--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:49:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1523/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -395.63 -398.87
2 -395.64 -398.42
--------------------------------------
TOTAL -395.63 -398.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896569 0.088716 0.364753 1.492079 0.865948 1429.62 1465.31 1.000
r(A<->C){all} 0.164364 0.020207 0.000109 0.460436 0.123398 165.54 298.28 1.000
r(A<->G){all} 0.175485 0.021959 0.000111 0.476632 0.136343 238.54 245.64 1.000
r(A<->T){all} 0.153878 0.017526 0.000063 0.419009 0.118289 116.15 176.11 1.002
r(C<->G){all} 0.171717 0.019716 0.000127 0.458213 0.139008 321.67 333.99 1.000
r(C<->T){all} 0.172194 0.019816 0.000011 0.444855 0.138384 240.99 278.02 1.001
r(G<->T){all} 0.162362 0.019194 0.000038 0.432821 0.126298 259.38 289.25 1.000
pi(A){all} 0.178055 0.000498 0.134130 0.221433 0.177557 1187.44 1272.16 1.000
pi(C){all} 0.294746 0.000703 0.246508 0.351172 0.294059 1098.49 1148.49 1.000
pi(G){all} 0.287008 0.000692 0.234797 0.337725 0.286737 1178.77 1296.37 1.000
pi(T){all} 0.240190 0.000597 0.193106 0.287051 0.240206 1244.86 1305.99 1.000
alpha{1,2} 0.405508 0.212621 0.000147 1.325281 0.243990 1394.28 1407.19 1.000
alpha{3} 0.431717 0.214520 0.000166 1.380933 0.276220 1189.62 1345.31 1.000
pinvar{all} 0.993954 0.000055 0.980013 0.999995 0.996341 847.89 1125.92 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -379.089068
Model 2: PositiveSelection -379.089099
Model 0: one-ratio -379.089123
Model 7: beta -379.089098
Model 8: beta&w>1 -379.0891
Model 0 vs 1 1.0999999994965037E-4
Model 2 vs 1 6.199999995715189E-5
Model 8 vs 7 3.999999989900971E-6
>C1
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C2
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C3
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C4
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C5
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C6
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96
C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
**************************************************
C1 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C2 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C3 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C4 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C5 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C6 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2880]--->[2880]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C2 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C3 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C4 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C5 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C6 MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
**************************************************
C1 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C2 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C3 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C4 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C5 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C6 DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C2 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C3 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C4 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C5 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C6 ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
**************************************************
C1 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C2 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C3 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C4 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C5 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C6 CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
**************************************************
C1 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C2 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C3 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C4 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C5 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C6 GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
**************************************************
C1 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C2 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C3 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C4 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C5 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C6 GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
**************************************************
C1 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C2 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C3 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C4 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C5 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C6 AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
**************************************************
C1 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C2 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C3 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C4 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C5 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C6 TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
**************************************
>C1
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C2
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C3
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C4
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C5
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C6
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C1
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C2
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C3
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C4
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C5
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C6
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 288 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855693
Setting output file names to "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 366606530
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5490007798
Seed = 1960593637
Swapseed = 1579855693
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -644.557769 -- -24.965149
Chain 2 -- -644.557769 -- -24.965149
Chain 3 -- -644.557708 -- -24.965149
Chain 4 -- -644.557769 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -644.557708 -- -24.965149
Chain 2 -- -644.557769 -- -24.965149
Chain 3 -- -644.557806 -- -24.965149
Chain 4 -- -644.557806 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558)
500 -- (-406.097) (-407.562) [-401.630] (-410.831) * (-407.576) [-404.677] (-408.143) (-414.448) -- 0:33:19
1000 -- (-407.354) [-400.459] (-408.024) (-409.706) * (-402.660) (-400.711) [-407.705] (-404.268) -- 0:16:39
1500 -- [-407.347] (-404.711) (-402.983) (-407.587) * [-405.121] (-408.674) (-405.520) (-405.337) -- 0:11:05
2000 -- [-401.071] (-407.529) (-406.265) (-411.852) * (-403.805) [-400.082] (-418.434) (-402.485) -- 0:08:19
2500 -- (-406.572) [-402.562] (-404.693) (-403.201) * (-405.288) [-403.219] (-402.670) (-403.576) -- 0:06:39
3000 -- (-406.380) [-409.375] (-405.047) (-406.649) * [-401.647] (-412.600) (-403.253) (-406.398) -- 0:05:32
3500 -- (-411.820) [-407.911] (-408.539) (-403.798) * (-404.920) (-411.282) [-409.894] (-411.119) -- 0:04:44
4000 -- (-406.882) (-402.245) (-403.286) [-404.460] * (-405.579) (-412.531) [-402.801] (-403.648) -- 0:04:09
4500 -- (-403.338) [-403.456] (-415.973) (-401.363) * (-405.159) [-400.986] (-407.263) (-403.242) -- 0:03:41
5000 -- (-408.795) (-406.114) [-407.971] (-409.152) * (-407.196) (-404.813) [-408.169] (-408.418) -- 0:03:19
Average standard deviation of split frequencies: 0.089791
5500 -- (-408.676) (-399.640) (-402.656) [-402.359] * [-406.393] (-414.132) (-406.166) (-403.729) -- 0:03:00
6000 -- (-404.173) (-408.805) (-405.694) [-402.699] * [-411.464] (-406.158) (-401.546) (-405.935) -- 0:02:45
6500 -- (-405.026) (-400.883) (-409.725) [-411.083] * [-401.985] (-403.994) (-401.038) (-403.842) -- 0:02:32
7000 -- (-413.043) (-410.198) (-405.352) [-402.990] * (-403.351) [-399.679] (-404.293) (-411.364) -- 0:02:21
7500 -- (-405.001) (-403.101) [-413.624] (-412.217) * (-404.616) (-402.182) [-407.350] (-411.568) -- 0:02:12
8000 -- (-412.535) (-404.043) [-408.054] (-401.416) * (-403.859) (-411.443) (-402.946) [-404.144] -- 0:02:04
8500 -- (-407.825) (-412.760) [-404.606] (-400.719) * (-408.585) [-404.499] (-403.660) (-409.906) -- 0:01:56
9000 -- (-409.475) [-405.849] (-408.080) (-404.969) * (-405.747) [-404.476] (-412.441) (-402.898) -- 0:01:50
9500 -- (-405.321) [-403.764] (-405.274) (-404.887) * (-408.808) (-406.657) (-413.407) [-405.560] -- 0:01:44
10000 -- (-406.193) [-405.250] (-404.843) (-407.706) * (-401.358) (-403.703) [-405.853] (-409.107) -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- (-403.759) [-403.784] (-404.901) (-406.155) * (-408.083) [-401.374] (-408.853) (-406.460) -- 0:01:34
11000 -- (-410.126) (-412.025) [-403.310] (-403.552) * (-413.549) (-406.991) [-408.096] (-408.445) -- 0:01:29
11500 -- (-416.257) (-408.323) [-405.689] (-404.328) * (-405.271) (-407.811) [-399.729] (-402.424) -- 0:01:25
12000 -- (-415.870) (-411.045) (-404.989) [-406.890] * (-404.487) (-406.632) [-403.922] (-408.027) -- 0:01:22
12500 -- (-410.262) [-400.708] (-403.820) (-405.565) * (-406.903) (-405.549) (-403.885) [-402.021] -- 0:01:19
13000 -- (-414.289) (-408.144) [-399.960] (-403.204) * [-403.356] (-408.904) (-409.416) (-406.154) -- 0:01:15
13500 -- (-404.852) (-403.706) [-407.271] (-401.740) * (-406.604) (-408.295) [-420.325] (-413.520) -- 0:01:13
14000 -- (-405.147) (-411.545) [-404.693] (-413.349) * (-417.019) [-406.115] (-403.386) (-406.792) -- 0:01:10
14500 -- (-415.036) [-396.151] (-399.019) (-409.392) * [-407.958] (-414.805) (-403.535) (-416.063) -- 0:01:07
15000 -- (-409.062) (-405.427) (-400.778) [-399.448] * [-400.871] (-406.011) (-406.358) (-411.269) -- 0:01:05
Average standard deviation of split frequencies: 0.052521
15500 -- (-405.198) (-395.691) (-409.512) [-402.608] * (-402.947) (-414.533) [-401.933] (-408.929) -- 0:01:03
16000 -- (-395.604) (-395.573) (-415.091) [-406.935] * [-407.947] (-405.201) (-403.491) (-399.800) -- 0:01:01
16500 -- [-395.472] (-394.054) (-403.056) (-408.812) * (-401.254) [-407.050] (-410.755) (-395.939) -- 0:00:59
17000 -- (-395.183) [-395.662] (-411.098) (-407.109) * (-413.733) (-411.696) [-402.410] (-395.562) -- 0:01:55
17500 -- [-398.054] (-399.493) (-405.169) (-402.714) * (-424.851) (-409.760) [-402.485] (-397.095) -- 0:01:52
18000 -- (-399.005) (-399.606) (-399.503) [-408.398] * (-401.536) (-407.095) [-403.299] (-396.286) -- 0:01:49
18500 -- (-396.885) (-399.448) [-406.035] (-413.333) * (-405.419) (-417.811) (-402.227) [-396.665] -- 0:01:46
19000 -- (-400.358) (-398.400) (-408.831) [-408.218] * [-407.317] (-412.455) (-405.261) (-394.095) -- 0:01:43
19500 -- (-395.003) (-400.235) [-397.638] (-404.975) * (-408.823) (-408.909) (-407.748) [-395.841] -- 0:01:40
20000 -- (-394.405) [-394.469] (-405.415) (-405.724) * [-403.972] (-409.775) (-402.959) (-395.333) -- 0:01:38
Average standard deviation of split frequencies: 0.052823
20500 -- (-395.844) (-395.518) [-402.398] (-413.339) * [-403.764] (-406.131) (-416.709) (-398.575) -- 0:01:35
21000 -- (-397.627) (-395.968) [-410.610] (-406.819) * (-406.487) (-402.058) (-405.460) [-396.751] -- 0:01:33
21500 -- (-395.577) [-396.205] (-409.044) (-407.222) * [-407.454] (-406.700) (-406.994) (-398.259) -- 0:01:31
22000 -- (-396.484) [-395.744] (-402.789) (-410.767) * (-407.056) (-403.919) [-405.524] (-395.585) -- 0:01:28
22500 -- (-397.269) [-396.932] (-406.588) (-409.839) * (-414.367) [-408.816] (-407.153) (-396.361) -- 0:01:26
23000 -- (-396.790) (-397.331) [-398.958] (-411.458) * [-405.231] (-418.696) (-403.765) (-398.059) -- 0:01:24
23500 -- (-399.888) (-397.027) [-412.487] (-426.067) * (-420.659) [-401.458] (-407.957) (-397.306) -- 0:01:23
24000 -- [-396.740] (-395.652) (-402.456) (-431.144) * (-405.553) (-418.144) (-400.300) [-394.962] -- 0:01:21
24500 -- [-394.955] (-396.194) (-405.178) (-419.549) * (-402.776) (-415.805) [-403.917] (-396.806) -- 0:01:19
25000 -- (-395.587) [-399.627] (-406.777) (-405.155) * (-402.419) (-412.508) [-410.892] (-395.735) -- 0:01:18
Average standard deviation of split frequencies: 0.047800
25500 -- (-394.383) [-398.166] (-417.198) (-395.214) * (-416.971) [-408.200] (-411.849) (-397.255) -- 0:01:16
26000 -- (-399.120) (-399.080) [-412.873] (-395.502) * (-400.533) [-410.640] (-408.954) (-398.939) -- 0:01:14
26500 -- (-398.016) [-399.014] (-401.880) (-395.424) * (-401.373) (-409.052) [-401.232] (-398.757) -- 0:01:13
27000 -- (-396.350) (-397.009) (-408.571) [-396.760] * (-407.898) (-413.315) [-411.675] (-395.890) -- 0:01:12
27500 -- (-395.335) [-394.883] (-411.247) (-399.656) * (-427.778) [-396.689] (-404.885) (-396.133) -- 0:01:10
28000 -- (-394.486) [-394.416] (-402.974) (-396.550) * (-406.925) (-397.086) (-404.591) [-396.625] -- 0:01:09
28500 -- (-394.411) [-395.622] (-406.541) (-398.396) * (-406.242) (-395.756) (-408.801) [-396.710] -- 0:01:08
29000 -- (-395.284) (-396.156) (-401.094) [-395.340] * (-401.017) [-396.432] (-409.261) (-396.457) -- 0:01:06
29500 -- (-396.784) [-394.967] (-396.814) (-395.895) * (-407.238) [-396.455] (-415.208) (-396.326) -- 0:01:05
30000 -- (-395.504) (-395.447) (-398.504) [-395.258] * (-402.896) [-397.322] (-415.006) (-396.774) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- [-396.674] (-396.541) (-402.438) (-396.903) * (-407.703) [-394.672] (-402.917) (-402.216) -- 0:01:03
31000 -- (-394.256) (-395.213) (-394.874) [-394.166] * (-396.565) (-397.141) [-395.137] (-395.691) -- 0:01:02
31500 -- [-394.159] (-395.736) (-393.954) (-396.202) * (-395.193) [-396.230] (-394.590) (-394.817) -- 0:01:01
32000 -- (-398.478) [-394.698] (-395.669) (-400.724) * (-395.836) (-396.005) [-395.365] (-400.372) -- 0:01:00
32500 -- (-398.843) (-397.004) [-397.894] (-397.439) * [-399.050] (-396.173) (-397.003) (-399.970) -- 0:00:59
33000 -- (-395.943) (-395.666) (-395.809) [-398.626] * [-397.377] (-398.066) (-399.155) (-395.816) -- 0:00:58
33500 -- (-398.077) (-395.068) (-394.327) [-398.185] * [-396.646] (-398.746) (-399.989) (-398.553) -- 0:01:26
34000 -- (-399.491) [-395.730] (-395.202) (-397.420) * (-395.218) (-396.454) (-400.073) [-400.652] -- 0:01:25
34500 -- (-396.840) [-396.629] (-399.202) (-395.830) * (-394.860) [-397.732] (-394.631) (-397.559) -- 0:01:23
35000 -- (-400.082) (-398.683) [-397.800] (-396.633) * (-395.818) (-398.702) (-396.666) [-398.454] -- 0:01:22
Average standard deviation of split frequencies: 0.038556
35500 -- (-395.487) [-395.361] (-397.671) (-396.181) * (-397.370) [-399.674] (-396.495) (-400.786) -- 0:01:21
36000 -- [-397.332] (-398.000) (-395.837) (-395.779) * (-395.723) [-397.341] (-394.920) (-396.221) -- 0:01:20
36500 -- [-399.441] (-398.047) (-397.980) (-395.241) * (-397.258) (-397.370) [-396.931] (-396.124) -- 0:01:19
37000 -- (-397.581) (-401.849) (-395.518) [-396.568] * (-396.367) (-397.117) [-395.651] (-396.165) -- 0:01:18
37500 -- (-395.030) [-401.989] (-396.063) (-395.500) * [-397.652] (-401.282) (-398.180) (-394.792) -- 0:01:17
38000 -- (-395.156) [-396.482] (-395.941) (-395.740) * (-395.813) (-397.563) [-398.343] (-399.847) -- 0:01:15
38500 -- (-397.377) [-396.350] (-398.101) (-395.515) * (-399.222) (-395.906) (-397.667) [-397.094] -- 0:01:14
39000 -- [-394.312] (-395.846) (-394.658) (-395.738) * (-395.037) [-395.181] (-395.972) (-394.945) -- 0:01:13
39500 -- (-401.538) [-395.001] (-397.200) (-395.393) * (-396.225) (-396.982) (-397.124) [-394.579] -- 0:01:12
40000 -- (-399.875) [-395.755] (-394.623) (-396.927) * [-395.196] (-395.588) (-399.337) (-396.173) -- 0:01:12
Average standard deviation of split frequencies: 0.040267
40500 -- (-405.947) [-395.849] (-395.364) (-399.252) * (-394.501) (-398.764) (-396.008) [-396.523] -- 0:01:11
41000 -- (-396.271) (-398.601) (-394.644) [-397.141] * [-394.885] (-396.240) (-394.905) (-396.214) -- 0:01:10
41500 -- (-398.926) (-396.077) (-394.588) [-395.812] * (-396.411) (-397.432) (-399.515) [-397.474] -- 0:01:09
42000 -- (-396.345) (-394.563) (-399.946) [-396.081] * (-399.148) [-394.985] (-397.244) (-395.873) -- 0:01:08
42500 -- (-396.583) [-395.588] (-396.519) (-396.770) * (-399.151) (-395.754) [-395.040] (-395.199) -- 0:01:07
43000 -- (-398.063) (-395.906) [-394.918] (-397.334) * (-399.679) (-397.561) (-399.585) [-398.538] -- 0:01:06
43500 -- (-395.368) [-396.614] (-397.067) (-396.847) * (-401.059) [-397.246] (-400.444) (-395.096) -- 0:01:05
44000 -- (-394.126) (-394.434) (-395.286) [-395.198] * (-395.442) (-398.630) (-397.515) [-395.981] -- 0:01:05
44500 -- (-396.043) (-396.906) [-399.090] (-394.802) * (-398.247) (-398.476) (-398.778) [-394.266] -- 0:01:04
45000 -- [-399.488] (-395.582) (-395.668) (-397.997) * (-399.347) (-395.641) [-395.062] (-395.233) -- 0:01:03
Average standard deviation of split frequencies: 0.039040
45500 -- (-399.671) [-394.498] (-396.108) (-398.261) * [-395.959] (-395.598) (-395.484) (-395.647) -- 0:01:02
46000 -- (-396.533) (-394.595) (-395.417) [-397.020] * [-396.984] (-397.326) (-396.057) (-399.097) -- 0:01:02
46500 -- (-395.414) [-394.860] (-395.479) (-396.474) * [-395.141] (-395.999) (-399.425) (-397.480) -- 0:01:01
47000 -- (-394.991) (-396.749) (-395.280) [-394.728] * (-395.334) (-395.351) [-400.696] (-401.243) -- 0:01:00
47500 -- (-400.192) (-396.542) (-395.046) [-396.543] * [-395.285] (-396.341) (-396.480) (-396.961) -- 0:01:00
48000 -- (-395.534) (-396.435) [-397.058] (-396.559) * (-404.171) (-398.285) (-397.453) [-395.487] -- 0:00:59
48500 -- [-397.736] (-397.349) (-395.722) (-397.289) * (-403.969) (-403.579) [-396.225] (-395.088) -- 0:00:58
49000 -- (-395.423) (-395.367) (-394.110) [-394.595] * (-399.405) (-399.075) (-396.988) [-395.759] -- 0:00:58
49500 -- [-394.919] (-396.376) (-394.415) (-399.354) * (-395.793) (-400.713) (-395.198) [-393.913] -- 0:00:57
50000 -- [-397.673] (-395.254) (-396.175) (-398.029) * [-397.503] (-399.951) (-395.441) (-396.966) -- 0:00:57
Average standard deviation of split frequencies: 0.041351
50500 -- [-395.167] (-394.268) (-395.825) (-395.006) * [-396.759] (-399.409) (-395.340) (-396.487) -- 0:01:15
51000 -- (-397.543) [-394.571] (-397.380) (-395.440) * (-395.990) (-400.828) (-402.042) [-395.717] -- 0:01:14
51500 -- (-394.213) (-394.033) [-396.030] (-396.365) * (-399.548) [-395.900] (-399.258) (-397.129) -- 0:01:13
52000 -- (-394.586) (-395.947) [-396.546] (-396.330) * (-396.225) [-394.789] (-397.827) (-395.267) -- 0:01:12
