306] * (-397.349) (-397.244) [-395.225] (-399.076) -- 0:00:04 924500 -- (-395.785) (-394.440) (-394.986) [-398.435] * (-396.840) (-395.104) [-394.528] (-399.109) -- 0:00:04 925000 -- (-397.252) [-397.135] (-394.315) (-396.344) * [-395.128] (-394.502) (-395.761) (-400.032) -- 0:00:04 Average standard deviation of split frequencies: 0.006313 925500 -- (-396.002) [-396.920] (-395.048) (-394.585) * (-396.647) [-396.620] (-398.135) (-399.356) -- 0:00:04 926000 -- (-400.623) [-398.398] (-395.001) (-397.022) * (-395.894) (-396.029) [-396.591] (-397.782) -- 0:00:04 926500 -- (-395.044) (-394.588) (-395.118) [-394.271] * (-395.070) (-397.077) (-394.546) [-395.160] -- 0:00:04 927000 -- (-394.960) (-394.263) (-395.868) [-394.738] * [-395.121] (-398.889) (-396.409) (-395.150) -- 0:00:04 927500 -- [-395.758] (-396.352) (-395.551) (-400.246) * [-395.202] (-395.204) (-398.370) (-394.270) -- 0:00:04 928000 -- (-395.701) (-394.967) [-394.233] (-398.020) * (-396.764) (-398.413) (-400.031) [-395.942] -- 0:00:04 928500 -- (-394.540) [-396.646] (-394.450) (-397.910) * (-396.137) (-394.646) (-397.902) [-396.657] -- 0:00:04 929000 -- (-396.717) (-397.694) [-395.822] (-396.922) * [-396.571] (-396.464) (-398.681) (-395.779) -- 0:00:04 929500 -- (-396.111) (-394.948) [-396.754] (-395.714) * (-397.087) [-395.745] (-396.740) (-395.713) -- 0:00:04 930000 -- (-395.145) (-396.567) [-395.619] (-399.175) * (-396.323) [-395.885] (-399.976) (-398.142) -- 0:00:04 Average standard deviation of split frequencies: 0.005876 930500 -- (-398.209) (-395.744) [-396.292] (-397.105) * [-397.034] (-395.661) (-396.134) (-398.587) -- 0:00:04 931000 -- (-394.539) (-396.433) (-396.554) [-396.658] * (-395.587) (-396.472) (-397.959) [-396.548] -- 0:00:04 931500 -- (-395.549) [-395.743] (-398.013) (-395.231) * (-399.333) (-395.029) [-396.887] (-396.446) -- 0:00:04 932000 -- (-395.600) (-395.547) [-395.238] (-400.348) * (-397.503) (-394.639) [-395.579] (-397.559) -- 0:00:04 932500 -- (-394.475) (-397.858) [-394.551] (-399.371) * [-396.299] (-396.706) (-399.268) (-398.254) -- 0:00:04 933000 -- (-397.144) (-396.722) (-394.818) [-397.664] * (-395.323) [-395.991] (-399.435) (-395.929) -- 0:00:04 933500 -- (-396.894) (-399.702) (-395.058) [-397.193] * (-395.207) (-399.905) [-402.992] (-397.527) -- 0:00:04 934000 -- (-395.571) (-400.330) (-397.106) [-396.903] * (-395.982) [-395.742] (-398.042) (-395.990) -- 0:00:04 934500 -- (-397.146) (-401.458) (-397.748) [-394.795] * (-395.790) [-397.036] (-396.408) (-397.642) -- 0:00:03 935000 -- (-396.631) (-395.650) [-398.410] (-394.156) * (-404.893) (-395.342) (-395.571) [-397.798] -- 0:00:03 Average standard deviation of split frequencies: 0.005775 935500 -- (-397.409) (-396.782) (-398.178) [-394.332] * (-402.195) (-400.718) (-395.499) [-396.014] -- 0:00:03 936000 -- (-395.410) (-398.180) [-396.534] (-397.233) * (-397.574) (-396.434) (-395.772) [-395.297] -- 0:00:03 936500 -- (-394.108) (-394.980) [-395.982] (-400.062) * (-396.943) (-396.068) [-395.305] (-399.357) -- 0:00:03 937000 -- (-394.146) (-395.461) [-395.470] (-395.990) * (-394.604) (-398.109) [-394.808] (-398.398) -- 0:00:03 937500 -- [-395.413] (-399.229) (-394.736) (-396.913) * (-396.944) (-395.135) [-395.674] (-398.376) -- 0:00:03 938000 -- (-396.874) (-394.604) (-394.872) [-397.893] * (-395.778) (-395.068) [-396.341] (-397.340) -- 0:00:03 938500 -- [-394.752] (-398.789) (-395.414) (-395.327) * [-396.510] (-395.008) (-395.514) (-398.210) -- 0:00:03 939000 -- (-400.364) [-396.493] (-397.687) (-397.855) * (-395.544) [-395.186] (-396.384) (-396.712) -- 0:00:03 939500 -- (-397.915) (-398.531) (-394.363) [-394.703] * [-401.088] (-395.314) (-396.025) (-396.197) -- 0:00:03 940000 -- [-394.721] (-395.256) (-397.354) (-397.275) * [-395.899] (-395.301) (-394.999) (-396.121) -- 0:00:03 Average standard deviation of split frequencies: 0.005446 940500 -- (-394.788) (-395.190) [-402.876] (-397.938) * (-397.703) (-394.703) [-394.963] (-395.622) -- 0:00:03 941000 -- (-398.092) [-395.443] (-398.430) (-393.991) * [-395.142] (-396.216) (-397.413) (-400.450) -- 0:00:03 941500 -- (-397.252) (-397.007) (-398.655) [-393.982] * (-397.831) [-397.037] (-397.218) (-394.888) -- 0:00:03 942000 -- (-394.660) (-394.739) [-395.157] (-394.550) * (-400.815) [-396.130] (-396.158) (-395.151) -- 0:00:03 942500 -- (-395.309) (-394.786) (-394.819) [-396.884] * [-398.016] (-394.477) (-398.392) (-396.730) -- 0:00:03 943000 -- (-397.800) (-395.910) [-398.857] (-398.078) * (-399.574) (-397.261) (-395.378) [-398.510] -- 0:00:03 943500 -- (-399.385) (-395.325) (-398.513) [-394.603] * [-394.910] (-396.623) (-395.639) (-396.248) -- 0:00:03 944000 -- (-399.246) [-398.611] (-395.032) (-395.764) * (-396.012) (-396.073) (-399.510) [-395.446] -- 0:00:03 944500 -- [-396.071] (-400.626) (-395.842) (-395.301) * [-397.116] (-394.811) (-397.540) (-397.011) -- 0:00:03 945000 -- (-396.579) [-396.096] (-398.273) (-396.048) * [-395.740] (-399.920) (-396.774) (-398.216) -- 0:00:03 