52500 -- (-395.726) [-395.467] (-397.097) (-408.692) * (-395.358) (-394.550) (-396.816) [-396.041] -- 0:01:12
53000 -- [-398.014] (-398.946) (-396.597) (-403.517) * [-395.865] (-395.216) (-395.562) (-396.921) -- 0:01:11
53500 -- [-395.016] (-396.299) (-395.593) (-394.824) * [-397.431] (-395.131) (-399.172) (-397.840) -- 0:01:10
54000 -- (-396.503) (-398.830) [-396.491] (-394.855) * (-395.652) (-395.928) (-396.379) [-395.436] -- 0:01:10
54500 -- (-399.025) [-394.907] (-394.669) (-396.179) * (-399.011) (-397.170) [-395.218] (-395.658) -- 0:01:09
55000 -- (-397.795) [-395.053] (-395.396) (-395.715) * (-397.451) (-395.559) (-395.283) [-394.657] -- 0:01:08
Average standard deviation of split frequencies: 0.040761
55500 -- [-395.691] (-395.534) (-395.421) (-394.786) * [-396.332] (-397.987) (-394.714) (-395.606) -- 0:01:08
56000 -- (-397.004) (-399.263) [-395.470] (-396.753) * (-397.574) (-396.019) [-394.336] (-394.495) -- 0:01:07
56500 -- (-398.041) (-394.632) [-396.339] (-399.952) * (-397.031) (-400.763) (-397.057) [-394.599] -- 0:01:06
57000 -- [-395.021] (-395.248) (-395.574) (-396.764) * (-395.179) (-397.447) [-400.549] (-396.604) -- 0:01:06
57500 -- (-397.116) (-397.299) [-396.153] (-397.820) * (-397.789) [-396.997] (-395.402) (-397.252) -- 0:01:05
58000 -- (-398.677) (-398.740) [-396.988] (-397.017) * (-394.818) (-394.471) [-394.740] (-394.771) -- 0:01:04
58500 -- [-396.255] (-397.328) (-397.729) (-395.723) * (-400.817) [-396.718] (-395.438) (-396.728) -- 0:01:04
59000 -- (-397.253) (-395.055) (-395.221) [-395.689] * (-398.379) (-397.114) [-396.120] (-396.711) -- 0:01:03
59500 -- (-398.526) [-396.998] (-398.985) (-394.791) * [-396.296] (-398.066) (-395.836) (-396.556) -- 0:01:03
60000 -- (-397.493) (-397.766) [-394.574] (-397.140) * (-403.252) (-396.246) [-397.748] (-395.829) -- 0:01:02
Average standard deviation of split frequencies: 0.032309
60500 -- (-394.537) (-400.503) (-397.357) [-395.234] * [-399.252] (-396.617) (-398.420) (-397.789) -- 0:01:02
61000 -- (-396.035) (-395.028) (-396.667) [-396.227] * (-398.615) [-396.727] (-395.281) (-400.218) -- 0:01:01
61500 -- (-395.378) [-396.888] (-396.730) (-398.056) * [-395.640] (-398.079) (-396.923) (-396.191) -- 0:01:01
62000 -- (-395.680) (-395.130) (-396.759) [-398.553] * (-396.919) [-398.994] (-397.118) (-397.604) -- 0:01:00
62500 -- (-399.444) (-396.325) [-398.651] (-394.844) * [-396.141] (-395.850) (-395.393) (-397.718) -- 0:01:00
63000 -- (-402.163) [-394.912] (-396.640) (-394.735) * [-395.668] (-399.109) (-398.060) (-397.498) -- 0:00:59
63500 -- (-402.189) (-395.348) (-398.847) [-398.534] * (-395.509) [-396.526] (-397.837) (-396.190) -- 0:00:58
64000 -- (-400.820) [-395.861] (-398.350) (-396.062) * (-395.929) (-399.028) [-395.051] (-394.642) -- 0:00:58
64500 -- (-396.913) (-396.444) (-398.157) [-396.358] * (-399.448) (-396.136) (-397.796) [-396.289] -- 0:00:58
65000 -- (-395.076) (-401.465) (-397.808) [-398.460] * (-395.419) [-395.014] (-396.842) (-395.081) -- 0:00:57
Average standard deviation of split frequencies: 0.026869
65500 -- (-396.046) (-396.839) (-395.809) [-395.277] * (-396.301) [-396.311] (-395.948) (-397.598) -- 0:00:57
66000 -- (-396.122) (-397.452) (-395.983) [-397.565] * (-395.391) (-396.240) (-396.237) [-396.676] -- 0:00:56
66500 -- (-398.998) (-396.603) [-396.104] (-395.271) * (-396.411) (-397.398) (-396.090) [-396.661] -- 0:01:10
67000 -- (-401.563) [-396.857] (-394.903) (-395.914) * (-396.918) (-397.612) [-396.474] (-397.520) -- 0:01:09
67500 -- (-397.572) (-396.909) (-397.898) [-396.843] * (-396.127) (-403.066) [-394.689] (-395.888) -- 0:01:09
68000 -- (-396.578) (-398.494) [-395.678] (-399.208) * (-396.069) [-400.473] (-395.746) (-397.401) -- 0:01:08
68500 -- (-394.181) (-398.860) (-399.224) [-395.013] * (-394.210) [-397.710] (-396.702) (-396.140) -- 0:01:07
69000 -- (-395.881) (-394.627) [-398.927] (-394.634) * (-395.648) (-396.848) (-398.880) [-396.209] -- 0:01:07
69500 -- (-396.030) (-395.138) (-396.023) [-396.905] * [-396.366] (-396.463) (-395.563) (-396.535) -- 0:01:06
70000 -- (-394.447) [-394.645] (-396.490) (-399.823) * (-400.334) (-395.491) [-394.845] (-401.057) -- 0:01:06
Average standard deviation of split frequencies: 0.022347
70500 -- [-396.531] (-394.845) (-395.438) (-395.051) * (-396.032) (-394.876) [-394.952] (-394.719) -- 0:01:05
71000 -- (-401.329) [-396.343] (-395.506) (-396.414) * (-395.472) (-398.312) (-399.015) [-397.964] -- 0:01:05
71500 -- [-395.807] (-395.491) (-396.847) (-396.268) * (-395.705) [-397.215] (-397.286) (-395.230) -- 0:01:04
72000 -- (-394.835) (-394.716) [-395.899] (-397.868) * (-399.636) [-397.712] (-398.475) (-400.256) -- 0:01:04
72500 -- (-395.407) (-396.680) (-396.862) [-395.897] * (-394.525) (-400.153) (-396.997) [-395.146] -- 0:01:03
73000 -- (-399.969) (-396.474) (-397.107) [-395.575] * [-394.481] (-395.944) (-398.765) (-396.851) -- 0:01:03
73500 -- (-400.711) [-396.614] (-396.787) (-396.377) * (-395.351) (-396.250) [-396.008] (-397.235) -- 0:01:03
74000 -- [-394.162] (-396.819) (-397.395) (-394.003) * [-395.635] (-395.214) (-395.740) (-396.335) -- 0:01:02
74500 -- (-395.977) [-395.298] (-396.810) (-397.553) * (-395.960) (-397.203) [-395.222] (-398.981) -- 0:01:02
75000 -- [-395.789] (-395.733) (-394.739) (-400.766) * [-396.281] (-397.875) (-396.393) (-396.935) -- 0:01:01
Average standard deviation of split frequencies: 0.024811
75500 -- (-398.459) (-396.355) [-397.309] (-395.467) * (-396.792) (-396.284) (-397.289) [-397.123] -- 0:01:01
76000 -- (-396.228) (-399.943) [-396.643] (-401.316) * (-396.736) (-396.054) [-394.738] (-398.447) -- 0:01:00
76500 -- [-394.442] (-395.055) (-397.793) (-401.371) * [-394.639] (-396.591) (-396.864) (-396.492) -- 0:01:00
77000 -- (-395.011) (-396.112) [-395.992] (-398.756) * (-396.027) (-400.376) [-396.829] (-399.519) -- 0:00:59
77500 -- [-395.174] (-398.443) (-397.363) (-396.918) * [-398.393] (-400.201) (-395.094) (-397.792) -- 0:00:59
78000 -- (-395.409) [-395.476] (-396.530) (-399.072) * (-399.219) (-395.271) [-397.001] (-394.733) -- 0:00:59
78500 -- [-395.280] (-395.399) (-396.941) (-398.782) * (-398.576) (-398.228) (-400.669) [-397.676] -- 0:00:58
79000 -- (-398.457) (-397.533) [-397.237] (-397.720) * (-398.550) [-396.932] (-395.454) (-399.375) -- 0:00:58
79500 -- [-397.007] (-398.565) (-395.178) (-395.195) * (-397.825) (-397.687) [-397.002] (-396.626) -- 0:00:57
80000 -- (-394.230) [-394.839] (-394.605) (-397.155) * [-395.305] (-396.360) (-395.843) (-395.517) -- 0:00:57
Average standard deviation of split frequencies: 0.023097
80500 -- (-396.294) (-395.610) [-395.200] (-397.431) * (-395.734) (-400.064) [-396.867] (-395.720) -- 0:00:57
81000 -- (-394.504) (-400.509) [-395.706] (-396.039) * (-396.797) (-394.601) [-395.782] (-395.639) -- 0:00:56
81500 -- [-395.670] (-398.871) (-395.128) (-394.944) * (-399.323) (-396.543) [-396.491] (-395.415) -- 0:00:56
82000 -- (-395.890) (-399.498) [-395.215] (-396.370) * (-398.273) (-401.745) [-395.825] (-396.035) -- 0:00:55
82500 -- (-394.208) [-397.575] (-397.896) (-398.009) * (-399.366) [-395.690] (-398.754) (-395.419) -- 0:00:55
83000 -- [-395.486] (-394.822) (-395.179) (-394.875) * [-396.113] (-395.873) (-396.315) (-395.999) -- 0:00:55
83500 -- (-394.752) (-396.399) [-396.762] (-393.990) * (-396.325) (-396.825) [-394.741] (-396.100) -- 0:01:05
84000 -- (-395.659) (-397.608) (-396.292) [-395.804] * [-395.362] (-399.782) (-396.588) (-395.877) -- 0:01:05
84500 -- [-395.437] (-397.934) (-394.745) (-394.972) * (-400.474) [-395.288] (-398.861) (-399.327) -- 0:01:05
85000 -- (-395.152) [-395.131] (-394.321) (-395.863) * (-396.352) (-396.709) (-398.999) [-398.365] -- 0:01:04
Average standard deviation of split frequencies: 0.022448
85500 -- (-394.876) (-397.140) [-395.575] (-394.873) * [-396.716] (-397.380) (-398.810) (-397.069) -- 0:01:04
86000 -- (-395.706) [-397.399] (-396.191) (-394.433) * (-401.632) (-395.398) (-396.746) [-396.204] -- 0:01:03
86500 -- (-396.395) (-395.903) (-400.210) [-395.008] * (-397.581) (-397.798) [-396.885] (-394.692) -- 0:01:03
87000 -- (-395.462) [-394.513] (-396.247) (-395.899) * (-398.088) (-395.382) [-398.446] (-397.080) -- 0:01:02
87500 -- (-395.895) (-396.807) (-404.230) [-395.584] * (-395.415) [-397.635] (-399.807) (-397.116) -- 0:01:02
88000 -- [-394.940] (-396.118) (-403.085) (-394.941) * [-395.250] (-396.764) (-396.031) (-394.699) -- 0:01:02
88500 -- (-394.710) [-395.874] (-402.601) (-397.458) * (-394.887) (-395.362) [-395.410] (-396.411) -- 0:01:01
89000 -- (-398.369) (-396.853) (-395.425) [-395.321] * (-396.700) (-403.393) (-395.448) [-396.410] -- 0:01:01
89500 -- (-400.472) (-395.089) (-398.641) [-399.101] * (-398.656) (-398.058) (-397.101) [-395.248] -- 0:01:01
90000 -- (-406.295) (-400.703) [-395.609] (-395.758) * (-396.854) (-398.503) (-397.532) [-395.626] -- 0:01:00
Average standard deviation of split frequencies: 0.024342
90500 -- (-398.596) [-396.762] (-395.689) (-399.141) * (-395.182) (-398.471) [-400.459] (-395.830) -- 0:01:00
91000 -- (-397.326) (-396.053) [-396.109] (-397.487) * (-396.870) [-398.758] (-396.407) (-397.927) -- 0:00:59
91500 -- [-397.760] (-396.715) (-398.545) (-395.054) * (-395.563) (-398.736) [-396.487] (-396.489) -- 0:00:59
92000 -- (-394.895) (-394.869) [-398.951] (-395.686) * [-396.320] (-396.186) (-397.507) (-396.430) -- 0:00:59
92500 -- (-395.909) (-400.600) (-396.516) [-395.394] * (-397.430) [-395.698] (-395.090) (-401.718) -- 0:00:58
93000 -- [-397.782] (-395.039) (-397.049) (-399.821) * (-396.093) (-399.506) [-396.651] (-398.375) -- 0:00:58
93500 -- [-400.546] (-399.345) (-396.632) (-396.478) * (-400.423) (-394.388) [-394.707] (-396.547) -- 0:00:58
94000 -- (-398.232) (-397.645) [-396.855] (-397.260) * (-395.516) (-394.435) [-395.197] (-399.369) -- 0:00:57
94500 -- (-394.364) (-398.179) (-402.036) [-397.045] * (-395.397) [-394.899] (-396.619) (-401.218) -- 0:00:57
95000 -- (-395.331) (-396.982) (-397.141) [-397.995] * (-396.992) (-396.286) [-396.647] (-397.058) -- 0:00:57
Average standard deviation of split frequencies: 0.026784
95500 -- (-396.745) (-397.747) [-394.189] (-396.997) * [-394.963] (-396.239) (-396.336) (-396.350) -- 0:00:56
96000 -- (-402.891) [-396.184] (-395.589) (-395.138) * (-395.576) (-396.348) (-395.172) [-396.256] -- 0:00:56
96500 -- (-400.091) (-395.439) [-397.250] (-403.383) * (-395.555) [-394.751] (-394.360) (-395.508) -- 0:00:56
97000 -- (-398.579) (-395.812) (-399.764) [-394.654] * (-396.046) (-395.947) (-398.853) [-395.082] -- 0:00:55
97500 -- [-397.958] (-396.233) (-395.995) (-396.576) * (-396.298) (-396.644) (-398.656) [-394.898] -- 0:00:55
98000 -- [-394.840] (-395.139) (-394.616) (-395.660) * (-398.486) (-396.961) [-396.929] (-396.217) -- 0:00:55
98500 -- [-395.932] (-397.196) (-397.722) (-397.358) * [-395.551] (-400.732) (-397.321) (-395.814) -- 0:00:54
99000 -- (-395.929) [-398.852] (-398.192) (-397.051) * (-397.650) [-395.767] (-397.032) (-395.154) -- 0:00:54
99500 -- (-399.572) (-394.958) [-395.525] (-395.771) * (-395.389) (-395.618) (-395.026) [-395.419] -- 0:00:54
100000 -- [-398.689] (-394.774) (-396.563) (-396.025) * (-397.263) (-398.638) [-399.416] (-396.278) -- 0:00:54
Average standard deviation of split frequencies: 0.026090
100500 -- (-399.076) (-395.634) [-395.737] (-394.974) * [-395.673] (-399.061) (-396.446) (-396.949) -- 0:01:02
101000 -- (-399.719) (-395.220) [-397.602] (-397.576) * (-394.716) [-394.632] (-394.077) (-394.682) -- 0:01:02
101500 -- (-394.875) [-394.696] (-395.402) (-395.512) * (-396.319) (-394.662) [-394.635] (-396.007) -- 0:01:01
102000 -- (-397.743) (-398.207) (-396.620) [-397.542] * (-396.186) [-395.754] (-398.002) (-394.502) -- 0:01:01
102500 -- (-400.289) (-396.172) (-395.856) [-397.141] * [-397.990] (-396.462) (-396.678) (-395.761) -- 0:01:01
103000 -- (-395.990) [-396.682] (-394.881) (-401.060) * (-395.309) (-399.176) [-396.172] (-396.457) -- 0:01:00
103500 -- (-404.993) (-396.294) [-396.781] (-395.039) * (-394.837) (-397.297) [-396.337] (-396.348) -- 0:01:00
104000 -- [-403.663] (-394.922) (-396.525) (-395.322) * [-396.786] (-397.233) (-397.976) (-394.715) -- 0:01:00
104500 -- (-402.827) [-396.761] (-398.014) (-401.760) * [-397.380] (-396.572) (-396.988) (-398.549) -- 0:00:59
105000 -- (-395.494) [-397.982] (-394.977) (-395.700) * (-395.291) [-397.323] (-395.779) (-394.866) -- 0:00:59
Average standard deviation of split frequencies: 0.027088
105500 -- (-394.783) (-396.697) [-394.376] (-395.454) * (-396.829) [-395.018] (-401.382) (-395.896) -- 0:00:59
106000 -- (-397.291) (-395.719) [-394.305] (-395.509) * [-396.445] (-394.567) (-395.628) (-395.112) -- 0:00:59
106500 -- [-394.387] (-395.015) (-404.171) (-397.236) * (-394.802) [-394.639] (-396.086) (-395.407) -- 0:00:58
107000 -- (-394.383) (-396.777) (-398.484) [-395.313] * (-399.893) (-398.281) (-395.561) [-397.230] -- 0:00:58
107500 -- (-396.887) [-396.584] (-395.202) (-400.005) * (-398.966) (-396.243) (-395.474) [-395.484] -- 0:00:58
108000 -- (-395.878) (-397.119) (-395.117) [-397.204] * [-395.865] (-398.198) (-397.073) (-400.458) -- 0:00:57
108500 -- (-394.349) (-397.064) [-395.644] (-397.478) * (-396.286) (-396.419) [-394.686] (-394.934) -- 0:00:57
109000 -- [-395.934] (-396.588) (-395.645) (-397.385) * (-396.174) [-395.031] (-395.864) (-400.184) -- 0:00:57
109500 -- (-395.509) [-396.524] (-397.254) (-395.450) * [-395.112] (-397.091) (-396.741) (-396.462) -- 0:00:56
110000 -- (-398.562) (-397.775) [-397.508] (-395.059) * (-395.228) (-399.845) (-394.487) [-395.677] -- 0:00:56
Average standard deviation of split frequencies: 0.027107
110500 -- (-396.279) [-396.899] (-397.561) (-395.441) * [-394.746] (-403.325) (-394.556) (-395.221) -- 0:00:56
111000 -- (-396.509) (-394.904) (-396.546) [-395.127] * [-396.689] (-398.674) (-396.679) (-395.575) -- 0:00:56
111500 -- [-394.845] (-397.485) (-395.347) (-394.963) * (-394.904) [-397.053] (-399.250) (-395.234) -- 0:00:55
112000 -- [-399.390] (-397.137) (-396.636) (-394.431) * [-396.486] (-394.708) (-397.549) (-395.126) -- 0:00:55
112500 -- [-395.820] (-396.682) (-396.234) (-396.635) * (-394.291) (-397.678) [-395.904] (-395.409) -- 0:00:55
113000 -- [-395.283] (-396.662) (-396.062) (-401.009) * [-396.533] (-397.955) (-396.256) (-396.687) -- 0:00:54
113500 -- (-397.328) (-395.624) [-396.102] (-395.962) * (-399.228) (-395.421) [-394.784] (-396.477) -- 0:00:54
114000 -- (-398.382) (-395.002) [-397.293] (-398.686) * (-399.349) (-395.298) (-394.878) [-396.978] -- 0:00:54
114500 -- (-394.810) (-395.222) [-396.076] (-396.157) * (-395.875) (-396.064) [-394.119] (-396.996) -- 0:00:54
115000 -- (-394.700) (-395.686) (-397.128) [-397.352] * (-395.030) (-394.618) (-394.879) [-399.870] -- 0:00:53
Average standard deviation of split frequencies: 0.025544
115500 -- [-395.572] (-397.274) (-395.006) (-397.977) * (-394.306) (-396.946) (-395.483) [-396.488] -- 0:00:53
116000 -- [-397.694] (-397.367) (-395.222) (-397.514) * (-397.202) [-396.103] (-396.820) (-395.711) -- 0:00:53
116500 -- (-394.461) (-397.938) [-394.754] (-394.740) * [-394.898] (-395.804) (-396.553) (-398.294) -- 0:00:53
117000 -- [-396.083] (-398.358) (-395.397) (-394.644) * [-398.261] (-402.489) (-398.921) (-395.619) -- 0:01:00
117500 -- (-396.232) [-396.670] (-397.146) (-394.971) * (-397.877) (-394.432) (-399.771) [-396.974] -- 0:01:00
118000 -- [-395.206] (-395.583) (-396.853) (-395.041) * (-399.313) (-394.860) (-396.363) [-397.104] -- 0:00:59
118500 -- (-395.946) (-394.431) [-402.083] (-396.399) * [-395.727] (-394.644) (-395.309) (-397.716) -- 0:00:59
119000 -- [-397.081] (-395.435) (-399.452) (-395.842) * (-397.329) (-398.009) (-396.122) [-396.308] -- 0:00:59
119500 -- (-394.298) [-400.902] (-395.537) (-395.655) * (-397.215) [-399.663] (-396.563) (-394.886) -- 0:00:58
120000 -- (-395.831) (-396.774) [-395.584] (-395.906) * (-398.885) (-396.720) (-397.211) [-396.795] -- 0:00:58
Average standard deviation of split frequencies: 0.025300
120500 -- (-396.514) [-396.056] (-394.952) (-395.667) * [-396.653] (-397.855) (-395.331) (-397.408) -- 0:00:58
121000 -- (-394.834) (-395.531) [-396.887] (-395.074) * (-400.334) (-404.273) (-395.707) [-396.924] -- 0:00:58
121500 -- (-395.740) [-396.747] (-394.108) (-396.993) * (-394.861) (-399.178) [-394.807] (-398.051) -- 0:00:57
122000 -- (-395.252) [-394.574] (-394.459) (-397.205) * [-396.899] (-401.362) (-395.325) (-396.330) -- 0:00:57
122500 -- (-397.170) [-394.501] (-396.359) (-396.039) * [-395.870] (-401.795) (-397.508) (-397.288) -- 0:00:57
123000 -- (-396.258) (-398.938) [-395.798] (-397.724) * [-395.916] (-397.455) (-401.960) (-396.658) -- 0:00:57
123500 -- [-395.968] (-395.401) (-400.051) (-401.391) * (-400.236) (-396.491) (-401.931) [-396.085] -- 0:00:56
124000 -- (-399.182) [-396.195] (-397.996) (-400.041) * (-399.145) (-394.715) [-396.732] (-396.796) -- 0:00:56
124500 -- (-405.260) (-395.356) [-395.794] (-394.716) * (-396.797) (-396.162) [-395.675] (-395.002) -- 0:00:56
125000 -- (-399.857) (-399.291) [-398.007] (-395.631) * (-396.325) (-396.379) [-395.973] (-396.168) -- 0:00:56
Average standard deviation of split frequencies: 0.026189
125500 -- (-396.778) [-399.261] (-395.897) (-394.927) * (-398.340) (-397.851) (-398.493) [-395.290] -- 0:00:55
126000 -- (-399.190) (-396.836) [-394.913] (-395.428) * (-395.416) (-395.358) [-395.087] (-394.688) -- 0:00:55
126500 -- (-396.860) (-396.966) (-398.960) [-394.984] * (-397.542) (-394.640) (-394.751) [-396.814] -- 0:00:55
127000 -- (-396.577) [-396.516] (-394.731) (-395.239) * [-395.424] (-394.877) (-395.461) (-395.243) -- 0:00:54
127500 -- (-395.680) (-395.778) (-398.023) [-396.354] * (-394.604) [-396.287] (-397.769) (-395.399) -- 0:00:54
128000 -- (-395.812) (-397.987) [-396.835] (-395.232) * (-396.512) (-396.190) (-400.639) [-396.374] -- 0:00:54
128500 -- (-397.797) (-396.146) (-398.259) [-396.338] * [-395.790] (-396.202) (-397.395) (-400.296) -- 0:00:54
129000 -- (-398.339) (-397.402) [-395.821] (-399.087) * (-396.820) [-397.126] (-395.716) (-396.483) -- 0:00:54
129500 -- (-398.315) (-395.219) [-399.418] (-397.894) * (-401.289) (-397.011) [-394.233] (-395.206) -- 0:00:53
130000 -- [-397.436] (-396.030) (-396.953) (-395.487) * (-397.443) [-396.239] (-394.369) (-395.903) -- 0:00:53
Average standard deviation of split frequencies: 0.024910
130500 -- (-395.324) (-405.476) (-396.352) [-399.384] * (-395.315) [-398.609] (-395.351) (-394.141) -- 0:00:53
131000 -- (-404.285) (-400.628) [-398.906] (-397.600) * (-396.285) [-394.762] (-397.729) (-395.412) -- 0:00:53
131500 -- [-396.633] (-397.444) (-399.115) (-394.085) * (-396.115) [-396.097] (-399.897) (-397.386) -- 0:00:52
132000 -- [-398.922] (-399.602) (-397.447) (-394.643) * (-397.609) [-394.833] (-397.863) (-396.348) -- 0:00:52
132500 -- (-399.278) [-398.353] (-395.525) (-395.496) * (-396.680) (-396.890) [-396.200] (-401.656) -- 0:00:52
133000 -- (-399.821) (-394.159) [-395.806] (-400.514) * [-395.967] (-395.703) (-397.934) (-397.447) -- 0:00:52
133500 -- (-397.152) [-396.842] (-395.932) (-399.658) * (-394.753) [-396.045] (-395.829) (-395.151) -- 0:00:58
134000 -- (-396.060) (-395.756) [-395.309] (-394.555) * (-396.622) (-402.150) [-400.821] (-395.958) -- 0:00:58
134500 -- [-397.849] (-394.812) (-396.949) (-396.036) * (-394.959) (-396.663) (-399.975) [-396.404] -- 0:00:57
135000 -- (-395.984) [-394.787] (-396.333) (-397.343) * (-399.712) (-398.940) [-395.498] (-396.959) -- 0:00:57
Average standard deviation of split frequencies: 0.024594
135500 -- (-401.040) (-397.209) (-397.909) [-396.353] * (-398.557) (-395.991) (-396.277) [-399.297] -- 0:00:57
136000 -- (-399.187) (-396.242) [-395.027] (-395.526) * (-395.638) [-397.088] (-396.418) (-396.626) -- 0:00:57
136500 -- (-397.216) [-395.032] (-398.313) (-395.230) * (-394.295) [-396.799] (-396.226) (-396.902) -- 0:00:56
137000 -- (-397.822) [-396.680] (-396.471) (-394.376) * (-396.446) [-396.228] (-395.639) (-398.849) -- 0:00:56
137500 -- (-394.399) (-397.567) [-396.592] (-394.755) * (-397.612) (-399.994) (-395.656) [-395.476] -- 0:00:56
138000 -- (-396.098) (-399.027) [-402.083] (-396.186) * (-395.130) (-394.612) (-399.665) [-397.855] -- 0:00:56
138500 -- (-395.831) [-396.030] (-397.409) (-396.364) * (-397.911) (-396.547) [-397.131] (-396.344) -- 0:00:55
139000 -- (-397.218) (-394.852) [-396.557] (-394.955) * (-397.834) (-397.812) [-394.304] (-396.508) -- 0:00:55
139500 -- (-395.407) (-394.290) (-395.698) [-396.489] * (-398.268) [-396.170] (-396.357) (-396.771) -- 0:00:55
140000 -- (-395.575) (-394.948) [-395.357] (-399.272) * (-397.511) (-395.365) (-394.768) [-397.208] -- 0:00:55
Average standard deviation of split frequencies: 0.022661
140500 -- (-397.697) (-396.171) (-400.898) [-395.900] * (-397.477) (-394.095) [-395.725] (-395.861) -- 0:00:55
141000 -- (-394.746) (-396.797) (-401.714) [-396.695] * (-395.624) [-394.225] (-396.223) (-396.431) -- 0:00:54
141500 -- (-395.942) [-395.879] (-397.902) (-395.787) * [-396.285] (-395.132) (-395.259) (-395.593) -- 0:00:54
142000 -- (-400.888) [-398.558] (-396.883) (-394.878) * (-402.010) (-396.079) (-394.775) [-395.243] -- 0:00:54
142500 -- (-395.878) (-398.263) [-396.005] (-395.184) * (-395.255) (-395.670) (-395.917) [-394.210] -- 0:00:54
143000 -- (-394.453) [-396.724] (-396.972) (-396.063) * (-398.844) (-395.609) [-396.158] (-394.798) -- 0:00:53
143500 -- (-398.640) [-395.573] (-394.884) (-396.202) * (-395.825) (-404.210) [-397.417] (-394.975) -- 0:00:53
144000 -- (-397.606) [-395.645] (-394.390) (-397.550) * (-397.902) (-396.996) [-398.419] (-394.521) -- 0:00:53
144500 -- (-399.576) (-395.372) [-396.151] (-396.269) * [-395.701] (-396.711) (-394.067) (-397.268) -- 0:00:53
145000 -- (-396.233) [-395.380] (-399.362) (-398.627) * (-395.252) [-394.282] (-398.508) (-396.558) -- 0:00:53
Average standard deviation of split frequencies: 0.019680
145500 -- (-395.039) (-395.968) [-395.314] (-397.596) * [-395.831] (-394.206) (-398.421) (-398.064) -- 0:00:52
146000 -- (-395.485) (-398.240) [-395.354] (-397.478) * (-395.751) [-395.784] (-394.919) (-394.735) -- 0:00:52
146500 -- (-394.814) [-395.113] (-395.776) (-394.918) * [-400.576] (-399.280) (-395.742) (-396.023) -- 0:00:52
147000 -- (-395.450) (-397.081) (-394.917) [-396.337] * (-401.291) (-395.993) [-394.834] (-394.804) -- 0:00:52
147500 -- (-396.088) (-399.669) (-394.568) [-395.013] * (-396.406) (-395.548) (-397.505) [-395.805] -- 0:00:52
148000 -- [-398.058] (-396.051) (-399.930) (-396.241) * [-396.587] (-396.004) (-396.222) (-395.187) -- 0:00:51
148500 -- (-396.110) [-394.975] (-395.942) (-394.358) * (-396.244) (-397.034) [-394.358] (-399.173) -- 0:00:51
149000 -- (-395.195) (-396.857) (-394.251) [-396.804] * (-395.253) [-395.161] (-396.251) (-400.001) -- 0:00:51
149500 -- (-396.137) [-397.555] (-395.263) (-395.608) * (-397.297) (-396.689) [-397.844] (-397.319) -- 0:00:51
150000 -- (-396.660) (-396.092) (-396.729) [-396.505] * (-395.417) (-396.105) (-397.113) [-398.410] -- 0:00:51
Average standard deviation of split frequencies: 0.019086
150500 -- [-394.399] (-398.950) (-399.210) (-396.587) * (-395.460) (-395.233) [-396.933] (-395.057) -- 0:00:56
151000 -- (-395.277) [-398.154] (-394.592) (-400.909) * (-398.103) (-394.509) (-394.113) [-394.693] -- 0:00:56
151500 -- [-394.772] (-396.766) (-396.599) (-400.467) * [-395.712] (-401.571) (-395.581) (-395.120) -- 0:00:56
152000 -- [-399.334] (-394.784) (-395.144) (-397.874) * (-394.409) (-397.720) (-400.620) [-395.559] -- 0:00:55
152500 -- (-395.533) (-398.990) [-395.481] (-396.300) * (-399.172) (-396.682) [-394.536] (-397.723) -- 0:00:55
153000 -- (-397.748) (-394.900) [-396.763] (-394.668) * (-395.853) (-399.436) (-397.809) [-397.071] -- 0:00:55
153500 -- (-402.139) [-394.391] (-394.544) (-397.204) * (-398.287) (-398.132) [-396.200] (-397.320) -- 0:00:55
154000 -- (-398.902) (-396.859) [-394.703] (-394.807) * (-397.446) (-395.280) (-396.587) [-396.653] -- 0:00:54
154500 -- (-397.297) (-397.194) [-395.371] (-399.068) * (-395.359) [-397.702] (-394.873) (-394.944) -- 0:00:54
155000 -- [-395.450] (-397.218) (-396.011) (-398.397) * (-399.584) (-397.556) [-394.601] (-396.728) -- 0:00:54
Average standard deviation of split frequencies: 0.018433
155500 -- [-395.178] (-398.232) (-397.961) (-395.062) * (-395.420) (-399.935) [-396.319] (-395.576) -- 0:00:54
156000 -- [-394.794] (-400.508) (-397.331) (-398.452) * [-395.839] (-400.660) (-396.294) (-394.808) -- 0:00:54
156500 -- (-396.183) (-403.015) (-403.875) [-396.513] * (-395.528) [-396.497] (-395.338) (-395.650) -- 0:00:53
157000 -- (-398.776) (-404.616) (-395.068) [-397.061] * [-394.774] (-397.798) (-400.084) (-398.335) -- 0:00:53
157500 -- (-400.137) [-399.777] (-397.396) (-398.990) * (-394.602) (-397.219) [-396.598] (-397.717) -- 0:00:53
158000 -- (-395.251) [-397.611] (-396.314) (-395.570) * [-395.348] (-396.333) (-395.674) (-395.105) -- 0:00:53
158500 -- [-394.773] (-394.639) (-396.605) (-398.438) * (-398.131) (-397.682) [-396.134] (-394.376) -- 0:00:53
159000 -- (-397.537) [-395.709] (-397.186) (-399.496) * [-396.631] (-397.897) (-395.290) (-397.213) -- 0:00:52
159500 -- [-394.780] (-396.432) (-396.512) (-396.352) * (-397.230) (-395.917) (-396.193) [-397.469] -- 0:00:52
160000 -- (-397.623) (-398.350) (-398.034) [-394.754] * (-396.463) (-397.772) (-397.034) [-396.997] -- 0:00:52
Average standard deviation of split frequencies: 0.018925
160500 -- [-396.284] (-396.033) (-396.522) (-395.083) * [-397.211] (-394.743) (-394.566) (-394.772) -- 0:00:52
161000 -- (-397.558) (-401.917) [-394.969] (-395.177) * (-395.187) [-398.920] (-400.904) (-394.648) -- 0:00:52
161500 -- [-400.619] (-398.742) (-395.332) (-396.527) * (-398.192) (-395.429) (-399.687) [-395.292] -- 0:00:51
162000 -- (-395.377) (-397.274) [-397.246] (-397.150) * (-399.300) (-396.229) (-395.910) [-397.734] -- 0:00:51
162500 -- (-397.850) [-395.083] (-394.556) (-398.767) * (-397.688) [-394.141] (-397.601) (-398.992) -- 0:00:51
163000 -- [-396.198] (-394.875) (-398.149) (-395.955) * (-398.327) [-397.598] (-399.383) (-399.476) -- 0:00:51
163500 -- (-396.178) (-397.119) [-397.214] (-395.779) * (-401.240) (-397.617) (-398.676) [-401.917] -- 0:00:51
164000 -- (-399.304) (-396.690) (-397.003) [-396.894] * [-397.648] (-397.064) (-396.724) (-396.800) -- 0:00:50
164500 -- [-396.400] (-395.807) (-396.205) (-396.642) * (-398.775) (-394.810) [-395.859] (-398.077) -- 0:00:50
165000 -- (-397.288) (-395.461) (-398.221) [-399.692] * (-397.237) (-395.734) (-398.441) [-394.422] -- 0:00:50
Average standard deviation of split frequencies: 0.018175
165500 -- [-394.179] (-396.471) (-396.182) (-395.173) * [-395.565] (-396.141) (-396.978) (-394.417) -- 0:00:50
166000 -- [-394.221] (-394.441) (-395.376) (-398.872) * (-401.841) (-396.655) (-396.731) [-394.184] -- 0:00:50
166500 -- [-396.098] (-396.865) (-395.211) (-399.775) * (-396.332) (-396.057) (-396.874) [-394.916] -- 0:00:50
167000 -- (-399.501) (-394.406) (-394.200) [-397.398] * (-395.950) (-404.177) (-395.281) [-395.587] -- 0:00:54
167500 -- (-396.578) (-397.004) [-394.480] (-394.455) * [-396.836] (-395.483) (-395.974) (-395.996) -- 0:00:54
168000 -- (-396.703) (-394.804) [-396.478] (-395.527) * [-396.048] (-395.803) (-395.228) (-395.608) -- 0:00:54
168500 -- (-401.550) (-395.228) (-396.060) [-396.677] * (-394.902) [-395.302] (-395.548) (-396.084) -- 0:00:54
169000 -- [-395.419] (-397.184) (-394.182) (-396.081) * (-395.512) (-398.393) [-396.648] (-401.372) -- 0:00:54
169500 -- (-395.469) (-394.871) (-394.430) [-395.141] * (-397.181) [-396.362] (-400.355) (-398.430) -- 0:00:53
170000 -- [-396.360] (-395.354) (-396.093) (-395.543) * (-397.063) (-398.369) (-398.070) [-395.321] -- 0:00:53
Average standard deviation of split frequencies: 0.017678
170500 -- (-397.682) (-394.802) [-397.549] (-397.451) * (-394.955) (-404.758) (-398.568) [-394.624] -- 0:00:53
171000 -- (-402.752) (-395.004) [-394.793] (-399.284) * [-395.529] (-396.081) (-395.615) (-395.059) -- 0:00:53
171500 -- (-400.094) [-394.895] (-395.836) (-396.528) * [-397.802] (-400.172) (-397.705) (-397.543) -- 0:00:53
172000 -- (-398.685) (-395.380) [-399.612] (-397.327) * (-398.981) [-398.166] (-397.138) (-396.251) -- 0:00:52
172500 -- (-396.175) (-394.597) (-402.968) [-394.570] * [-395.274] (-397.476) (-395.033) (-397.898) -- 0:00:52
173000 -- (-398.910) (-396.273) (-398.856) [-395.561] * (-396.399) (-399.510) (-395.131) [-397.981] -- 0:00:52
173500 -- (-397.605) (-398.835) (-397.316) [-395.482] * (-397.571) (-396.943) (-400.309) [-395.447] -- 0:00:52
174000 -- (-394.989) (-395.315) (-396.939) [-395.078] * [-394.815] (-398.675) (-394.078) (-394.894) -- 0:00:52
174500 -- (-400.100) (-395.438) (-397.169) [-397.401] * (-395.144) (-397.279) [-395.794] (-394.887) -- 0:00:52
175000 -- [-399.392] (-396.070) (-396.868) (-398.851) * (-396.135) (-396.773) (-398.237) [-396.045] -- 0:00:51
Average standard deviation of split frequencies: 0.017276
175500 -- (-394.651) (-397.734) (-398.510) [-394.979] * (-394.353) (-395.668) (-402.015) [-398.177] -- 0:00:51
176000 -- (-399.321) [-397.598] (-396.643) (-395.075) * (-395.260) (-394.773) (-396.386) [-394.776] -- 0:00:51
176500 -- (-396.101) (-398.737) [-396.487] (-395.204) * (-403.135) (-395.120) [-394.151] (-396.008) -- 0:00:51
177000 -- (-395.429) [-397.950] (-394.831) (-397.431) * (-395.259) (-398.051) (-399.754) [-395.345] -- 0:00:51
177500 -- (-396.213) (-397.258) (-395.987) [-397.116] * (-395.005) (-397.013) (-399.046) [-394.756] -- 0:00:50
178000 -- (-395.584) (-396.698) [-396.796] (-394.413) * (-395.565) (-395.608) [-396.199] (-394.612) -- 0:00:50
178500 -- (-395.982) [-398.335] (-397.662) (-397.889) * (-394.820) [-398.167] (-395.332) (-398.494) -- 0:00:50
179000 -- (-396.578) [-394.603] (-395.564) (-396.309) * (-397.174) [-395.091] (-398.788) (-395.559) -- 0:00:50
179500 -- (-395.790) (-397.826) (-394.274) [-396.934] * (-395.985) [-400.591] (-401.454) (-397.776) -- 0:00:50
180000 -- [-398.257] (-395.606) (-398.370) (-398.464) * (-395.733) [-395.678] (-395.035) (-395.718) -- 0:00:50
Average standard deviation of split frequencies: 0.017221
180500 -- [-395.718] (-399.815) (-396.414) (-397.205) * [-395.925] (-395.863) (-395.957) (-399.090) -- 0:00:49
181000 -- (-395.815) (-395.548) (-395.786) [-398.664] * [-395.344] (-397.691) (-394.540) (-395.049) -- 0:00:49
181500 -- [-395.971] (-395.276) (-396.040) (-396.832) * (-398.278) [-396.882] (-394.628) (-396.861) -- 0:00:49
182000 -- [-394.989] (-396.293) (-394.346) (-395.269) * (-397.936) (-394.861) (-398.848) [-396.312] -- 0:00:49
182500 -- (-395.054) (-396.979) [-395.864] (-395.111) * (-396.541) [-394.473] (-396.681) (-396.796) -- 0:00:49
183000 -- (-396.897) (-396.603) [-394.268] (-402.669) * [-396.189] (-395.354) (-394.886) (-394.651) -- 0:00:49
183500 -- (-398.004) (-394.808) [-396.085] (-395.618) * (-397.281) [-397.293] (-398.186) (-400.191) -- 0:00:48
184000 -- (-396.599) (-395.271) (-394.557) [-395.150] * (-396.678) (-394.573) (-396.326) [-395.684] -- 0:00:53
184500 -- (-399.070) (-398.754) [-397.355] (-398.188) * (-398.215) [-395.652] (-395.268) (-401.971) -- 0:00:53
185000 -- (-393.972) (-395.257) [-394.909] (-395.717) * [-397.197] (-394.729) (-397.539) (-404.282) -- 0:00:52
Average standard deviation of split frequencies: 0.017107
185500 -- (-395.129) (-397.493) [-394.353] (-396.034) * (-395.414) [-395.017] (-399.975) (-401.779) -- 0:00:52
186000 -- (-396.741) (-397.130) (-395.019) [-395.743] * (-394.942) [-395.156] (-395.288) (-403.351) -- 0:00:52
186500 -- (-394.995) (-397.767) (-396.683) [-397.182] * (-394.912) (-397.041) (-395.791) [-399.338] -- 0:00:52
187000 -- (-396.361) (-395.306) (-394.896) [-395.782] * [-399.708] (-397.476) (-398.153) (-397.420) -- 0:00:52
187500 -- [-396.841] (-395.734) (-395.124) (-394.408) * (-399.020) (-395.527) (-395.948) [-398.243] -- 0:00:52
188000 -- (-398.327) (-399.702) (-398.550) [-396.617] * [-398.229] (-396.191) (-395.469) (-398.105) -- 0:00:51
188500 -- (-395.155) (-398.483) (-397.691) [-399.202] * [-397.532] (-398.111) (-398.245) (-397.276) -- 0:00:51
189000 -- (-395.893) [-395.695] (-395.488) (-397.220) * (-394.893) [-395.403] (-396.094) (-394.738) -- 0:00:51
189500 -- (-396.053) [-397.131] (-398.434) (-396.389) * (-396.744) (-396.516) (-395.300) [-395.593] -- 0:00:51
190000 -- (-396.230) (-396.723) (-396.787) [-399.888] * (-396.821) (-395.774) (-396.881) [-395.471] -- 0:00:51
Average standard deviation of split frequencies: 0.016194
190500 -- (-400.865) (-395.010) (-394.490) [-401.202] * (-396.079) (-395.124) (-396.954) [-394.922] -- 0:00:50
191000 -- [-396.254] (-398.032) (-395.781) (-397.212) * (-394.875) [-395.698] (-396.246) (-397.539) -- 0:00:50
191500 -- (-396.630) (-395.811) (-396.679) [-397.762] * (-395.408) (-394.400) (-398.006) [-394.345] -- 0:00:50
192000 -- [-397.411] (-396.967) (-398.430) (-399.195) * (-397.078) [-394.982] (-398.753) (-394.407) -- 0:00:50
192500 -- (-397.101) (-395.820) [-395.407] (-396.039) * (-397.711) (-395.609) (-397.235) [-395.434] -- 0:00:50
193000 -- (-396.231) (-396.618) [-395.175] (-398.977) * (-399.522) (-396.056) [-396.640] (-396.144) -- 0:00:50
193500 -- (-395.179) [-396.706] (-395.559) (-395.292) * (-397.885) (-397.844) [-394.544] (-396.286) -- 0:00:50
194000 -- [-394.919] (-399.057) (-398.983) (-398.073) * (-394.367) (-397.013) (-396.836) [-394.583] -- 0:00:49
194500 -- [-397.207] (-396.544) (-396.397) (-396.014) * (-394.702) (-394.416) (-396.269) [-397.440] -- 0:00:49
195000 -- (-396.744) [-396.660] (-395.573) (-395.244) * (-397.587) (-395.618) (-397.682) [-397.745] -- 0:00:49
Average standard deviation of split frequencies: 0.015950
195500 -- (-395.409) [-397.637] (-397.263) (-398.163) * (-397.874) [-396.300] (-402.433) (-396.827) -- 0:00:49
196000 -- (-401.985) [-395.336] (-403.374) (-395.916) * (-397.139) [-398.315] (-399.981) (-398.282) -- 0:00:49
196500 -- (-396.348) (-395.562) [-395.372] (-395.322) * (-396.643) (-398.397) [-395.068] (-396.210) -- 0:00:49
197000 -- (-395.424) (-394.450) [-398.863] (-395.695) * (-398.599) (-394.810) [-394.753] (-397.346) -- 0:00:48
197500 -- [-395.561] (-396.284) (-397.736) (-394.930) * [-395.665] (-394.012) (-395.787) (-398.384) -- 0:00:48
198000 -- (-398.820) [-396.032] (-394.818) (-401.060) * (-398.826) (-399.178) (-396.364) [-396.653] -- 0:00:48
198500 -- (-397.755) (-396.870) [-396.534] (-397.620) * (-395.125) (-396.474) (-394.835) [-394.489] -- 0:00:48
199000 -- (-396.860) [-394.733] (-397.977) (-399.736) * (-396.205) [-396.007] (-395.960) (-395.295) -- 0:00:48
199500 -- [-395.701] (-394.914) (-398.118) (-397.923) * (-395.143) (-396.581) [-400.066] (-396.973) -- 0:00:48
200000 -- (-395.822) [-397.104] (-397.349) (-395.251) * (-395.732) (-399.194) [-398.489] (-397.875) -- 0:00:48
Average standard deviation of split frequencies: 0.016939
200500 -- (-396.817) (-397.642) [-395.228] (-394.941) * (-396.696) (-401.226) (-397.707) [-394.857] -- 0:00:51
201000 -- (-397.296) [-397.547] (-395.243) (-395.892) * (-394.675) (-397.392) [-396.737] (-396.176) -- 0:00:51
201500 -- (-398.011) (-394.479) (-397.192) [-394.963] * (-395.841) (-395.771) [-395.855] (-394.763) -- 0:00:51
202000 -- [-397.356] (-394.114) (-397.181) (-396.506) * (-398.049) (-398.049) [-397.025] (-399.402) -- 0:00:51
202500 -- [-398.499] (-398.040) (-394.157) (-395.948) * (-398.495) [-396.433] (-394.255) (-396.148) -- 0:00:51
203000 -- [-398.008] (-396.193) (-397.173) (-397.223) * (-397.453) (-397.520) (-398.533) [-395.865] -- 0:00:51
203500 -- [-394.685] (-395.447) (-395.068) (-401.311) * (-395.260) (-397.513) [-397.398] (-398.986) -- 0:00:50
204000 -- (-395.761) (-395.739) [-394.416] (-394.770) * [-397.344] (-396.151) (-394.298) (-394.202) -- 0:00:50
204500 -- (-398.487) (-396.342) (-396.194) [-394.090] * [-395.500] (-397.779) (-396.756) (-397.259) -- 0:00:50
205000 -- (-395.137) (-400.337) [-398.206] (-395.968) * (-396.091) (-398.635) (-396.919) [-398.093] -- 0:00:50
Average standard deviation of split frequencies: 0.015447
205500 -- (-395.641) [-398.267] (-396.901) (-397.620) * (-398.491) (-399.253) [-394.355] (-394.882) -- 0:00:50
206000 -- (-396.584) (-397.813) (-396.431) [-399.829] * (-398.730) (-397.996) (-397.433) [-399.491] -- 0:00:50
206500 -- (-395.275) (-394.685) (-396.994) [-395.441] * (-395.725) (-395.145) (-398.890) [-394.751] -- 0:00:49
207000 -- (-395.170) (-394.423) [-396.342] (-395.634) * (-395.875) [-396.166] (-398.121) (-394.918) -- 0:00:49
207500 -- [-394.488] (-400.175) (-394.804) (-396.348) * (-396.261) (-399.911) (-394.980) [-395.236] -- 0:00:49
208000 -- (-398.027) (-394.984) (-398.293) [-398.261] * (-395.233) (-395.786) (-394.339) [-399.261] -- 0:00:49
208500 -- (-395.856) [-397.291] (-397.146) (-396.574) * (-398.029) [-397.194] (-397.682) (-399.522) -- 0:00:49
209000 -- (-396.044) (-399.789) [-398.104] (-402.919) * (-394.631) (-396.782) (-394.993) [-395.135] -- 0:00:49
209500 -- (-396.308) (-396.243) (-396.536) [-396.063] * (-395.271) (-396.105) (-396.993) [-396.371] -- 0:00:49
210000 -- (-394.215) (-397.852) (-394.184) [-401.096] * (-397.814) [-396.873] (-397.786) (-394.369) -- 0:00:48
Average standard deviation of split frequencies: 0.016253
210500 -- (-399.541) (-396.405) [-398.431] (-397.898) * (-397.267) (-396.370) (-396.576) [-396.367] -- 0:00:48
211000 -- (-397.813) (-396.877) [-394.990] (-396.893) * [-396.950] (-394.628) (-396.575) (-395.614) -- 0:00:48
211500 -- (-403.650) (-395.140) (-396.761) [-400.478] * (-395.649) [-394.345] (-399.664) (-396.914) -- 0:00:48
212000 -- (-396.066) [-395.237] (-396.121) (-397.935) * (-395.632) (-394.892) (-397.122) [-397.149] -- 0:00:48
212500 -- [-394.677] (-403.379) (-394.236) (-397.572) * (-402.151) (-398.238) (-396.808) [-396.212] -- 0:00:48
213000 -- (-395.500) [-397.049] (-400.290) (-396.142) * (-399.781) (-400.039) (-399.757) [-394.775] -- 0:00:48
213500 -- (-395.438) [-398.567] (-397.736) (-394.285) * (-403.199) [-394.587] (-396.597) (-396.285) -- 0:00:47
214000 -- (-398.173) (-401.251) [-396.591] (-395.393) * (-397.666) (-395.842) (-398.455) [-395.695] -- 0:00:47