Average standard deviation of split frequencies: 0.005747 945500 -- (-395.846) (-396.515) (-396.212) [-397.097] * [-395.645] (-398.365) (-397.219) (-395.873) -- 0:00:03 946000 -- (-397.614) [-395.552] (-395.747) (-397.940) * (-397.055) (-396.473) (-394.871) [-398.649] -- 0:00:03 946500 -- (-395.093) [-397.833] (-400.450) (-396.050) * (-397.441) (-399.508) [-394.940] (-395.518) -- 0:00:03 947000 -- (-395.371) (-399.316) [-396.122] (-396.822) * (-396.149) (-396.667) (-395.154) [-395.526] -- 0:00:03 947500 -- [-398.192] (-398.198) (-395.028) (-394.461) * [-395.717] (-396.161) (-397.710) (-398.720) -- 0:00:03 948000 -- (-397.403) (-398.609) (-394.785) [-400.601] * (-400.385) (-399.723) [-395.837] (-400.633) -- 0:00:03 948500 -- (-399.555) (-396.711) (-395.151) [-396.452] * (-396.160) [-396.569] (-395.701) (-398.398) -- 0:00:03 949000 -- (-396.719) (-395.570) (-396.547) [-394.157] * (-394.935) (-397.477) (-397.234) [-396.519] -- 0:00:03 949500 -- (-395.134) (-395.498) (-395.647) [-393.996] * (-396.632) (-397.451) (-397.782) [-396.014] -- 0:00:03 950000 -- [-396.394] (-395.072) (-396.020) (-395.815) * (-396.641) (-403.500) (-395.875) [-398.279] -- 0:00:03 Average standard deviation of split frequencies: 0.005950 950500 -- (-396.576) (-400.102) [-395.300] (-395.692) * (-397.863) [-395.296] (-397.709) (-398.887) -- 0:00:03 951000 -- (-395.194) (-394.589) [-394.472] (-395.617) * (-398.704) [-395.231] (-396.997) (-395.264) -- 0:00:02 951500 -- [-395.170] (-395.928) (-399.498) (-396.739) * (-396.156) (-395.780) [-398.296] (-394.696) -- 0:00:02 952000 -- (-395.248) [-398.112] (-398.227) (-395.577) * [-396.723] (-395.924) (-399.413) (-397.668) -- 0:00:02 952500 -- (-398.480) [-395.538] (-396.405) (-394.980) * [-395.098] (-395.807) (-396.433) (-399.259) -- 0:00:02 953000 -- (-398.166) [-395.206] (-397.182) (-396.010) * (-396.468) (-396.867) [-396.684] (-399.460) -- 0:00:02 953500 -- (-397.839) (-395.398) [-398.313] (-395.369) * (-398.418) (-396.608) [-398.977] (-398.525) -- 0:00:02 954000 -- [-400.127] (-396.916) (-396.447) (-396.599) * (-396.130) (-400.053) [-395.417] (-395.854) -- 0:00:02 954500 -- (-397.424) (-396.501) [-396.745] (-395.683) * (-396.168) (-398.941) (-394.958) [-397.088] -- 0:00:02 955000 -- [-394.505] (-395.036) (-395.033) (-399.603) * (-395.546) (-398.706) [-398.426] (-396.809) -- 0:00:02 Average standard deviation of split frequencies: 0.005753 955500 -- (-395.684) (-395.384) [-395.569] (-396.317) * (-395.529) (-397.318) [-396.411] (-396.604) -- 0:00:02 956000 -- (-394.957) [-397.313] (-398.340) (-396.769) * (-397.247) (-396.745) [-395.518] (-396.489) -- 0:00:02 956500 -- (-395.076) (-396.321) (-402.155) [-394.528] * (-395.789) (-401.627) (-397.111) [-395.830] -- 0:00:02 957000 -- (-400.663) (-395.752) [-397.637] (-399.886) * (-395.594) (-397.065) (-396.431) [-395.769] -- 0:00:02 957500 -- (-397.415) (-397.399) [-398.412] (-397.509) * (-397.689) [-396.346] (-403.674) (-397.826) -- 0:00:02 958000 -- [-397.280] (-398.296) (-399.315) (-394.785) * [-396.355] (-395.559) (-400.417) (-395.892) -- 0:00:02 958500 -- (-397.459) (-399.081) (-396.333) [-394.595] * (-395.904) (-394.451) [-396.098] (-396.454) -- 0:00:02 959000 -- (-396.524) (-397.568) (-396.171) [-395.295] * (-398.579) (-394.608) [-394.385] (-395.162) -- 0:00:02 959500 -- (-395.151) [-395.096] (-400.849) (-397.258) * (-396.963) (-395.682) (-397.999) [-395.121] -- 0:00:02 960000 -- (-395.041) (-394.430) (-396.098) [-394.535] * (-394.162) [-395.347] (-399.482) (-396.187) -- 0:00:02 Average standard deviation of split frequencies: 0.006019 960500 -- (-397.808) [-396.928] (-400.440) (-396.927) * (-396.692) [-396.520] (-397.951) (-395.560) -- 0:00:02 961000 -- [-395.579] (-394.335) (-397.564) (-398.814) * (-397.003) [-394.501] (-398.131) (-394.368) -- 0:00:02 961500 -- (-397.538) [-397.574] (-395.845) (-397.582) * [-395.902] (-394.660) (-398.699) (-403.910) -- 0:00:02 962000 -- (-396.034) (-395.992) [-397.656] (-394.536) * [-397.149] (-395.054) (-395.504) (-394.309) -- 0:00:02 962500 -- (-395.725) (-398.973) [-395.936] (-395.511) * (-396.995) (-394.635) (-396.752) [-394.828] -- 0:00:02 963000 -- (-398.755) (-394.827) (-396.933) [-397.993] * (-395.880) [-394.426] (-395.768) (-395.186) -- 0:00:02 963500 -- (-399.685) (-397.492) [-396.568] (-394.902) * (-394.232) (-394.294) (-399.310) [-396.215] -- 0:00:02 964000 -- [-397.296] (-402.869) (-395.007) (-397.886) * [-395.254] (-395.629) (-395.738) (-397.379) -- 0:00:02 964500 -- (-396.177) (-399.132) (-396.192) [-396.125] * [-398.631] (-396.931) (-397.388) (-398.146) -- 0:00:02 965000 -- (-395.958) (-397.157) [-396.903] (-397.700) * (-396.783) (-395.486) (-396.007) [-397.227] -- 0:00:02 Average standard deviation of split frequencies: 0.006181 965500 -- (-400.887) [-397.531] (-397.588) (-395.116) * [-394.112] (-395.472) (-401.989) (-396.668) -- 0:00:02 966000 -- (-398.765) [-396.049] (-394.904) (-394.106) * [-396.903] (-396.391) (-399.767) (-397.374) -- 0:00:02 966500 -- (-398.096) [-401.810] (-399.631) (-394.157) * (-396.350) [-396.493] (-397.944) (-397.641) -- 0:00:02 967000 -- (-396.164) [-396.956] (-397.438) (-395.503) * (-396.570) [-394.785] (-399.315) (-395.816) -- 0:00:02 967500 -- (-395.680) (-398.183) (-400.698) [-394.683] * (-395.905) [-395.870] (-402.046) (-401.348) -- 0:00:01 968000 -- (-397.765) (-398.199) (-396.846) [-394.842] * (-397.846) (-396.668) (-401.280) [-396.013] -- 0:00:01 968500 -- (-396.077) [-397.625] (-395.053) (-398.913) * (-396.506) (-396.598) (-395.284) [-394.667] -- 0:00:01 969000 -- [-395.494] (-398.191) (-396.486) (-394.740) * (-397.142) [-396.693] (-398.290) (-395.106) -- 0:00:01 969500 -- (-399.201) [-397.424] (-402.120) (-395.156) * (-397.519) (-399.085) [-397.190] (-395.200) -- 0:00:01 970000 -- (-397.369) (-399.674) [-397.676] (-395.389) * (-395.331) [-395.197] (-397.225) (-395.140) -- 0:00:01 Average standard deviation of split frequencies: 0.006540 970500 -- (-397.783) (-399.778) (-395.416) [-395.598] * (-397.672) (-394.741) (-396.727) [-396.590] -- 0:00:01 971000 -- [-396.679] (-394.852) (-396.249) (-396.602) * (-400.484) (-396.260) [-398.298] (-395.324) -- 0:00:01 971500 -- [-398.371] (-396.182) (-394.242) (-395.152) * (-397.222) [-394.938] (-396.515) (-394.776) -- 0:00:01 972000 -- (-398.657) [-396.115] (-395.220) (-396.057) * (-396.787) [-395.038] (-395.871) (-398.948) -- 0:00:01 972500 -- (-396.229) (-395.052) (-395.133) [-397.613] * (-399.826) [-395.615] (-394.891) (-399.158) -- 0:00:01 973000 -- (-395.155) [-396.364] (-394.471) (-396.245) * (-399.234) [-395.783] (-396.934) (-394.056) -- 0:00:01 973500 -- (-397.418) (-396.411) (-394.920) [-395.895] * [-394.155] (-395.085) (-396.854) (-395.188) -- 0:00:01 974000 -- (-396.522) (-395.070) [-395.260] (-396.968) * [-397.453] (-397.490) (-395.802) (-396.238) -- 0:00:01 974500 -- (-395.488) (-397.211) [-394.798] (-401.073) * [-394.752] (-395.319) (-394.864) (-396.002) -- 0:00:01 975000 -- (-397.345) (-394.845) (-394.996) [-397.089] * (-395.890) [-395.490] (-396.066) (-394.918) -- 0:00:01 Average standard deviation of split frequencies: 0.006408 975500 -- (-396.134) (-394.903) [-399.518] (-396.570) * [-394.610] (-398.951) (-395.570) (-395.647) -- 0:00:01 976000 -- (-397.586) (-395.347) [-394.541] (-398.072) * [-395.829] (-394.171) (-398.051) (-399.506) -- 0:00:01 976500 -- (-396.505) (-402.991) [-396.327] (-398.316) * (-394.829) (-395.083) [-397.143] (-398.445) -- 0:00:01 977000 -- (-394.852) (-396.285) [-396.340] (-395.286) * (-395.042) (-394.691) [-395.949] (-397.218) -- 0:00:01 977500 -- (-395.805) (-396.296) (-405.883) [-394.171] * (-397.303) [-394.710] (-395.393) (-396.576) -- 0:00:01 978000 -- (-396.871) [-394.486] (-398.038) (-395.970) * (-397.284) (-396.555) [-395.037] (-395.270) -- 0:00:01 978500 -- (-400.347) [-395.193] (-395.601) (-397.019) * (-397.458) (-397.457) [-396.191] (-395.992) -- 0:00:01 979000 -- (-396.285) [-395.371] (-396.729) (-398.268) * (-396.606) [-398.435] (-395.159) (-396.742) -- 0:00:01 979500 -- (-394.661) (-396.583) [-394.342] (-397.893) * (-396.549) [-395.671] (-396.682) (-397.401) -- 0:00:01 980000 -- (-396.495) (-401.053) [-395.883] (-400.216) * [-396.983] (-396.584) (-395.167) (-396.008) -- 0:00:01 Average standard deviation of split frequencies: 0.006570 980500 -- [-395.882] (-401.044) (-395.106) (-394.524) * (-398.791) (-395.293) [-396.908] (-396.947) -- 0:00:01 981000 -- (-400.263) (-402.650) (-396.129) [-394.705] * (-399.761) [-397.128] (-398.572) (-397.818) -- 0:00:01 981500 -- (-397.328) (-395.903) [-395.196] (-396.248) * (-397.255) (-395.255) [-398.204] (-404.726) -- 0:00:01 982000 -- (-395.962) (-404.363) (-394.781) [-395.440] * (-396.237) [-396.201] (-400.220) (-403.969) -- 0:00:01 982500 -- (-396.938) (-398.394) (-394.688) [-396.042] * (-395.900) (-395.708) [-396.376] (-394.816) -- 0:00:01 983000 -- [-396.561] (-398.151) (-398.398) (-403.269) * [-396.048] (-396.517) (-395.946) (-399.045) -- 0:00:01 983500 -- [-398.092] (-394.428) (-397.528) (-397.235) * (-394.771) [-398.139] (-396.037) (-402.192) -- 0:00:01 984000 -- (-398.342) (-394.929) (-395.020) [-400.124] * (-398.479) (-402.062) (-395.816) [-394.412] -- 0:00:00 984500 -- (-398.173) (-395.802) [-396.549] (-395.176) * [-397.835] (-398.791) (-397.362) (-397.078) -- 0:00:00 985000 -- (-398.110) (-400.648) [-395.109] (-399.191) * (-399.028) (-397.013) (-395.709) [-396.667] -- 0:00:00 Average standard deviation of split frequencies: 0.006311 985500 -- (-396.728) (-402.068) [-397.042] (-394.382) * (-397.796) [-397.870] (-398.113) (-395.123) -- 0:00:00 986000 -- [-395.963] (-397.087) (-400.109) (-394.795) * [-395.642] (-397.059) (-398.805) (-395.487) -- 0:00:00 986500 -- (-394.782) (-396.883) (-396.194) [-398.439] * (-397.434) [-397.719] (-398.719) (-398.674) -- 0:00:00 987000 -- (-398.027) (-397.875) (-395.056) [-395.496] * [-395.895] (-395.712) (-398.512) (-401.416) -- 0:00:00 987500 -- (-395.255) [-396.799] (-397.569) (-394.042) * (-394.988) (-396.328) [-395.614] (-395.336) -- 0:00:00 988000 -- (-398.130) [-396.507] (-395.612) (-394.055) * (-395.128) (-398.693) (-399.047) [-394.537] -- 0:00:00 988500 -- (-396.148) (-399.328) [-395.093] (-396.199) * (-396.829) [-397.885] (-395.437) (-395.326) -- 0:00:00 989000 -- (-395.413) (-398.447) (-399.745) [-396.658] * (-398.019) (-399.600) (-398.977) [-395.821] -- 0:00:00 989500 -- (-399.468) [-395.462] (-396.871) (-395.387) * (-396.401) (-399.529) (-400.174) [-404.059] -- 0:00:00 990000 -- (-394.865) [-395.870] (-395.705) (-397.354) * (-397.499) (-398.067) [-396.330] (-396.088) -- 0:00:00 Average standard deviation of split frequencies: 0.006630 990500 -- (-398.928) (-395.066) (-407.146) [-396.734] * (-397.823) [-397.181] (-397.698) (-395.992) -- 0:00:00 991000 -- (-396.417) (-398.975) [-398.022] (-399.560) * [-395.829] (-395.832) (-395.020) (-395.339) -- 0:00:00 991500 -- [-396.955] (-399.066) (-396.984) (-394.634) * (-397.016) [-395.402] (-394.595) (-396.503) -- 0:00:00 992000 -- [-395.762] (-395.536) (-396.534) (-395.690) * (-399.750) (-396.366) [-396.136] (-396.042) -- 0:00:00 992500 -- (-395.276) [-397.152] (-398.970) (-395.643) * (-395.695) [-394.514] (-397.981) (-395.532) -- 0:00:00 993000 -- (-397.583) (-397.812) (-396.936) [-397.091] * (-397.535) (-395.626) [-394.467] (-394.548) -- 0:00:00 993500 -- (-397.862) (-397.593) (-397.634) [-394.716] * (-396.957) (-396.321) (-397.248) [-394.695] -- 0:00:00 994000 -- (-395.739) (-396.067) [-395.705] (-397.408) * (-395.402) (-396.018) (-398.878) [-394.349] -- 0:00:00 994500 -- [-395.566] (-394.737) (-400.804) (-400.754) * (-397.684) (-395.366) (-398.368) [-394.570] -- 0:00:00 995000 -- (-398.417) [-396.276] (-397.847) (-395.863) * (-398.196) [-394.128] (-395.478) (-397.859) -- 0:00:00 Average standard deviation of split frequencies: 0.006721 995500 -- [-396.972] (-397.024) (-396.239) (-395.887) * (-398.911) (-395.819) (-395.524) [-398.396] -- 0:00:00 996000 -- (-395.691) [-396.712] (-395.278) (-395.786) * (-394.106) (-397.587) [-395.375] (-398.043) -- 0:00:00 996500 -- (-394.949) (-401.268) (-397.027) [-394.037] * (-394.605) [-396.482] (-396.588) (-399.667) -- 0:00:00 997000 -- [-395.075] (-398.353) (-399.514) (-395.147) * [-394.742] (-397.041) (-397.149) (-398.877) -- 0:00:00 997500 -- [-399.079] (-397.704) (-395.987) (-395.513) * (-394.442) (-397.383) [-396.994] (-398.487) -- 0:00:00 998000 -- (-398.058) (-395.725) (-396.952) [-394.831] * (-394.557) [-394.966] (-397.951) (-395.082) -- 0:00:00 998500 -- [-396.106] (-394.695) (-396.982) (-396.807) * (-396.479) (-398.678) [-400.194] (-397.690) -- 0:00:00 999000 -- (-395.548) (-395.456) (-402.225) [-400.469] * (-395.614) (-401.446) (-400.489) [-397.381] -- 0:00:00 999500 -- (-395.745) (-395.052) (-398.178) [-403.837] * [-394.853] (-394.893) (-398.218) (-397.021) -- 0:00:00 1000000 -- [-400.164] (-397.835) (-395.916) (-397.315) * (-397.559) (-397.576) [-397.586] (-397.202) -- 0:00:00 Average standard deviation of split frequencies: 0.006721 Analysis completed in 1 mins 1 seconds Analysis used 58.97 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -393.89 Likelihood of best state for "cold" chain of run 2 was -393.89 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.8 % ( 69 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 40.1 % ( 33 %) Dirichlet(Pi{all}) 38.6 % ( 31 %) Slider(Pi{all}) 79.0 % ( 53 %) Multiplier(Alpha{1,2}) 77.9 % ( 45 %) Multiplier(Alpha{3}) 26.4 % ( 30 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 68 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 27 %) Multiplier(V{all}) 97.5 % ( 99 %) Nodeslider(V{all}) 30.5 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.6 % ( 63 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 40.2 % ( 26 %) Dirichlet(Pi{all}) 39.4 % ( 16 %) Slider(Pi{all}) 79.0 % ( 57 %) Multiplier(Alpha{1,2}) 78.3 % ( 54 %) Multiplier(Alpha{3}) 26.7 % ( 16 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 95 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 32 %) Multiplier(V{all}) 97.4 % ( 94 %) Nodeslider(V{all}) 30.6 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166991 0.82 0.67 3 | 165880 166561 0.84 4 | 166418 166978 167172 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166505 0.82 0.67 3 | 167341 166532 0.84 4 | 166482 166213 166927 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -395.51 | 1 1 | | 1 | | 2 | | 2 2 2 1 2 2 1 2 12 2 | | 2 1 2 2 2 * 1 2 1 | | *2 1 1 11 2 1 12| | 2 2 1 121112 22* | | 12 *21 * 2 2 12 22 21 22 21 22 12 2 | |21 1 1221 2 1 21 1 2 1 21 1 | | 1 2 2 1 1 1 1 1 1 | | 2 2 2 1 1 1 1| |1 * 11 2 1 | | 2 | | 1 2 | | 1 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -397.36 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -395.63 -398.87 2 -395.64 -398.42 -------------------------------------- TOTAL -395.63 -398.