214500 -- (-398.719) (-395.365) (-400.010) [-395.353] * (-397.508) [-401.023] (-394.888) (-396.890) -- 0:00:47
215000 -- (-397.955) (-394.904) (-395.866) [-396.236] * (-395.449) (-398.959) [-395.637] (-396.812) -- 0:00:47
Average standard deviation of split frequencies: 0.015059
215500 -- [-396.890] (-394.696) (-397.161) (-396.015) * (-397.069) (-399.997) [-397.144] (-396.628) -- 0:00:47
216000 -- (-398.000) [-394.860] (-396.286) (-395.417) * (-398.361) (-397.972) [-396.741] (-398.020) -- 0:00:47
216500 -- (-395.727) (-395.871) (-395.352) [-397.155] * (-394.880) (-395.379) [-395.819] (-400.681) -- 0:00:47
217000 -- (-400.664) (-396.725) (-402.757) [-397.292] * [-395.049] (-399.048) (-396.928) (-396.104) -- 0:00:50
217500 -- (-398.487) (-396.140) [-396.002] (-397.115) * (-395.913) [-395.576] (-396.952) (-394.993) -- 0:00:50
218000 -- (-395.584) [-394.468] (-398.551) (-396.271) * (-395.121) [-394.134] (-397.565) (-401.179) -- 0:00:50
218500 -- (-396.198) [-394.264] (-394.929) (-397.154) * (-394.770) [-394.398] (-394.935) (-395.803) -- 0:00:50
219000 -- (-395.362) (-397.252) (-398.500) [-397.093] * (-396.463) (-398.236) [-396.157] (-394.839) -- 0:00:49
219500 -- (-394.526) (-395.595) (-396.884) [-396.561] * (-396.597) (-396.918) [-396.748] (-394.126) -- 0:00:49
220000 -- [-395.966] (-396.455) (-394.728) (-401.671) * (-396.266) (-396.306) (-398.030) [-395.145] -- 0:00:49
Average standard deviation of split frequencies: 0.015274
220500 -- (-400.637) (-396.072) [-395.282] (-397.834) * [-398.783] (-396.175) (-397.496) (-395.413) -- 0:00:49
221000 -- (-397.301) (-395.783) (-396.958) [-394.622] * (-399.586) (-399.444) (-397.113) [-396.636] -- 0:00:49
221500 -- [-396.411] (-395.303) (-398.061) (-397.831) * (-398.356) (-395.188) [-398.304] (-397.384) -- 0:00:49
222000 -- (-394.888) (-397.423) (-395.772) [-394.699] * [-394.503] (-395.750) (-395.045) (-401.832) -- 0:00:49
222500 -- (-395.322) (-395.612) (-404.163) [-395.355] * (-395.965) (-396.748) [-395.541] (-403.831) -- 0:00:48
223000 -- (-394.718) (-397.894) (-408.603) [-396.501] * (-397.300) (-396.609) [-396.907] (-397.689) -- 0:00:48
223500 -- (-395.927) (-394.606) (-405.039) [-395.017] * (-395.406) [-398.685] (-395.755) (-398.320) -- 0:00:48
224000 -- (-399.764) (-394.900) (-394.941) [-395.533] * (-396.048) [-396.648] (-394.154) (-395.132) -- 0:00:48
224500 -- (-397.710) (-396.073) [-395.434] (-394.572) * [-398.276] (-396.459) (-394.291) (-394.626) -- 0:00:48
225000 -- (-396.350) (-396.643) (-396.704) [-394.038] * (-399.144) (-395.031) [-394.845] (-396.276) -- 0:00:48
Average standard deviation of split frequencies: 0.014810
225500 -- [-398.025] (-398.384) (-395.424) (-395.037) * [-396.718] (-395.360) (-396.673) (-397.515) -- 0:00:48
226000 -- (-395.915) [-395.067] (-395.378) (-395.216) * (-395.499) [-395.680] (-397.150) (-395.970) -- 0:00:47
226500 -- (-397.468) (-398.099) (-396.802) [-394.802] * (-394.848) (-394.760) (-396.313) [-394.637] -- 0:00:47
227000 -- (-396.224) (-397.622) [-397.690] (-394.642) * (-394.567) [-395.703] (-397.057) (-398.802) -- 0:00:47
227500 -- (-395.184) (-400.007) (-395.557) [-394.620] * [-398.363] (-400.529) (-394.819) (-397.732) -- 0:00:47
228000 -- (-396.560) [-400.893] (-394.593) (-396.893) * (-396.669) (-394.464) [-398.141] (-395.377) -- 0:00:47
228500 -- (-396.516) (-397.609) (-398.998) [-394.314] * (-397.508) (-394.679) (-395.844) [-395.956] -- 0:00:47
229000 -- [-398.002] (-394.435) (-396.334) (-394.631) * [-394.758] (-396.771) (-396.517) (-396.075) -- 0:00:47
229500 -- [-394.600] (-395.509) (-396.518) (-395.585) * [-394.467] (-402.114) (-396.723) (-396.102) -- 0:00:47
230000 -- [-397.426] (-396.035) (-395.870) (-395.922) * (-394.463) (-399.095) [-398.474] (-396.603) -- 0:00:46
Average standard deviation of split frequencies: 0.014079
230500 -- (-395.179) (-395.973) [-396.159] (-397.281) * (-399.253) [-395.456] (-396.828) (-396.072) -- 0:00:46
231000 -- [-397.019] (-394.437) (-396.647) (-396.018) * (-396.616) (-396.053) (-400.155) [-400.928] -- 0:00:46
231500 -- (-394.907) [-395.404] (-396.226) (-395.335) * (-396.305) (-394.157) [-400.436] (-395.583) -- 0:00:46
232000 -- (-397.796) (-402.653) (-397.767) [-394.868] * [-397.752] (-394.361) (-395.449) (-397.781) -- 0:00:46
232500 -- [-395.579] (-396.976) (-397.611) (-397.075) * [-396.083] (-394.228) (-397.177) (-397.452) -- 0:00:46
233000 -- (-395.443) (-394.788) (-395.340) [-394.712] * (-395.625) (-397.999) (-396.688) [-397.376] -- 0:00:46
233500 -- (-395.549) [-395.680] (-396.696) (-399.400) * (-395.041) (-399.229) [-398.339] (-395.946) -- 0:00:49
234000 -- (-394.916) [-396.014] (-401.708) (-397.230) * (-394.713) (-398.125) [-400.404] (-395.327) -- 0:00:49
234500 -- [-397.255] (-398.680) (-394.692) (-396.170) * (-396.271) [-396.549] (-397.546) (-395.894) -- 0:00:48
235000 -- (-396.084) [-395.657] (-396.684) (-398.470) * (-397.293) (-397.993) (-394.305) [-394.929] -- 0:00:48
Average standard deviation of split frequencies: 0.013871
235500 -- (-397.043) (-397.093) (-398.024) [-394.750] * (-400.644) (-402.338) (-395.822) [-396.243] -- 0:00:48
236000 -- (-402.803) (-396.546) [-395.718] (-398.579) * (-397.241) [-396.514] (-397.512) (-396.050) -- 0:00:48
236500 -- (-401.328) (-397.919) [-395.086] (-398.839) * (-395.752) (-398.333) [-395.734] (-402.094) -- 0:00:48
237000 -- (-397.863) (-397.141) [-394.790] (-395.645) * (-396.723) (-397.460) (-399.081) [-401.023] -- 0:00:48
237500 -- (-396.982) (-397.751) [-396.682] (-396.495) * (-395.557) (-397.794) (-394.478) [-397.421] -- 0:00:48
238000 -- (-396.448) (-396.255) [-398.834] (-394.724) * (-397.189) [-395.946] (-394.953) (-395.692) -- 0:00:48
238500 -- (-395.225) (-397.062) [-397.050] (-397.570) * (-398.370) (-400.240) (-395.638) [-395.430] -- 0:00:47
239000 -- (-396.366) [-400.884] (-396.910) (-399.808) * [-397.049] (-399.116) (-395.732) (-395.559) -- 0:00:47
239500 -- [-397.227] (-396.518) (-397.675) (-395.509) * [-395.575] (-397.210) (-395.567) (-395.887) -- 0:00:47
240000 -- (-400.611) [-396.659] (-398.254) (-396.323) * [-397.290] (-396.888) (-394.282) (-395.931) -- 0:00:47
Average standard deviation of split frequencies: 0.014473
240500 -- [-395.214] (-396.205) (-397.116) (-395.621) * (-395.903) (-399.776) [-396.774] (-395.417) -- 0:00:47
241000 -- (-397.056) [-400.303] (-395.108) (-396.952) * (-397.691) (-396.264) [-397.941] (-396.314) -- 0:00:47
241500 -- (-395.421) (-394.760) [-396.628] (-395.145) * (-395.119) (-395.507) [-395.931] (-398.073) -- 0:00:47
242000 -- (-395.778) (-395.483) [-398.971] (-397.256) * (-398.214) (-399.889) [-395.148] (-396.102) -- 0:00:46
242500 -- [-395.750] (-402.609) (-397.471) (-401.988) * (-396.630) (-398.865) [-395.527] (-397.665) -- 0:00:46
243000 -- (-395.741) (-401.054) (-396.549) [-394.987] * [-396.996] (-397.753) (-396.798) (-395.374) -- 0:00:46
243500 -- (-396.299) (-400.096) (-396.536) [-401.494] * (-394.153) (-397.078) (-399.122) [-394.815] -- 0:00:46
244000 -- (-394.792) (-395.754) (-397.712) [-399.593] * [-396.426] (-396.162) (-397.081) (-395.596) -- 0:00:46
244500 -- (-394.513) (-397.650) [-395.819] (-397.195) * (-396.487) [-396.597] (-395.045) (-401.074) -- 0:00:46
245000 -- (-398.021) (-397.239) [-395.749] (-395.484) * [-396.542] (-408.110) (-398.849) (-395.943) -- 0:00:46
Average standard deviation of split frequencies: 0.013414
245500 -- (-399.424) (-394.451) [-399.562] (-394.910) * (-397.107) (-399.057) (-398.152) [-395.554] -- 0:00:46
246000 -- (-400.206) [-399.387] (-396.840) (-395.325) * (-397.073) (-396.397) (-399.626) [-395.981] -- 0:00:45
246500 -- [-397.304] (-399.332) (-399.161) (-396.228) * [-395.210] (-397.946) (-396.658) (-396.266) -- 0:00:45
247000 -- [-397.046] (-395.993) (-398.044) (-396.838) * (-396.526) (-399.267) (-397.361) [-398.751] -- 0:00:45
247500 -- [-398.497] (-395.719) (-397.597) (-395.761) * (-397.029) (-397.811) (-394.601) [-395.927] -- 0:00:45
248000 -- (-395.407) (-396.985) (-396.938) [-396.238] * (-397.306) [-395.686] (-395.974) (-397.026) -- 0:00:45
248500 -- [-397.228] (-397.115) (-396.032) (-396.554) * [-397.197] (-396.047) (-396.249) (-396.182) -- 0:00:45
249000 -- [-395.473] (-402.877) (-395.779) (-396.286) * (-395.643) (-395.944) [-397.772] (-395.959) -- 0:00:45
249500 -- [-395.708] (-396.081) (-395.203) (-396.106) * (-401.402) (-395.353) (-397.798) [-398.709] -- 0:00:45
250000 -- (-396.025) [-401.733] (-396.800) (-396.766) * (-397.071) (-395.126) (-401.482) [-400.356] -- 0:00:48
Average standard deviation of split frequencies: 0.012328
250500 -- (-397.173) (-394.908) [-394.605] (-397.825) * (-396.750) (-395.799) [-396.703] (-395.491) -- 0:00:47
251000 -- (-393.993) [-398.688] (-398.852) (-398.538) * (-396.520) [-395.645] (-396.662) (-394.394) -- 0:00:47
251500 -- [-394.681] (-397.081) (-397.473) (-396.193) * (-396.641) (-395.716) (-394.983) [-396.276] -- 0:00:47
252000 -- (-398.871) (-398.070) (-398.072) [-395.170] * (-396.751) [-397.873] (-396.868) (-396.241) -- 0:00:47
252500 -- (-394.756) (-397.101) (-396.409) [-395.704] * (-404.119) (-396.174) [-400.436] (-400.714) -- 0:00:47
253000 -- (-396.459) (-395.962) (-394.876) [-399.935] * [-395.942] (-395.940) (-398.464) (-395.362) -- 0:00:47
253500 -- (-397.576) (-401.001) [-395.742] (-396.488) * [-394.358] (-395.014) (-397.335) (-398.338) -- 0:00:47
254000 -- (-395.041) (-399.118) [-397.260] (-396.066) * (-396.629) [-395.013] (-395.845) (-398.324) -- 0:00:46
254500 -- (-394.588) (-397.122) (-395.383) [-396.622] * (-395.221) [-398.439] (-398.384) (-401.469) -- 0:00:46
255000 -- [-398.517] (-410.369) (-397.134) (-397.016) * [-396.685] (-397.383) (-394.671) (-397.507) -- 0:00:46
Average standard deviation of split frequencies: 0.012174
255500 -- [-396.655] (-404.959) (-396.443) (-397.538) * (-395.263) (-395.392) (-397.122) [-397.311] -- 0:00:46
256000 -- (-397.180) (-397.320) (-397.072) [-395.381] * (-397.272) (-395.969) [-395.052] (-403.400) -- 0:00:46
256500 -- [-401.126] (-396.294) (-400.368) (-397.069) * (-395.648) [-394.778] (-398.141) (-403.740) -- 0:00:46
257000 -- (-401.801) (-397.894) [-400.549] (-399.656) * (-397.037) (-397.071) (-395.927) [-397.167] -- 0:00:46
257500 -- (-399.679) (-395.701) [-394.915] (-395.079) * (-397.737) (-399.248) [-394.748] (-398.577) -- 0:00:46
258000 -- (-397.198) (-395.640) [-395.826] (-397.688) * (-394.764) [-397.221] (-395.980) (-395.602) -- 0:00:46
258500 -- [-395.651] (-400.171) (-396.110) (-396.956) * (-395.940) (-396.733) [-396.132] (-396.384) -- 0:00:45
259000 -- (-395.513) (-397.872) [-396.214] (-396.742) * (-396.479) (-395.774) (-397.766) [-395.080] -- 0:00:45
259500 -- (-396.576) (-398.668) (-396.096) [-396.549] * (-396.850) (-396.882) (-397.414) [-395.053] -- 0:00:45
260000 -- [-395.484] (-399.412) (-397.689) (-397.640) * [-400.064] (-396.928) (-399.856) (-396.347) -- 0:00:45
Average standard deviation of split frequencies: 0.011655
260500 -- (-396.794) (-395.919) (-398.598) [-401.378] * (-394.761) (-394.565) [-397.595] (-397.914) -- 0:00:45
261000 -- (-397.269) [-394.798] (-394.940) (-398.363) * (-394.977) (-394.745) (-398.992) [-394.942] -- 0:00:45
261500 -- (-397.923) [-394.191] (-397.266) (-394.815) * (-397.596) (-399.566) (-397.540) [-395.202] -- 0:00:45
262000 -- (-396.643) (-395.934) [-394.495] (-395.978) * [-394.833] (-397.116) (-397.789) (-398.015) -- 0:00:45
262500 -- (-396.826) (-395.473) [-394.054] (-395.422) * (-396.187) [-400.978] (-397.599) (-395.874) -- 0:00:44
263000 -- (-395.379) [-399.479] (-397.085) (-397.774) * [-395.490] (-395.783) (-395.482) (-396.331) -- 0:00:44
263500 -- (-397.003) (-398.211) (-398.601) [-397.951] * (-395.466) [-395.303] (-395.560) (-399.714) -- 0:00:44
264000 -- (-400.591) (-398.677) (-396.352) [-394.951] * (-396.839) [-395.428] (-396.251) (-398.291) -- 0:00:44
264500 -- (-402.996) (-395.873) (-398.644) [-395.788] * (-396.099) [-396.060] (-395.470) (-395.165) -- 0:00:44
265000 -- (-397.172) (-398.955) [-395.378] (-396.736) * (-396.547) [-396.099] (-395.756) (-398.014) -- 0:00:44
Average standard deviation of split frequencies: 0.012701
265500 -- (-397.689) (-399.137) [-399.576] (-394.959) * [-394.901] (-394.620) (-396.839) (-395.051) -- 0:00:44
266000 -- (-400.701) (-398.308) (-397.927) [-396.262] * (-397.480) [-396.032] (-396.284) (-396.147) -- 0:00:44
266500 -- (-401.651) [-396.326] (-397.547) (-395.411) * (-396.933) (-402.525) [-395.840] (-396.417) -- 0:00:46
267000 -- (-396.204) [-395.682] (-397.187) (-396.281) * [-394.970] (-397.421) (-396.524) (-398.911) -- 0:00:46
267500 -- (-395.054) [-394.770] (-398.149) (-396.251) * [-395.774] (-396.807) (-395.086) (-395.991) -- 0:00:46
268000 -- (-395.087) (-395.567) [-394.087] (-404.133) * (-397.955) (-400.861) (-395.354) [-395.447] -- 0:00:46
268500 -- [-395.805] (-401.372) (-394.100) (-401.362) * (-394.940) [-394.217] (-397.574) (-396.712) -- 0:00:46
269000 -- [-396.584] (-396.688) (-394.920) (-398.452) * (-399.281) (-394.504) [-397.418] (-394.716) -- 0:00:46
269500 -- (-399.109) [-398.636] (-398.071) (-395.013) * (-397.197) (-395.146) (-394.584) [-395.206] -- 0:00:46
270000 -- (-396.915) (-396.268) (-396.798) [-396.726] * (-396.945) (-397.066) [-397.468] (-401.261) -- 0:00:45
Average standard deviation of split frequencies: 0.011708
270500 -- (-397.205) (-396.575) (-396.433) [-395.567] * [-397.725] (-397.469) (-395.482) (-397.678) -- 0:00:45
271000 -- (-400.239) [-394.187] (-394.878) (-397.611) * [-396.651] (-397.472) (-395.413) (-396.329) -- 0:00:45
271500 -- [-400.781] (-395.435) (-395.672) (-396.163) * [-395.327] (-395.397) (-394.850) (-397.716) -- 0:00:45
272000 -- (-396.232) [-396.130] (-400.426) (-396.247) * (-398.606) (-396.925) [-395.624] (-395.903) -- 0:00:45
272500 -- (-395.169) (-396.552) [-398.551] (-397.657) * (-396.695) (-397.369) [-396.065] (-396.970) -- 0:00:45
273000 -- (-397.290) (-398.886) (-398.605) [-397.575] * (-395.630) (-394.984) (-397.133) [-395.598] -- 0:00:45
273500 -- (-395.983) (-395.778) (-394.462) [-399.054] * (-397.695) (-399.235) [-395.139] (-396.220) -- 0:00:45
274000 -- (-395.358) [-395.986] (-394.463) (-398.681) * [-395.501] (-395.449) (-394.797) (-397.491) -- 0:00:45
274500 -- (-395.390) [-394.977] (-394.772) (-402.512) * (-396.666) (-394.035) [-394.809] (-397.576) -- 0:00:44
275000 -- [-395.681] (-398.963) (-394.509) (-397.943) * [-395.456] (-395.525) (-399.077) (-394.965) -- 0:00:44
Average standard deviation of split frequencies: 0.010722
275500 -- (-396.874) (-397.489) (-395.735) [-396.930] * [-395.212] (-397.436) (-398.404) (-400.246) -- 0:00:44
276000 -- [-395.748] (-394.639) (-399.197) (-398.683) * (-394.065) [-396.389] (-394.954) (-399.429) -- 0:00:44
276500 -- (-396.498) [-399.556] (-397.581) (-395.327) * (-395.145) [-394.688] (-397.014) (-395.988) -- 0:00:44
277000 -- [-395.414] (-396.607) (-395.972) (-397.814) * (-398.470) [-395.143] (-395.454) (-396.718) -- 0:00:44
277500 -- [-394.344] (-395.467) (-398.578) (-402.346) * [-397.808] (-396.068) (-394.917) (-403.494) -- 0:00:44
278000 -- (-395.701) (-398.686) [-396.136] (-397.414) * (-396.104) (-397.069) [-396.492] (-397.372) -- 0:00:44
278500 -- [-396.261] (-399.797) (-396.901) (-395.274) * (-394.752) (-395.033) (-397.800) [-395.708] -- 0:00:44
279000 -- [-396.880] (-395.766) (-394.887) (-396.202) * (-394.424) (-396.281) [-398.188] (-395.663) -- 0:00:43
279500 -- (-396.416) (-396.561) (-394.897) [-395.308] * (-397.912) (-395.583) (-396.749) [-397.576] -- 0:00:43
280000 -- (-397.995) (-396.806) (-398.189) [-397.760] * (-395.401) [-396.461] (-398.323) (-398.716) -- 0:00:43
Average standard deviation of split frequencies: 0.010264
280500 -- (-396.451) (-395.183) [-398.734] (-396.634) * (-397.723) (-397.880) [-397.031] (-397.138) -- 0:00:43
281000 -- (-399.338) (-395.289) (-396.541) [-395.719] * [-394.777] (-399.193) (-395.354) (-395.788) -- 0:00:43
281500 -- (-396.613) [-395.335] (-398.119) (-399.365) * (-395.439) (-398.926) [-394.409] (-395.324) -- 0:00:43
282000 -- (-395.462) [-395.997] (-395.488) (-396.151) * (-396.693) (-396.501) [-396.220] (-399.346) -- 0:00:43
282500 -- (-394.933) [-394.232] (-395.147) (-396.315) * (-396.659) [-399.446] (-396.572) (-399.266) -- 0:00:43
283000 -- (-395.819) [-398.156] (-395.614) (-395.023) * (-398.736) (-395.955) (-395.895) [-398.940] -- 0:00:45
283500 -- (-394.695) (-394.693) [-395.003] (-396.701) * (-395.366) (-399.059) (-396.043) [-394.695] -- 0:00:45
284000 -- (-395.234) (-399.125) [-396.403] (-397.085) * (-396.057) (-394.632) [-394.304] (-395.753) -- 0:00:45
284500 -- (-396.886) (-399.859) [-396.440] (-396.151) * (-397.005) (-395.033) [-397.414] (-396.815) -- 0:00:45
285000 -- (-395.520) [-397.522] (-396.480) (-396.470) * [-395.498] (-396.267) (-395.036) (-399.881) -- 0:00:45
Average standard deviation of split frequencies: 0.008608
285500 -- (-395.371) (-394.276) (-397.191) [-395.687] * [-395.036] (-395.041) (-394.819) (-396.167) -- 0:00:45
286000 -- (-395.467) (-394.929) (-395.176) [-394.954] * (-396.283) [-396.828] (-398.523) (-394.938) -- 0:00:44
286500 -- (-397.633) [-394.284] (-396.083) (-396.836) * (-396.450) (-395.716) [-395.312] (-394.631) -- 0:00:44
287000 -- (-395.636) [-396.669] (-398.411) (-395.371) * (-394.358) (-397.095) (-395.049) [-395.145] -- 0:00:44
287500 -- (-396.752) (-396.704) (-394.706) [-395.138] * (-400.518) (-396.993) [-399.033] (-398.447) -- 0:00:44
288000 -- (-399.011) [-394.971] (-404.184) (-403.271) * [-395.449] (-394.870) (-399.030) (-399.358) -- 0:00:44
288500 -- (-398.129) [-395.998] (-397.426) (-395.434) * (-398.214) (-394.471) [-396.370] (-399.644) -- 0:00:44
289000 -- (-397.942) [-396.386] (-398.994) (-394.797) * (-394.729) (-395.949) (-397.502) [-395.615] -- 0:00:44
289500 -- (-394.226) (-395.898) (-396.243) [-395.346] * (-394.448) [-395.210] (-397.374) (-398.834) -- 0:00:44
290000 -- (-397.275) (-396.651) [-395.175] (-396.664) * [-396.987] (-399.052) (-397.099) (-396.873) -- 0:00:44
Average standard deviation of split frequencies: 0.007749
290500 -- (-397.218) [-394.513] (-397.382) (-396.357) * (-395.581) (-397.363) [-394.487] (-399.997) -- 0:00:43
291000 -- (-398.704) (-394.871) (-397.297) [-397.235] * [-397.576] (-394.072) (-397.383) (-397.234) -- 0:00:43
291500 -- (-395.836) (-396.159) (-399.181) [-395.517] * [-395.636] (-395.477) (-394.810) (-397.023) -- 0:00:43
292000 -- (-397.989) (-396.285) (-394.541) [-394.879] * (-396.797) [-395.413] (-397.615) (-396.125) -- 0:00:43
292500 -- [-395.175] (-395.596) (-395.048) (-401.045) * (-395.542) [-394.663] (-398.184) (-396.113) -- 0:00:43
293000 -- (-395.298) [-394.349] (-396.063) (-399.615) * [-398.059] (-395.138) (-397.095) (-396.523) -- 0:00:43
293500 -- (-394.981) (-397.792) (-397.444) [-394.175] * [-399.322] (-396.008) (-394.667) (-396.080) -- 0:00:43
294000 -- [-395.895] (-397.508) (-394.637) (-398.102) * (-397.961) (-395.991) [-395.070] (-396.212) -- 0:00:43
294500 -- [-396.871] (-399.938) (-394.517) (-396.115) * (-400.808) [-396.153] (-395.838) (-396.047) -- 0:00:43