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896569 0.088716 0.364753 1.492079 0.865948 1429.62 1465.31 1.000 r(A<->C){all} 0.164364 0.020207 0.000109 0.460436 0.123398 165.54 298.28 1.000 r(A<->G){all} 0.175485 0.021959 0.000111 0.476632 0.136343 238.54 245.64 1.000 r(A<->T){all} 0.153878 0.017526 0.000063 0.419009 0.118289 116.15 176.11 1.002 r(C<->G){all} 0.171717 0.019716 0.000127 0.458213 0.139008 321.67 333.99 1.000 r(C<->T){all} 0.172194 0.019816 0.000011 0.444855 0.138384 240.99 278.02 1.001 r(G<->T){all} 0.162362 0.019194 0.000038 0.432821 0.126298 259.38 289.25 1.000 pi(A){all} 0.178055 0.000498 0.134130 0.221433 0.177557 1187.44 1272.16 1.000 pi(C){all} 0.294746 0.000703 0.246508 0.351172 0.294059 1098.49 1148.49 1.000 pi(G){all} 0.287008 0.000692 0.234797 0.337725 0.286737 1178.77 1296.37 1.000 pi(T){all} 0.240190 0.000597 0.193106 0.287051 0.240206 1244.86 1305.99 1.000 alpha{1,2} 0.405508 0.212621 0.000147 1.325281 0.243990 1394.28 1407.19 1.000 alpha{3} 0.431717 0.214520 0.000166 1.380933 0.276220 1189.62 1345.31 1.000 pinvar{all} 0.993954 0.000055 0.980013 0.999995 0.996341 847.89 1125.92 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*.*.. 8 -- .*..*. 9 -- ...*.* 10 -- ..**.. 11 -- ..*..* 12 -- .**... 13 -- ....** 14 -- .**.** 15 -- ..**** 16 -- ...**. 17 -- .*.*** 18 -- .****. 19 -- .*...* 20 -- .***.* 21 -- ..*.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 453 0.150899 0.007066 0.145903 0.155896 2 8 451 0.150233 0.000471 0.149900 0.150566 2 9 446 0.148568 0.000942 0.147901 0.149234 2 10 441 0.146902 0.007066 0.141905 0.151899 2 11 436 0.145237 0.000000 0.145237 0.145237 2 12 433 0.144237 0.012719 0.135243 0.153231 2 13 431 0.143571 0.006124 0.139241 0.147901 2 14 431 0.143571 0.011777 0.135243 0.151899 2 15 430 0.143238 0.010364 0.135909 0.150566 2 16 426 0.141905 0.006595 0.137242 0.146569 2 17 426 0.141905 0.009422 0.135243 0.148568 2 18 411 0.136909 0.000471 0.136576 0.137242 2 19 411 0.136909 0.018373 0.123917 0.149900 2 20 400 0.133245 0.007537 0.127915 0.138574 2 21 396 0.131912 0.001884 0.130580 0.133245 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.104226 0.011166 0.000006 0.316387 0.071871 1.000 2 length{all}[2] 0.097388 0.010210 0.000000 0.300315 0.065091 1.000 2 length{all}[3] 0.100681 0.010422 0.000034 0.306829 0.068865 1.000 2 length{all}[4] 0.098305 0.009272 0.000002 0.293085 0.067973 1.000 2 length{all}[5] 0.102159 0.010651 0.000011 0.302533 0.071970 1.000 2 length{all}[6] 0.098303 0.010223 0.000014 0.299693 0.065949 1.000 2 length{all}[7] 0.094328 0.007848 0.000052 0.273514 0.070492 0.998 2 length{all}[8] 0.101202 0.010312 0.000087 0.325974 0.067106 0.998 2 length{all}[9] 0.105202 0.010918 0.000726 0.312565 0.075570 0.998 2 length{all}[10] 0.096537 0.010794 0.000003 0.302478 0.065006 0.998 2 length{all}[11] 0.098234 0.008125 0.000055 0.268673 0.071775 0.999 2 length{all}[12] 0.093569 0.008920 0.000550 0.274962 0.062951 0.998 2 length{all}[13] 0.095757 0.009263 0.001447 0.284984 0.070438 1.003 2 length{all}[14] 0.099822 0.010038 0.000047 0.280595 0.071661 1.007 2 length{all}[15] 0.105456 0.010834 0.000162 0.301254 0.077334 0.999 2 length{all}[16] 0.089720 0.008697 0.000175 0.290599 0.062666 1.007 2 length{all}[17] 0.102336 0.008950 0.000161 0.297197 0.075777 0.998 2 length{all}[18] 0.098520 0.010617 0.000052 0.288625 0.063106 0.999 2 length{all}[19] 0.093252 0.009895 0.000040 0.295222 0.060061 1.000 2 length{all}[20] 0.095682 0.010078 0.000178 0.297239 0.063716 0.998 2 length{all}[21] 0.098006 0.011493 0.000309 0.325716 0.065170 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006721 Maximum standard deviation of split frequencies = 0.018373 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.007 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |----------------------------------------------------------------- C2 (2) | |--------------------------------------------------------------------- C3 (3) + |-------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 288 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 43 patterns at 96 / 96 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 43 patterns at 96 / 96 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 41968 bytes for conP 3784 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.059531 0.048301 0.107182 0.040032 0.102978 0.085752 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -421.002460 Iterating by ming2 Initial: fx= 421.002460 x= 0.05953 0.04830 0.10718 0.04003 0.10298 0.08575 0.30000 1.30000 1 h-m-p 0.0000 0.0004 229.9862 +++ 398.510869 m 0.0004 14 | 1/8 2 h-m-p 0.0018 0.0089 34.9212 ------------.. | 1/8 3 h-m-p 0.0000 0.0001 211.2272 ++ 394.597172 m 0.0001 46 | 2/8 4 h-m-p 0.0007 0.0128 25.3636 -----------.. | 2/8 5 h-m-p 0.0000 0.0001 188.9308 ++ 390.334770 m 0.0001 77 | 3/8 6 h-m-p 0.0010 0.0163 20.3060 -----------.. | 3/8 7 h-m-p 0.0000 0.0003 163.6605 +++ 382.819900 m 0.0003 109 | 4/8 8 h-m-p 0.0026 0.0242 14.4040 ------------.. | 4/8 9 h-m-p 0.0000 0.0002 134.1144 +++ 379.496731 m 0.0002 142 | 5/8 10 h-m-p 0.0020 0.0457 8.5707 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 