295000 -- (-396.420) (-396.224) [-394.274] (-396.387) * (-396.417) (-396.735) (-398.306) [-396.909] -- 0:00:43
Average standard deviation of split frequencies: 0.007697
295500 -- (-399.657) [-394.221] (-395.185) (-399.200) * (-395.760) (-397.942) (-396.012) [-394.359] -- 0:00:42
296000 -- (-400.486) [-394.859] (-398.196) (-396.994) * (-397.073) [-395.484] (-395.427) (-395.351) -- 0:00:42
296500 -- [-395.391] (-395.316) (-395.585) (-395.595) * (-396.158) (-395.516) [-399.145] (-397.084) -- 0:00:42
297000 -- (-395.361) [-397.023] (-396.214) (-394.411) * (-396.209) (-396.714) (-396.955) [-395.334] -- 0:00:42
297500 -- [-396.458] (-403.645) (-396.535) (-394.459) * (-396.659) [-396.362] (-394.952) (-402.007) -- 0:00:42
298000 -- (-395.890) (-396.431) (-397.156) [-394.034] * (-395.660) (-395.976) [-395.250] (-395.418) -- 0:00:42
298500 -- (-398.582) [-396.667] (-397.243) (-394.408) * (-394.813) (-395.508) (-396.185) [-396.972] -- 0:00:42
299000 -- (-398.024) [-394.817] (-395.516) (-396.471) * [-396.099] (-394.808) (-394.697) (-397.564) -- 0:00:42
299500 -- (-397.734) [-398.505] (-395.645) (-394.693) * [-395.181] (-395.028) (-397.767) (-398.710) -- 0:00:44
300000 -- (-396.627) (-402.524) [-397.328] (-396.786) * (-394.005) (-395.924) (-395.636) [-395.315] -- 0:00:44
Average standard deviation of split frequencies: 0.007747
300500 -- (-394.994) [-399.075] (-397.698) (-397.733) * (-396.981) (-395.296) [-395.975] (-396.786) -- 0:00:44
301000 -- [-396.835] (-394.433) (-394.476) (-395.858) * (-397.903) [-395.626] (-394.388) (-398.081) -- 0:00:44
301500 -- (-396.507) [-398.825] (-402.222) (-394.860) * (-398.877) (-398.572) [-397.403] (-394.728) -- 0:00:44
302000 -- (-403.671) [-396.139] (-396.422) (-394.252) * (-395.123) (-395.809) [-397.056] (-399.470) -- 0:00:43
302500 -- (-395.844) (-396.275) [-395.249] (-395.924) * (-398.207) (-394.950) (-395.574) [-394.670] -- 0:00:43
303000 -- (-396.187) (-395.698) (-395.693) [-397.964] * (-398.328) [-395.330] (-397.017) (-399.691) -- 0:00:43
303500 -- [-394.376] (-396.762) (-394.903) (-399.108) * [-394.767] (-395.701) (-396.840) (-396.281) -- 0:00:43
304000 -- (-394.685) [-394.922] (-394.412) (-396.217) * (-395.267) [-395.030] (-395.265) (-399.944) -- 0:00:43
304500 -- (-396.564) (-395.783) [-396.620] (-396.364) * (-396.338) (-395.390) (-394.661) [-397.202] -- 0:00:43
305000 -- (-396.002) [-394.902] (-397.448) (-394.213) * (-395.325) (-394.262) [-395.693] (-401.916) -- 0:00:43
Average standard deviation of split frequencies: 0.007189
305500 -- (-397.312) (-402.335) (-397.232) [-397.528] * (-395.069) (-398.411) [-397.916] (-405.676) -- 0:00:43
306000 -- [-396.255] (-398.357) (-397.194) (-396.798) * [-394.433] (-397.204) (-394.824) (-402.832) -- 0:00:43
306500 -- (-395.743) (-395.633) (-396.341) [-395.629] * (-394.912) [-395.465] (-394.527) (-399.610) -- 0:00:42
307000 -- (-396.527) (-394.712) (-396.294) [-395.598] * (-395.692) [-400.347] (-395.092) (-394.267) -- 0:00:42
307500 -- (-396.895) (-394.907) (-396.484) [-394.520] * (-395.356) (-397.584) [-394.033] (-395.643) -- 0:00:42
308000 -- (-407.048) (-395.914) (-398.381) [-396.048] * (-395.978) (-398.373) [-396.440] (-396.336) -- 0:00:42
308500 -- [-397.434] (-398.075) (-394.624) (-397.210) * (-394.945) (-396.187) (-395.345) [-395.328] -- 0:00:42
309000 -- [-398.337] (-399.175) (-396.877) (-397.049) * (-394.549) [-395.883] (-394.934) (-395.021) -- 0:00:42
309500 -- (-396.700) (-398.740) (-399.681) [-399.021] * [-394.744] (-395.452) (-396.046) (-398.568) -- 0:00:42
310000 -- (-397.312) [-397.440] (-395.672) (-394.434) * (-395.686) (-394.193) [-398.944] (-396.365) -- 0:00:42
Average standard deviation of split frequencies: 0.007165
310500 -- [-395.308] (-394.991) (-396.072) (-395.935) * [-395.041] (-396.963) (-396.504) (-397.444) -- 0:00:42
311000 -- [-393.985] (-397.823) (-395.384) (-394.678) * [-396.554] (-394.317) (-403.762) (-397.962) -- 0:00:42
311500 -- (-398.778) [-394.949] (-395.425) (-394.882) * (-396.073) [-395.344] (-398.246) (-395.419) -- 0:00:41
312000 -- (-398.290) (-395.676) (-397.175) [-398.000] * (-397.281) (-397.502) [-396.550] (-395.501) -- 0:00:41
312500 -- (-399.157) [-394.512] (-401.065) (-395.954) * [-396.045] (-398.980) (-397.020) (-395.549) -- 0:00:41
313000 -- (-395.061) [-394.742] (-395.637) (-394.868) * (-398.131) (-396.051) [-395.688] (-395.808) -- 0:00:41
313500 -- (-396.040) [-395.461] (-396.935) (-397.375) * (-396.283) (-397.549) (-395.634) [-394.910] -- 0:00:41
314000 -- [-395.324] (-397.605) (-395.914) (-396.341) * [-394.800] (-397.902) (-396.115) (-397.013) -- 0:00:41
314500 -- [-394.258] (-397.050) (-394.947) (-395.983) * (-400.570) [-399.212] (-396.758) (-396.109) -- 0:00:41
315000 -- (-399.475) [-398.299] (-401.088) (-394.630) * (-396.672) [-397.454] (-401.810) (-395.340) -- 0:00:41
Average standard deviation of split frequencies: 0.007045
315500 -- (-402.887) (-395.614) [-394.336] (-396.410) * [-395.742] (-395.352) (-398.479) (-395.183) -- 0:00:41
316000 -- [-397.871] (-395.825) (-396.379) (-395.279) * [-394.510] (-395.137) (-398.225) (-395.506) -- 0:00:43
316500 -- (-394.991) [-395.866] (-398.168) (-396.350) * [-394.790] (-395.648) (-395.907) (-394.724) -- 0:00:43
317000 -- [-394.516] (-399.344) (-396.842) (-400.157) * (-395.694) (-395.086) [-396.625] (-396.335) -- 0:00:43
317500 -- (-395.406) [-395.389] (-398.313) (-399.619) * (-399.193) [-395.594] (-394.779) (-396.074) -- 0:00:42
318000 -- [-395.976] (-395.789) (-396.836) (-397.393) * (-395.269) (-397.288) (-399.225) [-399.131] -- 0:00:42
318500 -- (-396.509) (-396.770) [-398.418] (-398.219) * (-396.697) (-395.960) [-396.046] (-398.719) -- 0:00:42
319000 -- (-402.165) [-395.151] (-396.026) (-396.743) * (-395.443) (-395.800) [-395.147] (-396.813) -- 0:00:42
319500 -- (-395.560) (-395.722) [-395.613] (-396.619) * (-395.921) (-395.062) (-394.916) [-397.208] -- 0:00:42
320000 -- (-396.579) [-396.329] (-395.158) (-395.700) * (-395.443) (-396.170) [-396.276] (-394.678) -- 0:00:42
Average standard deviation of split frequencies: 0.008129
320500 -- [-399.069] (-395.813) (-396.793) (-394.977) * (-395.513) (-394.573) [-396.025] (-398.612) -- 0:00:42
321000 -- [-403.510] (-396.380) (-398.462) (-394.846) * [-398.069] (-396.129) (-395.206) (-397.010) -- 0:00:42
321500 -- (-401.747) (-397.484) (-398.006) [-395.908] * (-396.186) (-395.192) (-394.621) [-396.552] -- 0:00:42
322000 -- (-398.293) (-397.548) [-403.699] (-394.322) * (-395.301) [-395.643] (-394.966) (-397.545) -- 0:00:42
322500 -- [-395.680] (-394.114) (-397.421) (-395.774) * (-396.080) (-397.966) (-393.926) [-396.418] -- 0:00:42
323000 -- [-396.772] (-396.055) (-396.172) (-399.515) * (-400.642) (-396.260) (-394.341) [-395.229] -- 0:00:41
323500 -- (-396.208) (-398.383) (-395.347) [-394.642] * (-394.872) (-397.385) [-401.881] (-397.542) -- 0:00:41
324000 -- [-397.251] (-396.384) (-400.157) (-398.657) * (-396.035) [-396.247] (-397.744) (-395.357) -- 0:00:41
324500 -- [-398.340] (-400.507) (-399.402) (-396.944) * (-397.821) (-397.148) (-394.917) [-394.603] -- 0:00:41
325000 -- (-395.603) (-394.504) [-401.259] (-401.195) * (-399.240) [-397.159] (-396.796) (-394.600) -- 0:00:41
Average standard deviation of split frequencies: 0.008421
325500 -- (-398.062) (-396.358) [-395.562] (-394.921) * (-394.932) [-401.006] (-398.961) (-394.783) -- 0:00:41
326000 -- (-397.036) (-395.226) [-396.670] (-396.755) * [-397.641] (-398.053) (-398.283) (-395.335) -- 0:00:41
326500 -- (-400.885) [-396.240] (-394.925) (-396.696) * (-399.323) (-398.610) (-399.913) [-396.961] -- 0:00:41
327000 -- (-397.601) [-395.170] (-397.055) (-394.885) * (-395.854) (-397.290) (-395.173) [-397.540] -- 0:00:41
327500 -- (-396.110) [-396.401] (-394.384) (-397.387) * (-395.962) (-400.276) (-403.392) [-397.713] -- 0:00:41
328000 -- [-396.724] (-396.131) (-395.828) (-394.904) * (-394.298) (-395.541) (-401.103) [-395.665] -- 0:00:40
328500 -- [-394.808] (-396.078) (-395.432) (-395.979) * (-397.145) [-394.221] (-396.089) (-399.832) -- 0:00:40
329000 -- (-396.385) (-395.594) (-397.124) [-397.955] * [-399.248] (-395.271) (-395.499) (-395.366) -- 0:00:40
329500 -- (-399.429) (-399.424) [-397.508] (-395.095) * [-398.574] (-399.287) (-394.685) (-394.404) -- 0:00:40
330000 -- (-399.568) (-396.039) (-396.121) [-395.293] * (-398.694) (-398.943) (-395.616) [-396.458] -- 0:00:40
Average standard deviation of split frequencies: 0.008134
330500 -- (-397.086) [-396.272] (-402.138) (-399.037) * [-395.508] (-398.513) (-397.299) (-395.864) -- 0:00:40
331000 -- (-397.023) [-395.746] (-395.940) (-395.285) * (-397.583) (-396.777) [-395.306] (-394.908) -- 0:00:40
331500 -- (-396.754) (-395.538) (-396.056) [-396.768] * (-395.242) (-395.456) [-396.812] (-395.948) -- 0:00:40
332000 -- (-396.174) (-395.281) (-394.621) [-394.898] * (-395.305) [-396.592] (-397.393) (-398.088) -- 0:00:40
332500 -- (-395.040) [-395.305] (-396.212) (-397.507) * [-397.697] (-397.334) (-397.916) (-398.282) -- 0:00:42
333000 -- (-395.250) (-395.796) [-397.982] (-398.000) * (-395.621) [-395.322] (-397.255) (-396.260) -- 0:00:42
333500 -- (-400.668) [-395.233] (-396.907) (-394.242) * (-395.637) (-396.000) (-395.608) [-394.631] -- 0:00:41
334000 -- [-397.463] (-397.825) (-397.853) (-394.604) * [-395.640] (-395.692) (-396.426) (-398.699) -- 0:00:41
334500 -- (-397.980) (-395.275) [-396.445] (-394.243) * (-394.640) (-397.886) [-399.163] (-396.523) -- 0:00:41
335000 -- (-398.059) [-397.453] (-395.076) (-395.279) * (-395.107) [-398.461] (-395.040) (-400.056) -- 0:00:41
Average standard deviation of split frequencies: 0.008748
335500 -- (-395.128) (-399.133) (-398.399) [-394.611] * (-397.394) (-395.335) [-394.788] (-397.521) -- 0:00:41
336000 -- [-394.723] (-397.326) (-394.682) (-394.942) * (-396.182) (-395.471) [-394.443] (-394.852) -- 0:00:41
336500 -- (-394.973) (-396.636) (-396.672) [-394.711] * (-395.236) [-397.471] (-395.994) (-394.447) -- 0:00:41
337000 -- (-396.585) (-402.693) [-394.819] (-394.699) * (-394.357) (-396.541) [-395.239] (-395.396) -- 0:00:41
337500 -- (-396.332) [-395.554] (-395.364) (-396.487) * (-394.310) (-396.722) [-395.541] (-395.306) -- 0:00:41
338000 -- (-397.134) [-397.252] (-398.138) (-395.148) * (-395.790) (-396.934) (-395.778) [-401.493] -- 0:00:41
338500 -- (-397.936) [-396.014] (-394.831) (-397.170) * [-394.432] (-396.911) (-395.359) (-397.894) -- 0:00:41
339000 -- (-396.424) (-397.874) (-398.183) [-397.399] * (-394.441) [-396.565] (-397.000) (-395.837) -- 0:00:40
339500 -- (-398.761) [-395.922] (-398.999) (-397.756) * (-396.677) (-395.058) [-397.972] (-400.843) -- 0:00:40
340000 -- (-400.046) [-395.424] (-398.672) (-396.848) * (-396.736) (-398.693) [-398.513] (-395.201) -- 0:00:40
Average standard deviation of split frequencies: 0.008465
340500 -- (-396.794) [-397.525] (-397.497) (-396.378) * (-401.884) [-398.052] (-396.730) (-397.096) -- 0:00:40
341000 -- [-394.649] (-398.892) (-397.728) (-398.086) * (-394.934) (-397.208) [-395.616] (-397.566) -- 0:00:40
341500 -- (-395.801) [-400.393] (-395.539) (-398.013) * (-394.892) (-394.908) [-395.430] (-398.676) -- 0:00:40
342000 -- (-395.461) (-398.753) (-394.870) [-397.081] * (-395.990) (-396.755) (-396.158) [-395.487] -- 0:00:40
342500 -- [-397.229] (-397.561) (-394.115) (-395.817) * (-396.436) (-398.065) [-397.007] (-394.331) -- 0:00:40
343000 -- (-394.467) (-401.585) (-394.494) [-396.619] * (-395.252) (-397.023) [-394.547] (-394.300) -- 0:00:40
343500 -- [-394.958] (-397.124) (-394.450) (-395.635) * (-396.646) (-396.111) [-394.846] (-396.860) -- 0:00:40
344000 -- (-396.461) (-394.274) (-395.195) [-395.763] * (-395.455) [-395.754] (-393.953) (-398.362) -- 0:00:40
344500 -- (-395.276) (-395.433) [-397.460] (-396.572) * (-397.166) [-396.815] (-395.876) (-396.654) -- 0:00:39
345000 -- (-396.939) [-398.458] (-401.067) (-396.568) * [-398.532] (-399.513) (-395.238) (-396.702) -- 0:00:39
Average standard deviation of split frequencies: 0.007645
345500 -- [-399.516] (-396.188) (-397.368) (-398.808) * (-395.798) (-398.614) (-396.796) [-396.825] -- 0:00:39
346000 -- (-399.009) (-396.879) [-398.484] (-397.341) * [-396.023] (-399.362) (-395.467) (-394.633) -- 0:00:39
346500 -- (-396.262) [-397.857] (-395.508) (-396.467) * (-396.596) (-396.854) [-397.779] (-401.783) -- 0:00:39
347000 -- [-396.138] (-395.452) (-396.833) (-398.132) * (-396.086) (-395.792) [-397.268] (-397.856) -- 0:00:39
347500 -- [-395.055] (-395.201) (-398.201) (-396.630) * [-397.607] (-395.753) (-396.605) (-397.392) -- 0:00:39
348000 -- [-398.431] (-396.107) (-394.296) (-397.310) * (-397.027) (-395.490) [-401.874] (-398.685) -- 0:00:39
348500 -- (-396.602) (-398.261) [-396.568] (-395.833) * [-395.682] (-395.378) (-396.842) (-404.226) -- 0:00:39
349000 -- (-398.160) (-394.737) [-396.947] (-396.184) * (-395.776) [-395.705] (-396.373) (-396.327) -- 0:00:41
349500 -- (-395.711) (-396.295) [-395.525] (-396.621) * [-396.977] (-402.840) (-396.473) (-400.352) -- 0:00:40
350000 -- (-395.245) (-397.958) (-395.625) [-396.187] * (-394.651) [-398.535] (-396.978) (-406.069) -- 0:00:40
Average standard deviation of split frequencies: 0.007394
350500 -- (-394.931) (-396.001) [-396.457] (-397.596) * [-395.786] (-395.360) (-396.155) (-397.643) -- 0:00:40
351000 -- [-396.589] (-395.131) (-395.454) (-394.785) * (-396.770) (-398.269) (-395.295) [-400.402] -- 0:00:40
351500 -- (-400.405) (-394.358) [-396.268] (-395.784) * (-394.547) [-398.753] (-395.866) (-397.048) -- 0:00:40
352000 -- (-397.131) [-394.381] (-396.953) (-394.285) * [-395.869] (-396.922) (-395.283) (-395.009) -- 0:00:40
352500 -- (-401.450) (-395.417) (-394.370) [-395.553] * (-397.407) (-395.975) [-394.454] (-395.789) -- 0:00:40
353000 -- (-395.556) [-396.641] (-402.631) (-395.779) * (-396.907) (-396.122) (-398.106) [-395.047] -- 0:00:40
353500 -- (-397.909) (-395.715) (-398.237) [-396.761] * [-396.199] (-394.734) (-396.299) (-395.494) -- 0:00:40
354000 -- [-398.576] (-396.092) (-394.744) (-401.563) * (-395.791) (-395.949) (-394.196) [-395.215] -- 0:00:40
354500 -- (-396.654) (-398.417) [-395.540] (-398.752) * [-396.839] (-394.726) (-395.401) (-397.189) -- 0:00:40
355000 -- [-395.975] (-395.859) (-394.644) (-396.467) * (-398.979) (-394.056) [-394.860] (-396.788) -- 0:00:39
Average standard deviation of split frequencies: 0.007209
355500 -- [-396.233] (-398.228) (-395.215) (-394.689) * [-397.935] (-395.550) (-398.877) (-396.476) -- 0:00:39
356000 -- (-395.555) [-398.162] (-397.872) (-397.200) * [-398.111] (-396.729) (-395.979) (-394.946) -- 0:00:39
356500 -- (-397.004) (-395.376) [-397.736] (-397.729) * [-395.430] (-395.814) (-395.779) (-398.913) -- 0:00:39
357000 -- (-396.522) (-395.589) (-395.425) [-394.723] * (-394.984) (-397.044) (-400.710) [-396.279] -- 0:00:39
357500 -- (-399.423) [-396.053] (-396.683) (-397.063) * (-398.875) (-394.442) [-398.856] (-396.777) -- 0:00:39
358000 -- (-394.976) (-395.983) (-397.402) [-398.752] * [-398.458] (-394.776) (-398.323) (-394.973) -- 0:00:39
358500 -- [-396.176] (-399.515) (-398.966) (-397.873) * (-397.469) (-396.931) (-398.400) [-394.523] -- 0:00:39
359000 -- (-397.322) (-397.465) (-396.073) [-397.964] * (-396.885) (-397.162) (-401.275) [-396.942] -- 0:00:39
359500 -- (-396.162) (-396.712) (-399.471) [-397.593] * (-396.197) [-397.752] (-400.256) (-396.850) -- 0:00:39
360000 -- (-395.096) [-397.140] (-397.093) (-401.311) * (-395.663) (-395.616) [-396.866] (-396.234) -- 0:00:39
Average standard deviation of split frequencies: 0.007552
360500 -- [-395.598] (-394.864) (-395.602) (-395.810) * (-395.267) (-401.827) (-397.150) [-396.678] -- 0:00:39
361000 -- (-394.956) [-395.006] (-397.209) (-396.302) * (-397.280) (-399.780) [-395.821] (-399.546) -- 0:00:38
361500 -- (-396.553) (-395.660) (-395.870) [-395.521] * (-396.341) (-397.190) (-395.562) [-398.076] -- 0:00:38
362000 -- [-399.796] (-397.878) (-394.636) (-396.559) * (-394.591) (-395.651) (-397.511) [-397.361] -- 0:00:38
362500 -- (-396.013) (-396.293) [-396.812] (-396.617) * [-398.147] (-395.686) (-398.134) (-399.706) -- 0:00:38
363000 -- [-395.240] (-398.235) (-397.976) (-397.702) * [-397.154] (-398.923) (-396.790) (-398.496) -- 0:00:38
363500 -- [-395.333] (-395.885) (-395.089) (-398.752) * [-396.128] (-394.515) (-394.273) (-407.060) -- 0:00:38
364000 -- (-397.631) (-398.244) (-400.325) [-397.594] * (-400.766) [-395.408] (-395.132) (-397.215) -- 0:00:38
364500 -- (-395.075) (-399.276) (-395.138) [-396.549] * (-395.442) (-396.378) (-395.974) [-397.071] -- 0:00:38
365000 -- [-395.134] (-397.901) (-395.724) (-394.566) * (-395.669) [-396.635] (-394.059) (-397.808) -- 0:00:38
Average standard deviation of split frequencies: 0.007513
365500 -- (-395.911) (-394.933) (-394.819) [-394.940] * (-394.455) (-394.540) (-401.099) [-395.895] -- 0:00:38
366000 -- [-395.491] (-395.606) (-395.112) (-396.081) * (-395.632) (-396.150) (-403.396) [-397.948] -- 0:00:39
366500 -- [-397.066] (-395.666) (-394.147) (-395.600) * (-396.199) [-396.582] (-398.790) (-400.602) -- 0:00:39
367000 -- (-396.804) (-394.739) (-398.030) [-396.453] * (-399.683) (-394.430) [-396.214] (-396.726) -- 0:00:39
367500 -- (-396.589) [-399.319] (-394.785) (-396.341) * (-400.351) [-396.016] (-398.455) (-396.629) -- 0:00:39
368000 -- (-394.556) (-399.889) [-394.043] (-396.481) * (-399.604) (-397.294) [-396.080] (-395.937) -- 0:00:39
368500 -- [-394.329] (-397.882) (-394.257) (-396.473) * [-398.644] (-394.560) (-396.766) (-396.676) -- 0:00:39
369000 -- (-396.502) [-400.804] (-395.595) (-397.692) * (-398.447) (-395.513) (-397.717) [-397.080] -- 0:00:39
369500 -- (-396.174) (-396.720) [-394.475] (-396.092) * [-395.270] (-396.440) (-398.564) (-396.244) -- 0:00:39
370000 -- (-399.207) [-395.754] (-394.519) (-397.534) * [-396.602] (-396.628) (-400.359) (-400.232) -- 0:00:39
Average standard deviation of split frequencies: 0.008408
370500 -- (-397.051) [-399.005] (-396.907) (-405.214) * (-395.335) [-396.460] (-399.330) (-400.919) -- 0:00:39
371000 -- [-395.871] (-399.776) (-396.396) (-404.088) * (-393.908) (-394.818) (-397.716) [-395.707] -- 0:00:38
371500 -- (-396.301) (-395.105) (-396.209) [-397.318] * (-397.576) (-398.111) (-396.213) [-395.850] -- 0:00:38
372000 -- (-395.073) (-394.659) [-395.532] (-395.730) * (-396.954) [-397.242] (-395.797) (-395.753) -- 0:00:38
372500 -- (-394.832) (-394.586) [-397.455] (-401.325) * (-397.048) [-396.627] (-396.895) (-399.186) -- 0:00:38
373000 -- (-394.701) (-399.366) (-397.170) [-396.173] * [-396.795] (-399.227) (-395.839) (-396.582) -- 0:00:38
373500 -- (-394.919) (-400.836) (-394.507) [-398.884] * (-396.699) (-397.440) [-394.515] (-397.246) -- 0:00:38
374000 -- (-397.273) (-399.408) (-399.076) [-397.194] * (-396.354) (-396.581) [-395.062] (-396.563) -- 0:00:38
374500 -- [-394.297] (-395.869) (-396.128) (-398.974) * (-395.558) (-394.972) (-396.080) [-395.565] -- 0:00:38
375000 -- (-397.546) (-395.495) [-394.928] (-395.387) * (-397.666) (-396.795) (-397.663) [-394.529] -- 0:00:38