95.0972 ++ 379.089123 m 0.0000 174 | 6/8 12 h-m-p 0.4119 8.0000 0.0000 --C 379.089123 0 0.0064 187 | 6/8 13 h-m-p 1.4026 8.0000 0.0000 Y 379.089123 0 0.3507 200 Out.. lnL = -379.089123 201 lfun, 201 eigenQcodon, 1206 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.030142 0.075749 0.041890 0.105784 0.048015 0.061468 0.299775 0.686696 0.255496 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 11.746029 np = 9 lnL0 = -412.439943 Iterating by ming2 Initial: fx= 412.439943 x= 0.03014 0.07575 0.04189 0.10578 0.04801 0.06147 0.29977 0.68670 0.25550 1 h-m-p 0.0000 0.0003 218.6522 +++ 396.188692 m 0.0003 15 | 1/9 2 h-m-p 0.0001 0.0007 99.1666 ++ 390.725744 m 0.0007 27 | 2/9 3 h-m-p 0.0000 0.0000 1685.7557 ++ 388.639691 m 0.0000 39 | 3/9 4 h-m-p 0.0000 0.0000 2727.1849 ++ 384.930683 m 0.0000 51 | 4/9 5 h-m-p 0.0000 0.0000 4837.2744 ++ 382.235550 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0000 35356.3112 ++ 381.619419 m 0.0000 75 | 6/9 7 h-m-p 0.0012 0.0657 6.3726 -----------.. | 6/9 8 h-m-p 0.0000 0.0003 92.8111 +++ 379.089111 m 0.0003 109 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 379.089111 m 8.0000 121 | 7/9 10 h-m-p 0.0554 8.0000 0.0017 -----Y 379.089111 0 0.0000 140 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9 12 h-m-p 0.0160 8.0000 0.0001 +++++ 379.089110 m 8.0000 182 | 7/9 13 h-m-p 0.0062 3.0817 0.4518 ---------C 379.089110 0 0.0000 205 | 7/9 14 h-m-p 0.0160 8.0000 0.0001 +++++ 379.089110 m 8.0000 222 | 7/9 15 h-m-p 0.0047 2.3411 0.3534 ---------C 379.089110 0 0.0000 245 | 7/9 16 h-m-p 0.0160 8.0000 0.0000 ------C 379.089110 0 0.0000 265 | 7/9 17 h-m-p 0.0160 8.0000 0.0000 +++++ 379.089110 m 8.0000 282 | 7/9 18 h-m-p 0.0001 0.0423 6.5964 +++++ 379.089100 m 0.0423 299 | 8/9 19 h-m-p 0.2938 1.4691 0.2814 ++ 379.089068 m 1.4691 311 | 9/9 20 h-m-p 0.0160 8.0000 0.0000 N 379.089068 0 0.0160 324 Out.. lnL = -379.089068 325 lfun, 975 eigenQcodon, 3900 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.105353 0.040639 0.105116 0.077510 0.067857 0.054047 0.000100 1.760893 0.551863 0.290411 1.492458 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 12.700388 np = 11 lnL0 = -419.519834 Iterating by ming2 Initial: fx= 419.519834 x= 0.10535 0.04064 0.10512 0.07751 0.06786 0.05405 0.00011 1.76089 0.55186 0.29041 1.49246 1 h-m-p 0.0000 0.0000 209.9276 ++ 419.375848 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0013 151.6765 ++++ 397.658927 m 0.0013 32 | 2/11 3 h-m-p 0.0000 0.0002 193.6854 ++ 392.560744 m 0.0002 46 | 3/11 4 h-m-p 0.0003 0.0017 57.6590 ++ 387.508667 m 0.0017 60 | 4/11 5 h-m-p 0.0005 0.0027 11.3763 -----------.. | 4/11 6 h-m-p 0.0000 0.0000 178.4371 ++ 386.009291 m 0.0000 97 | 5/11 7 h-m-p 0.0160 8.0000 4.4190 -------------.. | 5/11 8 h-m-p 0.0000 0.0001 155.5577 ++ 383.687599 m 0.0001 136 | 6/11 9 h-m-p 0.0160 8.0000 3.3978 -------------.. | 6/11 10 h-m-p 0.0000 0.0003 128.5356 +++ 379.109248 m 0.0003 176 | 7/11 11 h-m-p 0.0160 8.0000 1.7547 -------------.. | 7/11 12 h-m-p 0.0000 0.0000 94.1294 ++ 379.089099 m 0.0000 215 | 8/11 13 h-m-p 0.0160 8.0000 0.0000 Y 379.089099 0 0.0160 229 | 8/11 14 h-m-p 0.0276 8.0000 0.0000 C 379.089099 0 0.0069 246 Out.. lnL = -379.089099 247 lfun, 988 eigenQcodon, 4446 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -379.094699 S = -379.088232 -0.002472 Calculating f(w|X), posterior probabilities of site classes. did 10 / 43 patterns 0:02 did 20 / 43 patterns 0:02 did 30 / 43 patterns 0:02 did 40 / 43 patterns 0:02 did 43 / 43 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.011840 0.073728 0.069804 0.090098 0.073531 0.013102 0.000100 0.733108 1.240581 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.713086 np = 9 lnL0 = -409.365963 Iterating by ming2 Initial: fx= 409.365963 x= 0.01184 0.07373 0.06980 0.09010 0.07353 0.01310 0.00011 0.73311 1.24058 1 h-m-p 0.0000 0.0000 217.7214 ++ 409.188952 m 0.0000 14 | 1/9 2 h-m-p 0.0001 0.0338 21.5591 ---------.. | 1/9 3 h-m-p 0.0000 0.0001 217.7917 ++ 403.119249 m 0.0001 45 | 2/9 4 h-m-p 0.0013 0.0369 19.8033 -----------.. | 2/9 5 h-m-p 0.0000 0.0000 200.4817 ++ 402.561354 m 0.0000 78 | 3/9 6 h-m-p 0.0001 0.0418 17.5035 ----------.. | 3/9 7 h-m-p 0.0000 0.0006 178.6389 +++ 381.777564 m 0.0006 111 | 4/9 8 h-m-p 0.0089 0.0674 11.0785 -------------.. | 4/9 9 h-m-p 0.0000 0.0000 161.9431 ++ 380.705043 m 0.0000 146 | 5/9 10 h-m-p 0.0012 0.1878 4.6067 -----------.. | 5/9 11 h-m-p 0.0000 0.0000 132.4430 ++ 380.667081 m 0.0000 179 | 6/9 12 h-m-p 0.0005 0.2453 3.6172 -----------.. | 6/9 13 h-m-p 0.0000 0.0002 93.3672 +++ 379.089098 m 0.0002 213 | 7/9 14 h-m-p 1.6000 8.0000 0.0000 ++ 379.089098 m 8.0000 225 | 7/9 15 h-m-p 0.1772 8.0000 0.0000 --Y 379.089098 0 0.0028 241 | 7/9 16 h-m-p 0.0160 8.0000 0.0001 --Y 379.089098 0 0.0003 257 | 7/9 17 h-m-p 0.0160 8.0000 0.0007 -----N 379.089098 0 0.0000 276 Out.. lnL = -379.089098 277 lfun, 3047 eigenQcodon, 16620 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.079739 0.087887 0.092026 0.068650 0.022584 0.064260 0.000100 0.900000 0.294229 1.275538 1.299946 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 17.187431 np = 11 lnL0 = -415.442275 Iterating by ming2 Initial: fx= 415.442275 x= 0.07974 0.08789 0.09203 0.06865 0.02258 0.06426 0.00011 0.90000 0.29423 1.27554 1.29995 1 h-m-p 0.0000 0.0000 201.4165 ++ 415.342040 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0012 111.0651 ++++ 404.052364 m 0.0012 32 | 2/11 3 h-m-p 0.0002 0.0012 119.3256 ++ 385.212147 m 0.0012 46 | 3/11 4 h-m-p 0.0003 0.0017 36.5661 ++ 384.016337 m 0.0017 60 | 4/11 5 h-m-p 0.0000 0.0000 11995.3657 ++ 382.509768 m 0.0000 74 | 5/11 6 h-m-p 0.0003 0.0015 21.5772 ----------.. | 5/11 7 h-m-p 0.0000 0.0001 158.7379 ++ 381.097673 m 0.0001 110 | 6/11 8 h-m-p 0.0011 0.0416 6.6330 -----------.. | 6/11 9 h-m-p 0.0000 0.0001 130.8510 ++ 379.499990 m 0.0001 147 | 7/11 10 h-m-p 0.0018 0.0592 4.6312 ------------.. | 7/11 11 h-m-p 0.0000 0.0000 93.7454 ++ 379.089100 m 0.0000 185 | 8/11 12 h-m-p 0.1858 8.0000 0.0000 +++ 379.089100 m 8.0000 200 | 8/11 13 h-m-p 0.0366 8.0000 0.0007 ++++ 379.089100 m 8.0000 219 | 8/11 14 h-m-p 0.0208 7.4702 0.2735 --------C 379.089100 0 0.0000 244 | 8/11 15 h-m-p 0.0160 8.0000 0.0010 +++++ 379.089100 m 8.0000 264 | 8/11 16 h-m-p 0.0284 7.4255 0.2764 ----------N 379.089100 0 0.0000 291 | 8/11 17 h-m-p 0.0160 8.0000 0.0000 -----N 379.089100 0 0.0000 313 | 8/11 18 h-m-p 0.0160 8.0000 0.0000 --------N 379.089100 0 0.0000 338 Out.. lnL = -379.089100 339 lfun, 4068 eigenQcodon, 22374 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -379.096439 S = -379.088198 -0.003613 Calculating f(w|X), posterior probabilities of site classes. did 10 / 43 patterns 0:12 did 20 / 43 patterns 0:12 did 30 / 43 patterns 0:12 did 40 / 43 patterns 0:13 did 43 / 43 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR NC_002677_1_NP_302065_1_937_ML1523 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR ************************************************** NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN NC_002677_1_NP_302065_1_937_ML1523 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN **********************************************
>NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >NC_002677_1_NP_302065_1_937_ML1523 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC >NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >NC_002677_1_NP_302065_1_937_ML1523 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN >NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
#NEXUS [ID: 5490007798] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 NC_002677_1_NP_302065_1_937_ML1523 NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 ; end; begin trees; translate 1 NC_011896_1_WP_010908386_1_1614_MLBR_RS07670, 2 NC_002677_1_NP_302065_1_937_ML1523, 3 NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440, 4 NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870, 5 NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370, 6 NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07187126,2:0.06509148,3:0.0688649,4:0.06797268,5:0.07196968,6:0.06594947); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07187126,2:0.06509148,3:0.0688649,4:0.06797268,5:0.07196968,6:0.06594947); end;
Estimated marginal likelihoods for runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -395.63 -398.87 2 -395.64 -398.42 -------------------------------------- TOTAL -395.63 -398.67 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896569 0.088716 0.364753 1.492079 0.865948 1429.62 1465.31 1.000 r(A<->C){all} 0.164364 0.020207 0.000109 0.460436 0.123398 165.54 298.28 1.000 r(A<->G){all} 0.175485 0.021959 0.000111 0.476632 0.136343 238.54 245.64 1.000 r(A<->T){all} 0.153878 0.017526 0.000063 0.419009 0.118289 116.15 176.11 1.002 r(C<->G){all} 0.171717 0.019716 0.000127 0.458213 0.139008 321.67 333.99 1.000 r(C<->T){all} 0.172194 0.019816 0.000011 0.444855 0.138384 240.99 278.02 1.001 r(G<->T){all} 0.162362 0.019194 0.000038 0.432821 0.126298 259.38 289.25 1.000 pi(A){all} 0.178055 0.000498 0.134130 0.221433 0.177557 1187.44 1272.16 1.000 pi(C){all} 0.294746 0.000703 0.246508 0.351172 0.294059 1098.49 1148.49 1.000 pi(G){all} 0.287008 0.000692 0.234797 0.337725 0.286737 1178.77 1296.37 1.000 pi(T){all} 0.240190 0.000597 0.193106 0.287051 0.240206 1244.86 1305.99 1.000 alpha{1,2} 0.405508 0.212621 0.000147 1.325281 0.243990 1394.28 1407.19 1.000 alpha{3} 0.431717 0.214520 0.000166 1.380933 0.276220 1189.62 1345.31 1.000 pinvar{all} 0.993954 0.000055 0.980013 0.999995 0.996341 847.89 1125.92 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1523/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 96 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1 TTC 1 1 1 1 1 1 | TCC 4 4 4 4 4 4 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0 Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1 CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0 CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1 CTG 5 5 5 5 5 5 | CCG 3 3 3 3 3 3 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1 ATC 2 2 2 2 2 2 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0 ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1 Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 5 5 5 5 5 5 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3 GTC 8 8 8 8 8 8 | GCC 9 9 9 9 9 9 | GAC 1 1 1 1 1 1 | GGC 2 2 2 2 2 2 GTA 1 1 1 1 1 1 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1 GTG 0 0 0 0 0 0 | GCG 1 1 1 1 1 1 | GAG 0 0 0 0 0 0 | GGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 #2: NC_002677_1_NP_302065_1_937_ML1523 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 #3: NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 #4: NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 #5: NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 #6: NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570 position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6 TTC 6 | TCC 24 | TAC 0 | TGC 0 Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 18 | TCG 12 | TAG 0 | Trp W TGG 6 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 6 CTC 0 | CCC 0 | CAC 0 | CGC 0 CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 6 CTG 30 | CCG 18 | CAG 12 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 6 ATC 12 | ACC 18 | AAC 6 | AGC 0 ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6 Met M ATG 18 | ACG 6 | AAG 0 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 30 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 18 GTC 48 | GCC 54 | GAC 6 | GGC 12 GTA 6 | GCA 24 | Glu E GAA 6 | GGA 6 GTG 0 | GCG 6 | GAG 0 | GGG 6 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14583 C:0.18750 A:0.25000 G:0.41667 position 2: T:0.32292 C:0.37500 A:0.12500 G:0.17708 position 3: T:0.25000 C:0.32292 A:0.15625 G:0.27083 Average T:0.23958 C:0.29514 A:0.17708 G:0.28819 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -379.089123 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299775 1.299946 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29977 omega (dN/dS) = 1.29995 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 7..2 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 7..3 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 7..4 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 7..5 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 7..6 0.000 193.0 95.0 1.2999 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -379.089068 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 193.1 94.9 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -379.089099 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.684640 0.198852 0.000001 1.536612 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.68464 0.19885 0.11651 w: 0.00000 1.00000 1.53661 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 7..2 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 7..3 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 7..4 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 7..5 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 7..6 0.000 193.1 94.9 0.3779 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -379.089098 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.732673 1.240673 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.73267 q = 1.24067 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.01325 0.05973 0.12104 0.19373 0.27669 0.36977 0.47359 0.58985 0.72241 0.88289 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 7..2 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 7..3 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 7..4 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 7..5 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 7..6 0.000 193.1 94.9 0.3703 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -379.089100 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.725118 0.005000 1.308796 1.452342 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.72512 p = 0.00500 q = 1.30880 (p1 = 0.27488) w = 1.45234 MLEs of dN/dS (w) for site classes (K=11) p: 0.07251 0.07251 0.07251 0.07251 0.07251 0.07251 0.07251 0.07251 0.07251 0.07251 0.27488 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.45234 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 7..2 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 7..3 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 7..4 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 7..5 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 7..6 0.000 193.1 94.9 0.3992 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099 Time used: 0:13
Model 1: NearlyNeutral -379.089068 Model 2: PositiveSelection -379.089099 Model 0: one-ratio -379.089123 Model 7: beta -379.089098 Model 8: beta&w>1 -379.0891 Model 0 vs 1 1.0999999994965037E-4 Model 2 vs 1 6.199999995715189E-5 Model 8 vs 7 3.999999989900971E-6