Average standard deviation of split frequencies: 0.008149
375500 -- (-394.980) (-401.457) [-395.099] (-395.312) * (-394.264) (-396.744) [-395.783] (-396.882) -- 0:00:38
376000 -- (-397.513) [-403.532] (-395.055) (-394.815) * (-394.275) (-398.170) (-395.909) [-394.965] -- 0:00:38
376500 -- (-395.777) [-400.067] (-395.813) (-401.792) * (-394.244) (-397.944) (-397.331) [-396.428] -- 0:00:38
377000 -- (-396.982) (-397.745) (-397.025) [-398.804] * (-396.931) (-399.855) [-397.658] (-394.609) -- 0:00:38
377500 -- [-398.709] (-396.114) (-398.865) (-394.763) * (-396.130) (-399.597) (-397.356) [-396.596] -- 0:00:37
378000 -- (-395.423) [-397.087] (-400.082) (-395.758) * (-397.521) (-398.832) [-396.827] (-395.827) -- 0:00:37
378500 -- (-395.910) (-400.340) (-398.100) [-397.744] * (-396.001) [-399.650] (-395.138) (-395.740) -- 0:00:37
379000 -- (-400.724) [-402.063] (-396.866) (-398.864) * (-397.881) (-402.838) (-395.259) [-395.908] -- 0:00:37
379500 -- (-396.720) [-395.603] (-395.844) (-395.787) * (-399.226) [-397.530] (-396.818) (-395.420) -- 0:00:37
380000 -- (-398.167) [-397.791] (-395.643) (-394.539) * [-398.756] (-398.165) (-396.500) (-394.243) -- 0:00:37
Average standard deviation of split frequencies: 0.008204
380500 -- (-397.284) (-395.452) [-398.478] (-394.515) * (-397.118) (-398.619) (-395.221) [-397.523] -- 0:00:37
381000 -- (-397.494) (-395.444) [-395.792] (-396.425) * (-396.628) (-396.755) (-396.563) [-395.360] -- 0:00:37
381500 -- [-395.810] (-398.522) (-395.921) (-400.370) * (-394.516) (-395.995) [-394.846] (-400.073) -- 0:00:37
382000 -- (-395.759) [-397.913] (-394.333) (-401.066) * (-396.801) [-394.359] (-395.467) (-394.523) -- 0:00:37
382500 -- (-395.236) (-395.806) [-395.814] (-396.189) * [-396.227] (-395.448) (-395.402) (-401.431) -- 0:00:37
383000 -- (-399.358) (-396.674) [-396.511] (-395.798) * (-395.618) (-395.580) [-397.256] (-396.198) -- 0:00:38
383500 -- (-398.445) (-396.279) [-397.955] (-396.358) * [-400.679] (-395.104) (-403.410) (-394.451) -- 0:00:38
384000 -- [-395.328] (-401.404) (-395.367) (-395.509) * (-399.257) (-399.068) (-397.726) [-394.007] -- 0:00:38
384500 -- (-396.045) [-398.430] (-398.173) (-398.003) * [-395.234] (-396.890) (-396.284) (-400.789) -- 0:00:38
385000 -- (-394.811) [-396.039] (-395.901) (-394.967) * (-396.467) (-397.888) (-395.884) [-398.707] -- 0:00:38
Average standard deviation of split frequencies: 0.008549
385500 -- (-396.518) (-396.650) (-396.765) [-396.602] * (-398.770) [-395.110] (-396.388) (-395.004) -- 0:00:38
386000 -- (-397.993) [-394.698] (-396.041) (-395.425) * (-396.072) [-395.715] (-397.802) (-395.403) -- 0:00:38
386500 -- (-397.815) (-398.901) (-395.733) [-397.025] * (-395.080) (-398.539) [-395.840] (-397.465) -- 0:00:38
387000 -- (-395.746) [-394.968] (-395.062) (-396.808) * (-396.823) (-398.363) [-395.188] (-396.103) -- 0:00:38
387500 -- (-399.272) [-397.565] (-394.060) (-399.312) * (-397.452) (-397.426) (-399.468) [-395.203] -- 0:00:37
388000 -- (-395.250) [-400.618] (-394.726) (-395.032) * (-398.054) (-396.682) [-399.288] (-395.000) -- 0:00:37
388500 -- [-395.340] (-399.878) (-394.688) (-396.460) * (-395.524) (-398.560) (-397.050) [-395.967] -- 0:00:37
389000 -- (-395.548) [-397.530] (-395.165) (-394.832) * (-397.769) (-395.767) (-396.742) [-396.846] -- 0:00:37
389500 -- [-396.287] (-402.446) (-396.102) (-397.212) * (-400.194) [-397.964] (-396.336) (-398.209) -- 0:00:37
390000 -- (-398.281) (-395.263) (-395.165) [-394.387] * (-397.597) (-396.058) [-397.017] (-395.186) -- 0:00:37
Average standard deviation of split frequencies: 0.007542
390500 -- (-395.621) (-396.320) [-396.307] (-398.270) * (-397.562) (-396.427) (-401.858) [-396.427] -- 0:00:37
391000 -- (-396.817) (-395.184) (-395.708) [-395.434] * (-396.108) (-395.454) [-397.782] (-395.727) -- 0:00:37
391500 -- (-396.061) (-397.329) [-397.112] (-396.472) * (-396.120) (-401.593) [-396.421] (-396.413) -- 0:00:37
392000 -- (-399.424) (-398.245) (-397.591) [-396.559] * [-400.802] (-399.865) (-397.554) (-394.796) -- 0:00:37
392500 -- [-399.217] (-399.638) (-395.864) (-400.958) * (-395.686) (-396.289) [-395.071] (-397.853) -- 0:00:37
393000 -- (-398.335) (-399.723) [-396.167] (-396.302) * (-395.353) [-396.240] (-394.612) (-396.372) -- 0:00:37
393500 -- (-397.701) (-394.909) [-395.831] (-396.635) * (-394.914) (-397.026) (-395.182) [-397.093] -- 0:00:36
394000 -- (-397.321) [-395.772] (-395.669) (-395.781) * (-395.027) (-397.803) [-394.660] (-394.249) -- 0:00:36
394500 -- [-394.745] (-397.061) (-397.515) (-398.060) * (-398.280) (-396.506) (-394.333) [-395.165] -- 0:00:36
395000 -- (-401.725) [-397.078] (-399.272) (-399.237) * [-396.536] (-398.430) (-396.122) (-397.605) -- 0:00:36
Average standard deviation of split frequencies: 0.007843
395500 -- (-395.317) [-394.999] (-395.587) (-396.931) * (-399.368) (-396.680) (-397.554) [-397.958] -- 0:00:36
396000 -- (-394.628) (-397.555) [-394.422] (-397.460) * (-395.659) (-396.078) [-396.906] (-396.286) -- 0:00:36
396500 -- (-398.696) [-395.825] (-395.761) (-395.510) * (-395.612) (-394.710) [-397.245] (-395.556) -- 0:00:36
397000 -- (-396.552) (-396.257) [-395.824] (-394.367) * [-394.000] (-395.478) (-395.375) (-397.036) -- 0:00:36
397500 -- (-400.197) [-395.020] (-394.864) (-394.765) * (-396.760) [-397.926] (-396.193) (-397.283) -- 0:00:36
398000 -- [-397.658] (-395.294) (-395.232) (-395.322) * (-399.114) [-396.851] (-398.565) (-396.615) -- 0:00:36
398500 -- (-395.898) [-396.443] (-396.924) (-395.260) * [-396.605] (-396.604) (-398.050) (-395.665) -- 0:00:36
399000 -- [-394.767] (-396.164) (-394.995) (-396.132) * (-397.094) (-402.620) (-395.777) [-396.841] -- 0:00:36
399500 -- (-396.716) (-397.843) (-395.065) [-400.523] * (-395.302) (-402.382) [-396.587] (-396.040) -- 0:00:36
400000 -- (-396.128) (-401.803) (-395.077) [-396.289] * (-397.601) (-396.922) (-396.900) [-396.272] -- 0:00:36
Average standard deviation of split frequencies: 0.007475
400500 -- (-396.058) (-398.987) (-395.818) [-395.447] * (-395.644) (-397.938) (-399.416) [-397.418] -- 0:00:37
401000 -- [-400.366] (-395.698) (-395.855) (-395.077) * (-395.771) (-397.611) [-396.806] (-399.700) -- 0:00:37
401500 -- (-398.310) (-398.735) (-396.976) [-394.994] * [-395.025] (-397.221) (-398.784) (-397.339) -- 0:00:37
402000 -- (-396.321) (-399.213) (-397.068) [-397.880] * (-396.600) (-402.425) (-395.360) [-396.853] -- 0:00:37
402500 -- (-398.423) (-395.598) [-399.153] (-395.670) * (-402.900) (-398.477) [-397.037] (-400.662) -- 0:00:37
403000 -- (-396.641) [-395.913] (-397.387) (-394.857) * [-399.893] (-396.351) (-396.409) (-395.175) -- 0:00:37
403500 -- (-398.969) [-395.196] (-396.939) (-396.138) * [-398.190] (-395.794) (-399.402) (-396.782) -- 0:00:36
404000 -- (-394.961) (-396.309) [-396.244] (-394.658) * (-396.679) (-395.810) (-397.079) [-394.433] -- 0:00:36
404500 -- (-396.024) [-395.861] (-396.099) (-396.860) * [-396.175] (-394.285) (-395.653) (-394.587) -- 0:00:36
405000 -- (-397.205) (-397.194) (-394.333) [-394.424] * (-395.083) [-397.323] (-396.815) (-396.038) -- 0:00:36
Average standard deviation of split frequencies: 0.007934
405500 -- (-399.131) (-398.447) [-398.290] (-396.884) * (-394.864) (-397.051) (-397.004) [-395.942] -- 0:00:36
406000 -- [-396.672] (-396.775) (-400.227) (-398.426) * (-395.841) (-396.885) [-397.852] (-396.902) -- 0:00:36
406500 -- [-395.406] (-396.359) (-399.442) (-396.340) * [-395.865] (-394.430) (-397.930) (-396.188) -- 0:00:36
407000 -- (-394.781) [-396.065] (-394.900) (-394.978) * (-395.484) (-395.763) (-401.023) [-398.143] -- 0:00:36
407500 -- (-394.829) (-397.260) [-394.614] (-394.868) * [-397.390] (-395.582) (-402.983) (-396.761) -- 0:00:36
408000 -- (-396.824) (-397.099) (-394.139) [-399.072] * (-395.646) (-396.035) (-396.489) [-398.837] -- 0:00:36
408500 -- (-399.442) (-398.702) [-394.033] (-401.114) * [-394.701] (-395.624) (-401.646) (-394.877) -- 0:00:36
409000 -- (-395.292) (-397.354) [-394.614] (-403.237) * (-399.351) (-394.602) [-401.318] (-395.412) -- 0:00:36
409500 -- [-394.757] (-395.969) (-394.626) (-399.658) * [-396.505] (-394.664) (-396.556) (-401.366) -- 0:00:36
410000 -- (-398.507) [-394.202] (-394.562) (-396.004) * (-396.735) [-394.734] (-395.754) (-394.681) -- 0:00:35
Average standard deviation of split frequencies: 0.008103
410500 -- [-394.907] (-394.574) (-394.581) (-395.039) * (-394.998) (-400.082) [-396.777] (-396.240) -- 0:00:35
411000 -- (-395.700) (-399.152) (-398.231) [-396.284] * (-395.417) [-397.258] (-394.429) (-397.140) -- 0:00:35
411500 -- (-395.870) (-400.364) (-395.331) [-395.064] * (-399.197) (-396.635) (-395.243) [-396.955] -- 0:00:35
412000 -- (-397.442) (-396.584) [-395.757] (-399.183) * [-398.980] (-395.291) (-396.218) (-395.814) -- 0:00:35
412500 -- (-398.143) [-394.933] (-397.362) (-396.801) * (-397.343) (-395.484) (-396.622) [-395.976] -- 0:00:35
413000 -- (-395.718) [-395.625] (-398.438) (-396.034) * (-400.555) (-396.443) [-395.634] (-395.524) -- 0:00:35
413500 -- (-398.226) (-397.070) (-396.950) [-395.812] * (-396.693) (-395.012) [-395.135] (-395.526) -- 0:00:35
414000 -- (-395.649) (-394.823) [-396.357] (-395.015) * (-395.963) [-395.561] (-401.039) (-396.826) -- 0:00:35
414500 -- [-395.578] (-394.945) (-396.095) (-394.735) * (-396.775) (-399.164) [-396.560] (-396.239) -- 0:00:35
415000 -- (-394.865) (-395.742) [-396.255] (-395.939) * (-395.073) (-395.537) [-396.796] (-400.916) -- 0:00:35
Average standard deviation of split frequencies: 0.007932
415500 -- (-395.270) (-398.015) (-401.583) [-395.436] * (-398.858) (-394.855) [-397.189] (-402.399) -- 0:00:35
416000 -- (-398.155) (-396.822) (-394.790) [-395.440] * (-398.100) (-396.835) [-395.515] (-397.033) -- 0:00:35
416500 -- [-395.965] (-400.925) (-397.792) (-395.878) * (-396.161) (-395.233) [-396.505] (-395.446) -- 0:00:35
417000 -- (-395.159) (-397.466) (-397.374) [-395.662] * (-395.005) [-399.758] (-401.538) (-395.227) -- 0:00:36
417500 -- [-397.535] (-401.521) (-398.780) (-397.502) * (-396.390) [-394.975] (-396.748) (-396.590) -- 0:00:36
418000 -- (-394.600) [-398.539] (-396.486) (-397.634) * [-398.036] (-397.001) (-399.345) (-396.955) -- 0:00:36
418500 -- (-395.559) [-396.098] (-396.197) (-395.507) * [-396.613] (-401.278) (-397.244) (-396.943) -- 0:00:36
419000 -- (-396.765) (-396.056) [-397.218] (-396.101) * (-398.820) [-396.982] (-401.602) (-396.445) -- 0:00:36
419500 -- (-399.997) (-399.996) [-395.518] (-395.058) * (-394.489) [-396.101] (-400.277) (-397.503) -- 0:00:35
420000 -- (-398.008) [-394.532] (-396.146) (-397.903) * [-398.103] (-395.595) (-398.777) (-395.398) -- 0:00:35
Average standard deviation of split frequencies: 0.008265
420500 -- (-397.307) [-395.752] (-396.433) (-396.325) * (-394.928) (-395.022) [-398.831] (-397.844) -- 0:00:35
421000 -- (-395.351) (-396.755) [-398.835] (-394.888) * (-394.338) (-395.127) [-397.327] (-396.049) -- 0:00:35
421500 -- [-395.925] (-395.791) (-395.387) (-395.137) * (-396.458) (-399.876) (-396.741) [-394.550] -- 0:00:35
422000 -- (-395.769) (-395.012) [-400.818] (-393.999) * [-396.687] (-396.917) (-397.869) (-394.872) -- 0:00:35
422500 -- (-395.366) [-395.606] (-395.478) (-394.575) * [-396.160] (-396.047) (-399.838) (-396.021) -- 0:00:35
423000 -- (-398.033) (-397.374) (-400.521) [-394.774] * (-396.324) (-395.686) [-395.818] (-399.859) -- 0:00:35
423500 -- (-396.491) [-396.620] (-400.038) (-397.640) * (-396.245) [-394.977] (-397.383) (-394.850) -- 0:00:35
424000 -- [-396.885] (-394.440) (-397.004) (-398.123) * (-394.320) (-399.919) (-395.099) [-395.663] -- 0:00:35
424500 -- (-401.476) (-397.430) (-395.216) [-400.519] * (-395.472) (-398.112) (-398.627) [-396.402] -- 0:00:35
425000 -- (-395.419) (-401.136) (-396.572) [-395.437] * (-395.865) [-396.934] (-399.781) (-395.239) -- 0:00:35
Average standard deviation of split frequencies: 0.008657
425500 -- [-396.263] (-395.833) (-394.392) (-397.440) * (-398.997) (-396.235) (-397.239) [-397.944] -- 0:00:35
426000 -- (-396.763) (-397.303) [-398.847] (-395.421) * (-397.304) (-397.165) [-396.762] (-396.139) -- 0:00:35
426500 -- (-395.956) (-394.229) (-395.284) [-395.404] * (-398.767) [-396.524] (-394.204) (-394.557) -- 0:00:34
427000 -- (-397.053) (-395.201) [-398.794] (-395.442) * [-398.459] (-397.277) (-395.334) (-397.073) -- 0:00:34
427500 -- (-396.985) (-395.541) [-395.656] (-397.404) * (-395.731) (-396.312) [-394.414] (-396.705) -- 0:00:34
428000 -- (-395.989) (-398.754) (-398.665) [-395.780] * (-395.084) (-398.625) [-395.716] (-401.058) -- 0:00:34
428500 -- [-396.050] (-398.963) (-396.153) (-397.688) * (-397.506) (-398.983) [-396.054] (-395.408) -- 0:00:34
429000 -- (-395.983) (-397.706) [-395.771] (-395.310) * [-400.515] (-395.610) (-394.563) (-396.966) -- 0:00:34
429500 -- (-398.989) (-395.937) [-395.942] (-395.481) * (-395.924) (-394.389) [-398.830] (-396.234) -- 0:00:34
430000 -- (-397.131) (-396.772) [-396.295] (-404.738) * (-395.034) [-398.622] (-399.691) (-396.551) -- 0:00:34
Average standard deviation of split frequencies: 0.008692
430500 -- (-395.703) [-396.235] (-396.074) (-400.318) * (-394.990) (-397.516) (-398.525) [-399.274] -- 0:00:34
431000 -- [-395.991] (-395.809) (-395.454) (-394.993) * (-396.807) [-399.368] (-396.263) (-397.683) -- 0:00:34
431500 -- (-396.691) (-394.794) [-396.924] (-396.520) * (-395.788) (-394.956) (-394.847) [-396.360] -- 0:00:34
432000 -- (-394.676) (-395.806) [-395.064] (-400.577) * (-399.638) (-395.177) [-398.359] (-400.371) -- 0:00:34
432500 -- (-395.129) (-395.679) (-395.383) [-397.769] * (-398.766) (-396.980) [-396.770] (-399.850) -- 0:00:34
433000 -- (-396.585) (-394.920) (-395.090) [-396.003] * [-396.401] (-396.773) (-397.648) (-398.327) -- 0:00:34
433500 -- (-405.219) (-394.521) [-394.082] (-395.781) * (-397.035) [-395.845] (-397.799) (-396.969) -- 0:00:33
434000 -- [-398.846] (-394.705) (-399.659) (-394.760) * (-395.246) (-394.125) [-396.546] (-394.846) -- 0:00:35
434500 -- (-395.998) (-398.045) [-396.003] (-397.131) * [-400.241] (-394.706) (-396.592) (-396.304) -- 0:00:35
435000 -- (-395.465) (-400.954) [-397.592] (-396.695) * (-396.051) (-407.772) (-397.162) [-395.795] -- 0:00:35
Average standard deviation of split frequencies: 0.008204
435500 -- [-394.855] (-395.234) (-397.026) (-398.744) * (-395.924) [-400.087] (-395.371) (-395.106) -- 0:00:34
436000 -- (-394.423) [-397.713] (-396.115) (-396.560) * (-396.216) (-395.326) (-397.789) [-394.969] -- 0:00:34
436500 -- (-394.780) [-398.638] (-395.234) (-396.708) * (-396.209) (-395.654) [-397.512] (-394.483) -- 0:00:34
437000 -- (-395.030) (-398.432) [-398.731] (-395.589) * (-397.272) (-396.865) (-395.146) [-395.609] -- 0:00:34
437500 -- (-395.084) [-395.706] (-399.387) (-406.705) * (-397.938) (-397.339) (-396.326) [-394.309] -- 0:00:34
438000 -- (-396.615) [-395.648] (-401.102) (-397.420) * (-394.963) (-395.706) [-394.992] (-395.756) -- 0:00:34
438500 -- (-397.767) (-395.167) (-395.585) [-396.039] * (-398.226) [-397.575] (-396.694) (-394.705) -- 0:00:34
439000 -- (-396.198) (-395.603) (-400.005) [-397.984] * [-397.521] (-396.555) (-396.896) (-400.408) -- 0:00:34
439500 -- (-396.662) (-398.475) [-395.272] (-396.151) * (-395.201) (-396.042) (-396.938) [-396.492] -- 0:00:34
440000 -- (-394.762) (-397.170) (-395.137) [-394.977] * [-399.895] (-398.825) (-394.692) (-395.748) -- 0:00:34
Average standard deviation of split frequencies: 0.007889
440500 -- [-395.171] (-394.730) (-398.036) (-397.769) * (-399.203) (-394.916) (-395.317) [-395.663] -- 0:00:34
441000 -- (-394.450) [-395.384] (-394.617) (-401.739) * (-396.154) (-396.566) (-394.506) [-394.759] -- 0:00:34
441500 -- (-397.482) [-396.511] (-394.980) (-395.112) * [-394.912] (-397.362) (-397.920) (-398.165) -- 0:00:34
442000 -- (-396.288) [-394.196] (-397.311) (-396.780) * (-395.445) (-395.469) [-395.607] (-396.077) -- 0:00:34
442500 -- (-396.870) [-395.008] (-397.324) (-396.062) * (-395.926) [-398.298] (-394.855) (-397.260) -- 0:00:34
443000 -- (-395.152) (-396.988) [-396.906] (-396.168) * (-395.464) (-397.932) (-394.790) [-395.609] -- 0:00:33
443500 -- [-395.190] (-398.866) (-395.258) (-394.099) * (-397.481) (-396.328) [-396.140] (-395.576) -- 0:00:33
444000 -- [-394.746] (-396.254) (-397.463) (-395.851) * (-396.996) (-396.245) [-398.173] (-396.320) -- 0:00:33
444500 -- (-397.357) (-397.276) [-394.810] (-395.476) * (-395.831) [-396.163] (-397.405) (-395.573) -- 0:00:33
445000 -- (-397.135) (-394.485) [-395.078] (-396.787) * (-396.492) [-398.371] (-399.693) (-398.393) -- 0:00:33
Average standard deviation of split frequencies: 0.008258
445500 -- (-396.728) (-396.833) (-395.357) [-397.356] * [-395.054] (-396.692) (-398.085) (-394.833) -- 0:00:33
446000 -- (-395.198) (-397.094) (-396.192) [-395.452] * (-394.730) (-398.292) [-395.388] (-395.590) -- 0:00:33
446500 -- [-394.664] (-395.989) (-395.268) (-394.204) * [-399.891] (-396.576) (-398.016) (-396.379) -- 0:00:33
447000 -- (-395.636) (-395.513) [-395.336] (-398.075) * (-397.362) [-397.556] (-394.404) (-396.538) -- 0:00:33
447500 -- (-394.573) (-396.932) [-396.329] (-395.312) * (-394.296) [-396.754] (-396.939) (-400.208) -- 0:00:33
448000 -- (-396.217) (-395.575) [-395.098] (-396.270) * (-400.211) (-396.641) (-395.269) [-396.552] -- 0:00:33
448500 -- (-399.591) [-395.144] (-394.221) (-395.526) * (-399.383) (-397.309) [-396.845] (-394.816) -- 0:00:33
449000 -- (-395.164) (-399.515) (-396.058) [-398.258] * (-396.308) (-395.225) (-394.331) [-394.725] -- 0:00:33
449500 -- (-397.190) (-400.150) (-399.902) [-396.433] * (-395.568) [-396.540] (-395.264) (-397.345) -- 0:00:33
450000 -- [-394.514] (-395.964) (-396.521) (-394.663) * (-395.400) [-395.948] (-395.651) (-395.424) -- 0:00:33
Average standard deviation of split frequencies: 0.008957
450500 -- (-394.509) (-394.925) (-396.871) [-395.002] * (-397.967) (-396.810) [-396.928] (-396.962) -- 0:00:34
451000 -- [-394.538] (-400.862) (-395.202) (-395.352) * (-394.955) (-396.675) [-395.626] (-395.444) -- 0:00:34
451500 -- (-396.556) [-395.811] (-394.665) (-396.143) * (-396.473) [-394.442] (-394.923) (-395.191) -- 0:00:34
452000 -- (-394.867) (-396.153) (-396.766) [-396.063] * (-396.389) (-396.992) (-394.203) [-397.632] -- 0:00:33
452500 -- (-396.651) (-395.619) (-397.290) [-396.224] * [-397.648] (-397.428) (-396.826) (-394.444) -- 0:00:33
453000 -- (-395.507) (-397.669) [-398.890] (-402.560) * [-398.429] (-394.911) (-395.093) (-394.295) -- 0:00:33
453500 -- (-394.293) (-396.196) (-396.496) [-400.625] * (-394.873) [-396.451] (-396.820) (-398.615) -- 0:00:33
454000 -- (-398.230) (-394.350) [-398.016] (-396.225) * [-395.356] (-394.609) (-396.820) (-396.351) -- 0:00:33
454500 -- [-396.487] (-394.752) (-394.277) (-394.885) * (-396.359) [-395.430] (-399.521) (-398.124) -- 0:00:33
455000 -- [-396.502] (-395.584) (-395.332) (-394.466) * (-395.996) (-394.501) (-395.797) [-396.990] -- 0:00:33
Average standard deviation of split frequencies: 0.008529
455500 -- [-396.573] (-396.436) (-397.600) (-394.045) * (-394.287) (-394.497) [-395.148] (-394.447) -- 0:00:33
456000 -- (-395.132) (-396.222) [-400.181] (-394.075) * [-394.974] (-394.137) (-396.761) (-396.136) -- 0:00:33
456500 -- [-400.703] (-396.601) (-400.283) (-394.161) * (-394.450) [-394.640] (-395.953) (-397.533) -- 0:00:33
457000 -- (-398.462) [-394.489] (-398.635) (-396.178) * (-395.640) (-397.084) [-397.285] (-399.030) -- 0:00:33
457500 -- (-397.580) (-396.053) [-397.050] (-394.765) * (-396.005) (-398.332) [-398.824] (-397.005) -- 0:00:33
458000 -- (-395.248) (-403.265) [-395.346] (-394.675) * (-398.886) (-401.304) [-395.366] (-398.288) -- 0:00:33
458500 -- [-395.737] (-395.977) (-400.508) (-395.876) * (-398.269) [-398.350] (-398.101) (-395.247) -- 0:00:33
459000 -- (-396.740) (-395.986) (-397.352) [-397.234] * (-395.966) [-395.282] (-396.821) (-397.682) -- 0:00:33
459500 -- (-394.913) [-401.464] (-395.919) (-395.030) * [-398.598] (-399.407) (-398.312) (-397.833) -- 0:00:32
460000 -- (-395.105) [-396.196] (-394.697) (-398.692) * [-395.572] (-399.062) (-396.870) (-396.385) -- 0:00:32
Average standard deviation of split frequencies: 0.008570
460500 -- (-396.931) [-395.967] (-397.856) (-397.683) * (-395.558) [-398.312] (-394.165) (-396.534) -- 0:00:32
461000 -- (-397.817) (-399.938) [-395.644] (-396.717) * (-396.953) (-396.579) [-395.563] (-400.200) -- 0:00:32
461500 -- (-400.105) (-396.778) (-396.361) [-394.491] * (-398.301) [-396.955] (-396.278) (-394.180) -- 0:00:32
462000 -- [-394.906] (-395.085) (-394.830) (-395.566) * (-396.339) [-399.058] (-393.967) (-395.085) -- 0:00:32
462500 -- (-402.281) (-399.348) (-396.502) [-394.508] * (-399.356) (-399.423) (-397.505) [-394.789] -- 0:00:32
463000 -- (-397.391) (-399.624) (-397.190) [-394.754] * (-396.929) (-399.085) (-395.145) [-395.358] -- 0:00:32
463500 -- (-396.173) (-399.738) (-395.128) [-397.067] * (-398.278) (-394.534) (-398.948) [-396.720] -- 0:00:32
464000 -- [-396.619] (-397.738) (-396.149) (-397.625) * (-398.079) [-396.116] (-394.964) (-396.235) -- 0:00:32
464500 -- (-397.420) (-395.838) [-398.089] (-396.255) * [-396.876] (-398.225) (-400.457) (-395.202) -- 0:00:32
465000 -- (-394.703) (-397.777) [-396.333] (-395.431) * [-396.976] (-398.864) (-401.052) (-395.441) -- 0:00:32
Average standard deviation of split frequencies: 0.008472
465500 -- (-395.116) (-396.294) [-399.836] (-403.517) * [-398.189] (-400.573) (-398.595) (-395.159) -- 0:00:32
466000 -- (-394.713) (-396.118) (-400.989) [-398.336] * [-399.436] (-395.270) (-396.906) (-397.144) -- 0:00:32
466500 -- (-395.436) (-397.604) [-396.938] (-394.960) * [-396.404] (-395.391) (-396.396) (-397.594) -- 0:00:32
467000 -- (-396.106) (-397.914) [-395.803] (-394.791) * (-398.351) [-397.202] (-398.312) (-399.172) -- 0:00:33
467500 -- (-396.021) [-395.242] (-395.982) (-398.366) * [-395.956] (-395.652) (-395.022) (-395.057) -- 0:00:33
468000 -- (-395.593) [-395.201] (-395.663) (-394.655) * [-394.414] (-395.989) (-397.612) (-396.489) -- 0:00:32
468500 -- (-397.930) [-394.884] (-397.886) (-398.016) * (-397.251) (-394.820) (-395.362) [-397.241] -- 0:00:32
469000 -- (-397.624) (-395.056) (-396.333) [-395.706] * (-400.275) (-397.555) [-395.703] (-395.259) -- 0:00:32
469500 -- (-396.966) (-395.380) [-395.730] (-398.389) * (-395.388) [-396.452] (-395.034) (-394.351) -- 0:00:32
470000 -- (-397.282) [-395.975] (-395.207) (-395.202) * (-397.463) [-399.644] (-398.138) (-396.090) -- 0:00:32
Average standard deviation of split frequencies: 0.008889
470500 -- (-395.940) [-395.131] (-396.274) (-396.536) * [-395.636] (-395.308) (-397.296) (-400.186) -- 0:00:32
471000 -- (-396.775) [-394.596] (-396.859) (-395.405) * (-395.902) [-395.501] (-396.360) (-398.403) -- 0:00:32
471500 -- (-401.483) (-397.414) [-396.637] (-394.337) * (-398.377) (-397.964) (-396.817) [-394.228] -- 0:00:32
472000 -- [-397.619] (-395.925) (-395.565) (-396.698) * [-395.488] (-400.115) (-395.903) (-396.874) -- 0:00:32
472500 -- (-397.516) (-394.797) (-395.511) [-397.165] * (-396.026) (-398.082) (-395.538) [-394.530] -- 0:00:32
473000 -- (-396.697) (-397.444) (-398.186) [-396.937] * (-403.963) (-397.563) (-398.700) [-395.183] -- 0:00:32
473500 -- (-395.558) (-395.279) [-399.152] (-396.300) * (-402.092) (-397.368) [-397.661] (-394.790) -- 0:00:32
474000 -- (-394.441) (-395.133) [-399.475] (-394.648) * (-398.050) (-401.136) (-397.471) [-395.270] -- 0:00:32
474500 -- [-394.885] (-394.717) (-398.286) (-395.749) * (-394.591) (-397.574) [-395.790] (-396.188) -- 0:00:32
475000 -- (-400.762) [-394.474] (-394.754) (-394.823) * [-396.124] (-400.099) (-398.812) (-395.716) -- 0:00:32
Average standard deviation of split frequencies: 0.008975
475500 -- (-396.456) [-397.209] (-395.757) (-394.842) * (-396.419) [-396.048] (-398.596) (-397.542) -- 0:00:31
476000 -- (-395.561) (-395.915) (-400.253) [-397.316] * (-395.221) (-396.113) (-398.842) [-395.456] -- 0:00:31
476500 -- (-395.036) (-396.109) (-394.851) [-400.501] * (-396.217) (-394.634) (-398.640) [-396.510] -- 0:00:31
477000 -- (-394.361) (-398.365) (-395.521) [-396.008] * (-399.439) (-397.783) [-395.764] (-395.108) -- 0:00:31
477500 -- [-396.006] (-394.732) (-402.510) (-395.186) * (-395.012) [-398.056] (-395.308) (-394.535) -- 0:00:31
478000 -- (-395.290) (-395.617) [-395.243] (-395.180) * (-397.259) [-396.621] (-394.197) (-395.040) -- 0:00:31
478500 -- (-396.480) (-395.429) [-397.332] (-396.112) * (-395.595) (-395.343) [-398.537] (-395.697) -- 0:00:31
479000 -- (-395.676) [-397.534] (-394.726) (-395.396) * (-399.043) (-398.402) (-398.566) [-397.547] -- 0:00:31
479500 -- [-395.053] (-395.981) (-396.224) (-394.816) * (-395.774) (-398.498) [-396.016] (-396.951) -- 0:00:31
480000 -- (-395.562) (-394.994) [-397.535] (-394.769) * (-395.945) [-395.768] (-398.695) (-397.705) -- 0:00:31
Average standard deviation of split frequencies: 0.010052
480500 -- (-395.317) [-396.364] (-397.172) (-396.060) * (-394.971) (-398.247) [-394.678] (-401.483) -- 0:00:31
481000 -- [-396.004] (-395.842) (-399.436) (-399.439) * (-394.962) (-397.496) [-394.843] (-394.577) -- 0:00:31
481500 -- (-395.746) [-394.744] (-395.243) (-397.464) * (-400.096) (-396.812) (-394.264) [-396.781] -- 0:00:31
482000 -- [-396.004] (-396.448) (-394.539) (-397.648) * [-397.543] (-397.483) (-398.605) (-394.877) -- 0:00:31
482500 -- (-401.806) (-395.866) (-396.174) [-397.920] * (-398.768) [-395.693] (-399.787) (-397.217) -- 0:00:31
483000 -- [-397.090] (-403.987) (-394.121) (-394.775) * [-394.681] (-396.366) (-400.559) (-395.602) -- 0:00:31
483500 -- (-395.241) (-400.730) [-399.756] (-397.339) * (-396.742) (-395.862) [-397.996] (-400.401) -- 0:00:32
484000 -- [-398.437] (-397.493) (-396.295) (-399.263) * (-399.026) (-394.929) [-394.789] (-395.720) -- 0:00:31
484500 -- [-396.478] (-397.029) (-395.287) (-395.974) * [-396.674] (-394.781) (-400.117) (-398.447) -- 0:00:31
485000 -- [-398.068] (-397.961) (-397.536) (-399.531) * (-401.050) [-397.962] (-395.971) (-394.596) -- 0:00:31
Average standard deviation of split frequencies: 0.009578
485500 -- [-394.736] (-395.019) (-398.743) (-395.988) * (-399.334) (-397.292) (-396.317) [-395.627] -- 0:00:31
486000 -- (-396.722) (-396.721) [-396.495] (-395.511) * (-399.477) (-397.561) [-395.730] (-397.869) -- 0:00:31
486500 -- (-394.030) [-395.749] (-398.791) (-398.022) * [-400.462] (-398.803) (-396.059) (-397.178) -- 0:00:31
487000 -- (-396.571) (-401.073) [-397.902] (-398.410) * (-396.034) (-397.495) [-396.467] (-397.717) -- 0:00:31
487500 -- [-396.043] (-397.626) (-400.804) (-403.250) * (-398.500) (-395.934) (-395.374) [-397.325] -- 0:00:31
488000 -- [-396.945] (-396.998) (-396.982) (-395.760) * (-396.526) [-396.366] (-394.977) (-396.360) -- 0:00:31
488500 -- (-396.367) [-397.539] (-395.054) (-395.678) * (-395.629) (-396.432) (-396.909) [-395.721] -- 0:00:31
489000 -- [-399.582] (-395.383) (-396.429) (-395.741) * (-394.918) (-395.322) (-397.042) [-396.407] -- 0:00:31
489500 -- (-401.612) (-395.386) [-396.046] (-395.644) * (-395.515) (-397.229) [-398.693] (-398.699) -- 0:00:31
490000 -- (-397.464) (-394.982) (-397.241) [-395.584] * (-396.268) (-399.136) (-399.700) [-395.953] -- 0:00:31
Average standard deviation of split frequencies: 0.009287
490500 -- [-398.829] (-397.327) (-395.754) (-394.870) * (-396.207) (-401.544) (-397.153) [-394.832] -- 0:00:31
491000 -- (-400.252) [-399.878] (-395.921) (-400.414) * (-402.753) (-397.642) (-396.386) [-395.422] -- 0:00:31
491500 -- (-397.327) (-397.847) (-397.662) [-395.061] * (-397.954) (-399.671) [-395.191] (-399.079) -- 0:00:31
492000 -- (-396.125) (-395.495) [-402.381] (-394.636) * (-399.447) (-396.959) [-394.586] (-397.696) -- 0:00:30
492500 -- (-395.068) (-396.496) (-396.004) [-395.761] * (-395.373) [-397.961] (-394.967) (-399.212) -- 0:00:30
493000 -- (-394.716) [-395.944] (-396.984) (-394.701) * (-398.628) (-397.790) [-400.136] (-397.782) -- 0:00:30
493500 -- (-396.261) [-394.919] (-397.581) (-394.913) * (-397.611) (-399.552) (-398.088) [-395.499] -- 0:00:30
494000 -- [-397.634] (-400.110) (-396.007) (-395.714) * (-398.459) [-396.740] (-397.934) (-396.115) -- 0:00:30
494500 -- [-396.495] (-397.794) (-397.586) (-398.680) * (-397.539) [-394.779] (-396.910) (-398.643) -- 0:00:30
495000 -- (-398.505) (-397.290) [-399.624] (-398.617) * (-395.722) (-395.806) [-398.302] (-395.637) -- 0:00:30
Average standard deviation of split frequencies: 0.008300
495500 -- (-398.400) [-395.754] (-397.133) (-397.280) * (-394.837) [-396.164] (-397.708) (-396.700) -- 0:00:30
496000 -- (-399.018) [-395.312] (-395.970) (-396.176) * (-396.430) [-394.878] (-394.764) (-397.166) -- 0:00:30
496500 -- (-398.963) (-397.630) [-401.176] (-395.141) * (-397.556) (-400.972) [-399.572] (-396.879) -- 0:00:30
497000 -- [-394.657] (-398.628) (-397.701) (-397.603) * (-400.537) [-395.821] (-394.793) (-397.306) -- 0:00:30
497500 -- [-396.374] (-398.705) (-395.485) (-395.763) * (-395.401) (-396.245) (-395.567) [-396.000] -- 0:00:30
498000 -- [-395.179] (-395.356) (-395.620) (-396.784) * (-397.903) (-398.092) [-399.993] (-395.334) -- 0:00:30
498500 -- (-396.409) (-396.259) [-395.128] (-395.678) * (-396.712) (-396.976) [-395.217] (-396.367) -- 0:00:30
499000 -- (-396.363) (-398.681) (-395.407) [-394.064] * [-398.623] (-397.450) (-395.317) (-396.377) -- 0:00:30
499500 -- (-394.930) (-398.860) (-396.039) [-395.901] * (-399.246) (-401.310) [-394.028] (-395.114) -- 0:00:30
500000 -- [-396.284] (-395.146) (-394.775) (-395.870) * (-396.750) (-396.130) [-394.169] (-395.397) -- 0:00:30
Average standard deviation of split frequencies: 0.008160
500500 -- (-398.856) [-395.651] (-396.479) (-395.017) * (-396.697) (-396.161) [-395.896] (-395.190) -- 0:00:30
501000 -- [-398.455] (-396.603) (-395.760) (-396.957) * (-394.864) [-395.183] (-397.830) (-395.264) -- 0:00:30
501500 -- (-394.985) (-396.143) [-396.570] (-395.426) * (-394.625) [-395.496] (-395.002) (-399.256) -- 0:00:30
502000 -- (-394.904) (-400.017) [-395.473] (-400.334) * (-394.656) (-396.417) (-396.926) [-401.174] -- 0:00:30
502500 -- (-398.683) (-402.417) (-395.657) [-399.632] * [-394.844] (-394.486) (-398.119) (-397.267) -- 0:00:30
503000 -- (-401.916) (-401.354) (-395.307) [-394.867] * [-395.065] (-398.903) (-395.349) (-398.681) -- 0:00:30
503500 -- (-397.985) (-398.834) [-397.566] (-396.579) * (-394.695) (-400.858) [-394.221] (-400.721) -- 0:00:30
504000 -- (-399.573) (-401.497) [-397.010] (-396.825) * [-396.331] (-396.668) (-394.922) (-397.267) -- 0:00:30
504500 -- (-398.039) (-398.316) [-395.302] (-399.676) * (-399.250) [-395.524] (-395.472) (-396.504) -- 0:00:30
505000 -- (-398.114) [-399.407] (-396.464) (-396.758) * (-396.630) (-395.766) (-397.297) [-394.828] -- 0:00:30
Average standard deviation of split frequencies: 0.008136
505500 -- [-396.318] (-397.641) (-402.153) (-394.787) * (-395.386) (-397.270) (-397.631) [-395.775] -- 0:00:30
506000 -- [-396.593] (-396.065) (-399.948) (-394.905) * (-395.931) (-394.791) (-396.450) [-400.052] -- 0:00:30
506500 -- (-394.420) (-394.647) (-401.577) [-395.629] * (-399.561) [-397.991] (-397.671) (-395.909) -- 0:00:30
507000 -- (-401.065) (-394.544) (-395.633) [-398.012] * (-397.825) (-396.183) (-396.714) [-396.995] -- 0:00:30
507500 -- (-395.864) (-397.886) [-395.433] (-398.266) * (-400.379) (-396.081) [-394.985] (-398.751) -- 0:00:30
508000 -- [-397.067] (-396.156) (-394.950) (-398.322) * (-394.296) [-394.863] (-396.982) (-395.452) -- 0:00:30
508500 -- [-395.022] (-394.388) (-396.092) (-396.196) * [-395.883] (-397.834) (-395.136) (-396.781) -- 0:00:29
509000 -- (-395.440) [-396.143] (-398.202) (-398.827) * (-396.737) [-395.917] (-394.948) (-395.149) -- 0:00:29
509500 -- [-398.801] (-394.499) (-396.098) (-400.359) * [-395.949] (-396.292) (-396.683) (-398.299) -- 0:00:29
510000 -- (-394.564) (-395.098) [-399.056] (-400.152) * (-399.229) [-396.637] (-397.113) (-399.301) -- 0:00:29
Average standard deviation of split frequencies: 0.008000
510500 -- [-395.151] (-395.237) (-394.560) (-402.676) * [-396.804] (-398.450) (-396.303) (-396.325) -- 0:00:29
511000 -- (-396.579) [-399.751] (-398.325) (-396.860) * (-396.558) (-395.426) [-395.948] (-398.664) -- 0:00:29
511500 -- (-397.143) (-397.215) (-399.025) [-398.630] * (-396.307) [-395.021] (-395.417) (-397.739) -- 0:00:29
512000 -- [-396.041] (-397.629) (-395.354) (-395.595) * (-396.882) (-396.464) (-397.438) [-394.008] -- 0:00:29
512500 -- (-399.095) (-395.956) [-395.171] (-400.016) * [-396.221] (-399.689) (-396.628) (-396.100) -- 0:00:29
513000 -- (-400.079) [-395.857] (-396.749) (-398.131) * (-399.350) (-395.874) (-396.522) [-400.169] -- 0:00:29
513500 -- [-399.381] (-398.088) (-396.455) (-397.069) * (-400.984) [-394.814] (-397.564) (-398.317) -- 0:00:29
514000 -- (-397.532) (-395.728) [-395.575] (-397.537) * (-396.306) (-394.630) [-395.120] (-395.375) -- 0:00:29
514500 -- (-394.646) (-395.330) [-395.384] (-396.213) * (-398.650) [-394.645] (-398.162) (-394.923) -- 0:00:29
515000 -- (-395.487) [-396.908] (-397.376) (-394.142) * (-398.950) (-395.884) (-399.540) [-398.188] -- 0:00:29
Average standard deviation of split frequencies: 0.008283
515500 -- (-396.682) (-397.449) (-394.706) [-394.506] * (-397.181) (-395.908) (-395.351) [-395.488] -- 0:00:29
516000 -- (-396.523) (-404.316) (-396.205) [-395.346] * [-395.130] (-396.799) (-398.210) (-394.891) -- 0:00:29
516500 -- (-397.761) [-396.698] (-398.731) (-397.122) * (-398.970) (-395.607) [-396.940] (-396.780) -- 0:00:29
517000 -- (-394.413) (-397.233) [-395.126] (-397.973) * (-395.397) (-396.668) (-395.303) [-396.123] -- 0:00:29
517500 -- (-396.611) (-397.190) (-395.138) [-396.535] * (-396.782) [-396.673] (-400.471) (-396.591) -- 0:00:29
518000 -- (-398.581) (-395.419) (-396.698) [-396.196] * (-396.608) (-395.880) (-395.652) [-396.272] -- 0:00:29
518500 -- (-396.097) (-396.337) (-395.902) [-401.536] * (-396.271) (-399.909) [-395.055] (-396.037) -- 0:00:29
519000 -- (-397.693) (-399.646) [-396.464] (-398.704) * (-395.049) (-397.311) (-396.374) [-394.853] -- 0:00:29
519500 -- (-399.833) (-395.182) (-396.585) [-397.920] * (-400.720) [-395.014] (-396.891) (-398.347) -- 0:00:29
520000 -- [-399.195] (-395.658) (-398.718) (-395.707) * (-395.016) [-398.857] (-397.463) (-399.423) -- 0:00:29
Average standard deviation of split frequencies: 0.008511
520500 -- [-399.314] (-396.123) (-395.358) (-396.258) * (-397.367) (-396.452) [-396.733] (-397.823) -- 0:00:29
521000 -- (-396.075) [-396.493] (-396.522) (-398.463) * (-394.362) (-396.350) [-396.020] (-396.190) -- 0:00:29
521500 -- (-396.599) (-397.738) (-395.457) [-397.772] * (-397.179) (-396.356) [-397.368] (-395.274) -- 0:00:29
522000 -- [-394.648] (-397.226) (-397.495) (-399.472) * (-395.219) [-396.321] (-396.129) (-396.833) -- 0:00:29
522500 -- (-396.255) (-396.881) [-397.345] (-396.566) * (-396.376) (-395.132) (-394.618) [-398.504] -- 0:00:29
523000 -- (-396.847) (-395.407) [-397.636] (-394.722) * (-394.663) (-396.061) (-396.176) [-395.632] -- 0:00:29
523500 -- (-395.345) (-398.757) (-394.616) [-394.712] * (-395.714) [-394.649] (-397.771) (-397.474) -- 0:00:29
524000 -- (-396.992) (-399.666) [-397.782] (-396.808) * (-395.413) (-397.071) (-398.057) [-396.202] -- 0:00:29
524500 -- [-395.960] (-398.873) (-406.587) (-397.298) * (-396.542) [-397.439] (-399.749) (-396.778) -- 0:00:29
525000 -- (-395.087) (-394.844) [-395.567] (-402.724) * [-396.539] (-394.511) (-396.447) (-399.206) -- 0:00:28
Average standard deviation of split frequencies: 0.009022
525500 -- [-394.965] (-394.531) (-395.742) (-394.817) * (-400.005) (-395.755) (-395.580) [-395.913] -- 0:00:28
526000 -- (-394.572) (-395.254) [-397.607] (-398.837) * (-399.266) (-397.562) [-398.700] (-397.033) -- 0:00:28
526500 -- (-394.403) (-397.034) [-394.985] (-395.402) * [-397.646] (-395.811) (-397.971) (-396.313) -- 0:00:28
527000 -- (-395.647) [-399.948] (-400.468) (-396.091) * (-397.966) (-396.045) [-395.623] (-397.166) -- 0:00:28
527500 -- [-396.499] (-398.636) (-397.328) (-396.989) * (-396.930) [-396.050] (-395.042) (-397.613) -- 0:00:28
528000 -- [-399.308] (-398.261) (-396.818) (-396.972) * [-396.564] (-394.657) (-394.471) (-396.573) -- 0:00:28
528500 -- (-397.457) [-394.925] (-398.244) (-397.620) * (-397.875) [-394.994] (-394.739) (-394.598) -- 0:00:28
529000 -- (-396.945) (-396.991) [-398.377] (-397.121) * (-400.515) [-397.186] (-395.108) (-395.411) -- 0:00:28
529500 -- (-398.667) [-397.268] (-397.701) (-394.850) * (-395.237) [-396.079] (-394.549) (-395.664) -- 0:00:28
530000 -- (-399.651) (-396.943) [-395.720] (-394.899) * (-396.190) (-395.096) (-396.027) [-400.794] -- 0:00:28
Average standard deviation of split frequencies: 0.008706
530500 -- [-395.424] (-395.718) (-396.153) (-395.323) * (-396.723) [-396.457] (-396.202) (-395.631) -- 0:00:28
531000 -- (-395.670) [-396.900] (-394.553) (-398.857) * (-395.066) (-394.540) (-395.810) [-396.298] -- 0:00:28
531500 -- (-399.507) (-395.347) [-395.588] (-396.617) * (-395.119) (-397.314) (-394.864) [-394.943] -- 0:00:28
532000 -- (-397.443) (-397.156) (-394.262) [-397.561] * (-394.577) (-399.121) (-406.533) [-396.523] -- 0:00:28
532500 -- (-398.018) [-396.104] (-394.079) (-395.061) * [-397.714] (-396.671) (-395.606) (-395.871) -- 0:00:28
533000 -- (-399.680) (-394.902) [-395.162] (-395.226) * (-397.849) (-394.464) [-396.850] (-396.266) -- 0:00:28
533500 -- (-394.568) (-394.804) [-395.816] (-397.015) * (-395.814) [-395.445] (-395.045) (-396.576) -- 0:00:27
534000 -- (-394.737) (-395.231) [-395.197] (-395.767) * [-394.825] (-400.756) (-397.211) (-396.682) -- 0:00:28
534500 -- [-395.026] (-395.103) (-396.469) (-396.320) * [-395.226] (-395.517) (-396.972) (-398.304) -- 0:00:28
535000 -- [-396.817] (-397.635) (-396.895) (-395.885) * [-396.397] (-396.045) (-395.904) (-396.112) -- 0:00:28
Average standard deviation of split frequencies: 0.008384
535500 -- [-395.126] (-395.369) (-397.468) (-394.648) * (-395.075) (-398.123) (-395.542) [-395.571] -- 0:00:28
536000 -- (-395.767) (-395.497) [-394.668] (-399.719) * (-396.148) (-396.853) [-395.413] (-397.391) -- 0:00:28
536500 -- (-394.982) (-394.451) [-394.909] (-399.501) * (-396.155) (-395.752) [-395.743] (-395.669) -- 0:00:28
537000 -- (-395.401) [-395.177] (-397.468) (-399.187) * (-396.816) (-398.176) (-401.361) [-396.724] -- 0:00:28
537500 -- (-396.517) (-397.342) [-399.785] (-396.777) * (-396.562) (-396.857) [-394.922] (-398.379) -- 0:00:28
538000 -- (-395.541) [-398.336] (-396.025) (-399.092) * (-394.920) (-394.619) [-395.665] (-399.623) -- 0:00:28
538500 -- [-399.012] (-395.441) (-396.022) (-396.810) * (-394.689) [-395.432] (-395.623) (-399.389) -- 0:00:28
539000 -- [-397.274] (-397.519) (-398.186) (-395.521) * (-396.317) (-394.802) (-395.111) [-396.532] -- 0:00:28
539500 -- (-395.593) (-399.339) [-396.358] (-395.585) * (-398.447) (-395.202) [-397.166] (-397.998) -- 0:00:28
540000 -- (-396.248) (-398.675) (-395.005) [-400.399] * (-395.820) (-396.256) [-397.289] (-398.105) -- 0:00:28
Average standard deviation of split frequencies: 0.008661
540500 -- (-394.546) (-399.433) (-396.007) [-400.324] * [-394.683] (-400.107) (-395.899) (-395.348) -- 0:00:28
541000 -- [-394.717] (-396.737) (-395.397) (-399.013) * (-399.460) (-395.644) (-398.999) [-397.184] -- 0:00:27
541500 -- (-400.196) [-397.993] (-398.695) (-396.122) * (-402.698) (-396.728) (-396.869) [-397.420] -- 0:00:27
542000 -- (-402.939) [-397.498] (-404.020) (-396.744) * (-402.222) (-398.563) [-394.437] (-396.353) -- 0:00:27
542500 -- [-396.703] (-396.733) (-396.906) (-399.208) * (-400.227) (-395.686) (-397.745) [-398.988] -- 0:00:27
543000 -- [-397.618] (-399.878) (-396.348) (-396.449) * [-399.053] (-396.510) (-397.031) (-397.553) -- 0:00:27
543500 -- (-395.911) [-396.423] (-396.960) (-395.337) * (-396.526) (-394.485) (-396.984) [-397.136] -- 0:00:27
544000 -- (-395.124) (-395.820) (-395.264) [-394.663] * (-397.239) (-395.192) [-395.292] (-396.458) -- 0:00:27
544500 -- [-395.714] (-394.927) (-398.978) (-399.340) * [-394.777] (-394.556) (-397.941) (-397.334) -- 0:00:27
545000 -- (-398.070) [-398.826] (-395.009) (-395.238) * (-397.075) (-395.596) [-395.329] (-396.788) -- 0:00:27
Average standard deviation of split frequencies: 0.007828
545500 -- [-398.759] (-396.845) (-394.733) (-397.108) * [-395.038] (-394.909) (-395.037) (-397.139) -- 0:00:27
546000 -- (-395.574) [-398.439] (-395.399) (-398.524) * (-395.905) (-396.114) [-395.751] (-397.178) -- 0:00:27
546500 -- (-396.779) [-396.667] (-402.289) (-396.524) * (-394.641) [-396.527] (-399.228) (-398.366) -- 0:00:27
547000 -- (-398.184) (-397.332) (-397.006) [-396.409] * (-395.229) (-398.962) [-394.998] (-395.264) -- 0:00:27
547500 -- (-395.802) (-398.307) [-396.252] (-396.307) * (-394.410) (-394.682) (-395.506) [-394.567] -- 0:00:27
548000 -- (-399.516) (-396.407) [-394.645] (-397.073) * (-394.953) [-396.174] (-395.675) (-394.653) -- 0:00:27
548500 -- [-396.892] (-394.913) (-395.381) (-398.142) * (-395.768) (-400.570) [-394.607] (-395.674) -- 0:00:27
549000 -- (-398.980) [-399.383] (-395.247) (-395.645) * [-395.413] (-397.625) (-394.669) (-396.599) -- 0:00:27
549500 -- [-394.887] (-398.143) (-398.112) (-394.951) * (-394.894) (-401.182) (-394.475) [-395.028] -- 0:00:27
550000 -- (-394.416) [-396.307] (-395.436) (-398.130) * (-399.344) (-398.198) [-395.029] (-395.709) -- 0:00:27
Average standard deviation of split frequencies: 0.007990
550500 -- (-394.840) [-396.375] (-395.244) (-398.429) * [-400.402] (-394.397) (-397.235) (-396.629) -- 0:00:27
551000 -- [-396.027] (-397.375) (-397.744) (-397.615) * (-397.673) [-398.943] (-396.071) (-395.679) -- 0:00:27
551500 -- (-396.501) (-394.720) [-397.871] (-395.817) * (-394.895) [-397.672] (-395.672) (-397.560) -- 0:00:27
552000 -- [-398.711] (-400.402) (-395.178) (-399.493) * (-397.941) (-398.279) [-397.144] (-394.886) -- 0:00:27
552500 -- (-396.046) (-396.171) (-397.978) [-396.026] * [-396.963] (-395.157) (-398.401) (-397.739) -- 0:00:27
553000 -- (-394.624) [-394.842] (-394.962) (-395.894) * [-398.860] (-398.313) (-396.108) (-397.013) -- 0:00:27
553500 -- (-396.101) (-395.705) [-394.644] (-395.715) * [-396.825] (-398.210) (-397.153) (-394.972) -- 0:00:27
554000 -- (-394.510) (-395.658) [-397.230] (-396.907) * (-395.879) (-396.187) (-399.697) [-398.511] -- 0:00:27
554500 -- [-395.038] (-394.816) (-397.503) (-401.052) * [-394.846] (-397.889) (-396.321) (-397.783) -- 0:00:27
555000 -- (-397.624) (-394.660) (-396.273) [-397.394] * [-395.236] (-399.170) (-398.002) (-398.762) -- 0:00:27
Average standard deviation of split frequencies: 0.007687
555500 -- (-397.919) (-395.239) [-394.954] (-394.029) * (-397.092) (-396.873) (-395.302) [-399.112] -- 0:00:27
556000 -- (-395.833) (-395.713) (-397.443) [-395.766] * (-394.893) [-399.652] (-395.747) (-397.026) -- 0:00:27
556500 -- (-396.386) (-398.107) (-400.062) [-396.821] * (-395.257) (-400.347) (-396.307) [-395.063] -- 0:00:27
557000 -- (-397.919) (-396.686) [-397.705] (-397.700) * (-395.751) (-396.367) (-396.108) [-395.062] -- 0:00:27
557500 -- (-396.744) [-398.300] (-397.843) (-396.507) * (-397.473) (-398.719) (-398.467) [-396.802] -- 0:00:26
558000 -- (-395.012) (-395.494) [-397.440] (-396.842) * (-398.651) [-394.302] (-398.498) (-398.973) -- 0:00:26
558500 -- [-394.666] (-399.312) (-402.951) (-397.836) * [-395.415] (-396.973) (-397.229) (-398.799) -- 0:00:26
559000 -- (-396.229) (-397.231) [-397.760] (-396.431) * [-397.213] (-394.562) (-395.899) (-398.106) -- 0:00:26
559500 -- (-398.277) [-395.027] (-397.334) (-397.236) * (-397.808) [-394.797] (-395.678) (-395.785) -- 0:00:26
560000 -- (-395.658) (-395.114) [-397.639] (-397.123) * (-396.114) (-394.509) [-395.896] (-396.366) -- 0:00:26
Average standard deviation of split frequencies: 0.007287
560500 -- (-394.784) (-400.483) (-395.431) [-395.421] * (-395.380) (-395.268) (-396.887) [-395.268] -- 0:00:26
561000 -- (-395.541) [-396.449] (-398.031) (-400.092) * (-394.353) (-396.377) (-395.105) [-395.871] -- 0:00:26
561500 -- (-398.695) [-396.638] (-396.483) (-396.770) * [-395.769] (-397.692) (-394.756) (-396.139) -- 0:00:26
562000 -- (-400.070) [-394.851] (-395.097) (-395.833) * [-395.548] (-396.403) (-395.363) (-395.124) -- 0:00:26
562500 -- (-402.455) (-397.201) [-398.014] (-396.094) * (-396.381) (-396.429) [-397.197] (-399.748) -- 0:00:26
563000 -- (-398.887) (-395.747) (-399.307) [-395.396] * (-395.231) (-396.945) (-399.023) [-397.710] -- 0:00:26
563500 -- (-396.729) (-395.041) [-399.560] (-396.638) * (-395.630) [-394.913] (-396.097) (-399.969) -- 0:00:26
564000 -- [-399.039] (-395.375) (-401.014) (-395.614) * (-396.276) [-395.967] (-396.253) (-394.882) -- 0:00:26
564500 -- (-397.142) [-397.600] (-395.476) (-395.395) * (-394.617) (-398.145) (-397.077) [-394.990] -- 0:00:26
565000 -- (-394.110) (-398.045) [-394.940] (-399.911) * (-396.087) (-394.857) [-396.031] (-398.209) -- 0:00:26
Average standard deviation of split frequencies: 0.007052
565500 -- (-399.990) (-398.739) [-399.567] (-398.318) * [-395.648] (-395.152) (-394.762) (-396.701) -- 0:00:26
566000 -- (-396.426) [-395.597] (-398.381) (-394.978) * [-395.121] (-396.830) (-395.486) (-394.819) -- 0:00:26
566500 -- [-398.483] (-396.287) (-396.366) (-395.178) * (-395.969) (-396.751) [-397.303] (-396.684) -- 0:00:26
567000 -- (-399.412) (-397.074) [-395.008] (-396.450) * (-396.315) (-396.065) (-398.579) [-398.756] -- 0:00:25
567500 -- (-396.745) [-396.439] (-396.643) (-399.482) * [-397.198] (-398.422) (-395.963) (-394.892) -- 0:00:26
568000 -- (-396.631) (-396.507) (-396.294) [-397.253] * (-400.350) (-396.843) (-400.800) [-394.811] -- 0:00:26
568500 -- (-398.395) (-397.774) (-399.686) [-395.694] * (-400.802) (-396.846) (-395.815) [-394.378] -- 0:00:26
569000 -- [-396.807] (-399.313) (-401.363) (-395.079) * [-395.550] (-397.096) (-396.136) (-396.524) -- 0:00:26
569500 -- (-397.827) (-397.045) [-396.124] (-396.929) * [-396.238] (-394.359) (-395.906) (-397.880) -- 0:00:26
570000 -- [-395.502] (-394.649) (-396.627) (-397.501) * (-396.329) (-395.174) [-396.139] (-397.048) -- 0:00:26
Average standard deviation of split frequencies: 0.007269
570500 -- [-396.275] (-395.029) (-395.618) (-395.684) * [-396.670] (-397.794) (-399.829) (-395.551) -- 0:00:26
571000 -- (-396.338) (-396.885) (-395.352) [-396.327] * (-397.573) (-398.470) [-398.177] (-396.947) -- 0:00:26
571500 -- [-395.827] (-396.006) (-397.577) (-396.178) * [-396.424] (-397.608) (-398.990) (-397.514) -- 0:00:26
572000 -- [-396.202] (-395.949) (-400.480) (-395.880) * (-395.463) (-397.877) (-396.140) [-395.359] -- 0:00:26
572500 -- (-395.111) [-395.187] (-398.553) (-395.355) * [-396.762] (-400.533) (-395.981) (-398.622) -- 0:00:26
573000 -- (-394.648) [-395.143] (-396.262) (-397.321) * [-398.758] (-397.254) (-394.264) (-398.063) -- 0:00:26
573500 -- (-394.482) (-394.797) (-397.043) [-397.769] * (-398.065) (-396.653) (-394.362) [-396.956] -- 0:00:26
574000 -- (-395.346) [-395.231] (-396.889) (-399.287) * (-395.819) (-397.040) [-396.310] (-396.971) -- 0:00:25
574500 -- (-399.736) (-398.735) [-396.156] (-397.468) * [-397.665] (-396.392) (-394.016) (-394.562) -- 0:00:25
575000 -- (-394.369) [-395.395] (-394.085) (-398.374) * (-401.918) [-394.017] (-398.228) (-396.225) -- 0:00:25
Average standard deviation of split frequencies: 0.007202
575500 -- [-395.829] (-395.320) (-396.679) (-399.311) * (-397.056) (-395.516) [-396.989] (-395.703) -- 0:00:25
576000 -- (-397.692) (-397.497) [-399.768] (-398.334) * (-397.324) (-402.619) [-394.952] (-394.872) -- 0:00:25
576500 -- [-396.161] (-399.820) (-395.888) (-398.782) * (-396.660) [-396.153] (-396.671) (-394.922) -- 0:00:25
577000 -- (-394.828) (-399.211) [-395.149] (-395.719) * (-395.888) [-396.169] (-399.046) (-395.578) -- 0:00:25
577500 -- (-398.529) [-397.294] (-394.132) (-394.304) * (-397.867) (-395.944) [-396.614] (-397.336) -- 0:00:25
578000 -- (-397.961) (-394.500) (-395.808) [-394.681] * (-395.386) [-398.825] (-394.912) (-398.450) -- 0:00:25
578500 -- (-394.777) (-396.637) (-400.484) [-396.298] * (-394.543) (-399.818) [-395.374] (-396.074) -- 0:00:25
579000 -- (-394.843) (-395.501) [-397.820] (-395.715) * (-397.067) (-399.160) (-396.491) [-396.213] -- 0:00:25
579500 -- (-395.509) (-397.236) [-395.060] (-394.779) * (-397.208) [-394.149] (-397.907) (-397.281) -- 0:00:25
580000 -- [-395.653] (-395.630) (-396.740) (-397.087) * (-398.930) [-395.061] (-398.470) (-397.151) -- 0:00:25
Average standard deviation of split frequencies: 0.007002
580500 -- (-394.504) (-395.941) (-401.058) [-395.207] * (-395.511) [-395.829] (-397.359) (-395.264) -- 0:00:25
581000 -- (-394.557) (-394.364) [-396.359] (-397.828) * (-395.150) (-401.322) (-399.053) [-395.327] -- 0:00:25
581500 -- (-397.596) (-396.571) [-395.072] (-398.192) * [-395.208] (-396.165) (-398.194) (-401.567) -- 0:00:25
582000 -- (-402.987) [-395.261] (-395.143) (-394.776) * [-397.490] (-395.401) (-395.435) (-397.042) -- 0:00:25
582500 -- (-394.668) (-397.115) [-397.046] (-394.042) * [-394.555] (-397.116) (-396.758) (-398.997) -- 0:00:25
583000 -- [-395.584] (-395.285) (-399.214) (-395.800) * (-398.119) (-398.052) (-397.576) [-397.255] -- 0:00:25
583500 -- [-395.559] (-395.206) (-398.047) (-399.218) * (-398.185) (-395.174) [-394.501] (-399.075) -- 0:00:24
584000 -- (-394.878) [-394.954] (-395.903) (-397.288) * (-395.275) (-396.524) [-396.635] (-397.375) -- 0:00:24
584500 -- (-396.961) (-395.756) (-395.923) [-396.124] * [-394.709] (-396.158) (-398.456) (-396.506) -- 0:00:25
585000 -- (-400.230) (-394.821) (-396.819) [-394.973] * [-396.714] (-398.143) (-396.093) (-400.413) -- 0:00:25
Average standard deviation of split frequencies: 0.007089
585500 -- (-397.593) (-395.334) (-395.334) [-395.768] * (-395.902) [-400.689] (-398.176) (-398.726) -- 0:00:25
586000 -- (-396.661) (-396.971) [-395.853] (-397.299) * [-397.746] (-395.685) (-395.791) (-395.105) -- 0:00:25
586500 -- [-394.995] (-395.703) (-394.615) (-396.989) * (-394.311) (-397.506) (-397.389) [-396.308] -- 0:00:25
587000 -- (-396.398) (-396.493) [-397.472] (-394.692) * (-398.512) (-396.535) (-399.348) [-395.110] -- 0:00:25
587500 -- (-396.149) (-397.371) (-395.519) [-397.357] * (-397.429) (-395.685) [-398.605] (-397.255) -- 0:00:25
588000 -- [-396.722] (-396.493) (-396.217) (-396.902) * (-395.938) (-395.744) (-398.476) [-395.862] -- 0:00:25
588500 -- (-396.143) [-395.298] (-395.133) (-394.248) * (-394.842) (-398.179) [-400.672] (-394.713) -- 0:00:25
589000 -- (-396.723) (-396.150) (-397.676) [-400.496] * [-394.989] (-394.879) (-396.504) (-400.198) -- 0:00:25
589500 -- [-397.592] (-398.379) (-394.832) (-399.062) * (-397.790) (-394.785) [-395.790] (-394.798) -- 0:00:25
590000 -- (-397.537) [-396.037] (-395.983) (-400.204) * (-396.235) (-395.532) (-395.271) [-394.271] -- 0:00:25
Average standard deviation of split frequencies: 0.006884
590500 -- (-397.470) (-394.639) [-395.825] (-395.588) * [-395.167] (-395.779) (-397.715) (-395.645) -- 0:00:24
591000 -- (-395.610) (-400.272) [-399.082] (-403.957) * [-395.274] (-396.357) (-396.287) (-394.143) -- 0:00:24
591500 -- (-399.147) (-400.984) [-397.542] (-395.327) * (-397.386) [-398.741] (-397.101) (-402.311) -- 0:00:24
592000 -- (-394.857) (-397.514) (-397.594) [-397.588] * [-398.512] (-397.020) (-396.248) (-402.407) -- 0:00:24
592500 -- (-394.551) (-395.730) [-397.535] (-395.222) * [-397.733] (-394.777) (-394.423) (-396.753) -- 0:00:24
593000 -- (-397.489) (-395.283) (-394.600) [-396.192] * (-397.524) (-396.333) (-395.281) [-396.738] -- 0:00:24
593500 -- [-398.843] (-396.907) (-402.434) (-401.785) * (-394.690) (-398.561) [-396.775] (-398.841) -- 0:00:24
594000 -- (-397.084) (-396.218) (-395.041) [-397.612] * [-395.490] (-396.985) (-395.141) (-397.155) -- 0:00:24
594500 -- (-395.089) [-394.934] (-398.343) (-397.547) * (-397.519) (-395.154) [-395.458] (-398.144) -- 0:00:24
595000 -- (-395.668) (-394.576) (-394.718) [-398.410] * (-397.269) (-394.920) (-397.137) [-398.055] -- 0:00:24
Average standard deviation of split frequencies: 0.006674
595500 -- (-394.692) (-395.495) [-397.512] (-395.928) * [-395.702] (-396.278) (-397.983) (-396.288) -- 0:00:24
596000 -- [-394.949] (-395.640) (-397.376) (-395.382) * [-394.483] (-396.566) (-395.115) (-395.794) -- 0:00:24
596500 -- (-395.786) [-395.938] (-394.992) (-396.374) * (-399.833) [-394.764] (-396.545) (-397.952) -- 0:00:24
597000 -- (-397.937) [-397.996] (-400.331) (-396.078) * (-396.121) (-394.957) [-394.405] (-394.596) -- 0:00:24
597500 -- (-401.553) (-396.798) [-395.681] (-395.636) * (-396.311) (-396.006) [-399.107] (-395.466) -- 0:00:24
598000 -- (-398.251) (-399.472) [-395.854] (-400.629) * (-397.417) (-398.810) (-398.714) [-397.215] -- 0:00:24
598500 -- (-396.867) [-394.838] (-394.479) (-397.651) * (-398.401) (-395.008) [-400.785] (-397.621) -- 0:00:24
599000 -- [-398.743] (-399.610) (-396.532) (-395.045) * (-395.554) [-395.019] (-396.515) (-395.126) -- 0:00:24
599500 -- (-395.339) (-396.695) [-399.345] (-396.957) * (-395.632) (-396.544) (-395.789) [-398.659] -- 0:00:24
600000 -- [-394.204] (-397.933) (-399.620) (-397.171) * (-396.492) (-396.999) [-395.345] (-396.682) -- 0:00:24
Average standard deviation of split frequencies: 0.006622
600500 -- (-396.349) (-397.555) (-395.419) [-394.521] * (-396.177) [-394.071] (-395.356) (-396.184) -- 0:00:23
601000 -- (-395.933) (-397.213) [-395.369] (-395.800) * (-394.812) [-394.984] (-395.983) (-397.507) -- 0:00:24
601500 -- (-399.469) (-395.801) [-395.097] (-395.579) * (-396.699) (-394.873) [-397.714] (-397.061) -- 0:00:24
602000 -- (-395.653) (-398.052) [-395.966] (-397.316) * [-394.361] (-395.941) (-400.232) (-395.381) -- 0:00:24
602500 -- (-396.804) (-397.428) (-396.990) [-395.371] * (-400.256) [-395.995] (-397.196) (-396.245) -- 0:00:24
603000 -- (-406.878) (-396.090) [-394.776] (-395.817) * (-394.363) (-394.948) [-398.989] (-395.104) -- 0:00:24
603500 -- (-398.220) (-399.628) (-396.620) [-396.769] * (-394.694) (-394.934) (-396.218) [-395.183] -- 0:00:24
604000 -- (-399.506) (-398.040) (-395.175) [-397.561] * (-395.554) [-397.897] (-395.920) (-397.711) -- 0:00:24
604500 -- (-394.462) [-394.665] (-395.897) (-396.061) * (-394.333) (-399.169) [-395.414] (-396.876) -- 0:00:24
605000 -- (-395.947) (-396.230) (-394.229) [-395.451] * (-397.029) (-398.999) [-394.300] (-396.533) -- 0:00:24
Average standard deviation of split frequencies: 0.006855
605500 -- [-399.908] (-396.217) (-397.213) (-395.397) * [-396.689] (-397.530) (-396.757) (-396.645) -- 0:00:24
606000 -- (-397.334) [-401.338] (-396.344) (-397.867) * [-396.274] (-397.383) (-398.130) (-397.785) -- 0:00:24
606500 -- (-396.403) (-405.851) (-395.845) [-396.358] * (-405.807) (-396.592) (-396.919) [-396.414] -- 0:00:24
607000 -- (-395.076) (-398.096) [-396.811] (-398.722) * (-397.718) [-397.206] (-397.547) (-396.935) -- 0:00:23
607500 -- (-396.047) (-402.180) (-398.029) [-395.696] * (-398.417) [-395.919] (-395.827) (-396.597) -- 0:00:23
608000 -- (-397.093) (-397.685) (-398.385) [-397.549] * (-395.997) (-395.659) (-399.106) [-399.415] -- 0:00:23
608500 -- (-398.217) [-395.617] (-396.570) (-394.814) * (-395.783) [-396.438] (-399.463) (-397.662) -- 0:00:23
609000 -- (-396.912) (-397.378) [-398.100] (-394.992) * (-394.922) [-394.222] (-396.691) (-395.904) -- 0:00:23
609500 -- (-397.387) (-399.467) [-397.242] (-396.387) * (-395.598) (-394.188) [-395.383] (-396.285) -- 0:00:23
610000 -- (-397.399) (-397.435) [-394.494] (-397.654) * (-395.515) (-399.148) [-395.961] (-398.590) -- 0:00:23
Average standard deviation of split frequencies: 0.007141
610500 -- (-394.332) (-394.908) [-396.500] (-396.691) * (-394.699) (-398.143) (-396.602) [-395.845] -- 0:00:23
611000 -- (-394.522) [-397.910] (-398.873) (-395.568) * [-394.516] (-397.958) (-394.639) (-397.028) -- 0:00:23
611500 -- (-395.490) (-394.740) [-395.583] (-394.098) * (-396.667) (-399.406) [-397.125] (-400.006) -- 0:00:23
612000 -- (-396.247) [-394.268] (-396.354) (-395.244) * [-395.454] (-398.596) (-395.480) (-395.953) -- 0:00:23
612500 -- (-396.379) (-396.840) (-395.404) [-396.107] * (-398.971) (-394.848) [-394.590] (-399.483) -- 0:00:23
613000 -- (-394.541) (-396.728) (-395.667) [-397.370] * (-395.317) (-398.037) [-394.879] (-395.951) -- 0:00:23
613500 -- (-395.049) (-397.042) [-397.113] (-394.823) * [-394.316] (-394.428) (-397.057) (-395.592) -- 0:00:23
614000 -- (-394.815) [-396.663] (-395.530) (-396.191) * (-395.125) [-396.207] (-394.696) (-394.377) -- 0:00:23
614500 -- [-394.985] (-395.948) (-396.674) (-396.348) * (-396.357) (-395.211) (-396.926) [-397.072] -- 0:00:23
615000 -- (-394.825) [-396.439] (-395.416) (-395.355) * [-396.967] (-399.407) (-394.913) (-398.408) -- 0:00:23
Average standard deviation of split frequencies: 0.007461
615500 -- [-395.585] (-395.183) (-394.578) (-398.928) * (-395.872) (-395.621) [-395.398] (-397.102) -- 0:00:23
616000 -- (-395.580) (-398.806) (-398.595) [-396.605] * (-398.588) (-398.248) [-398.624] (-397.751) -- 0:00:23
616500 -- (-395.454) [-394.578] (-395.836) (-394.775) * (-399.027) (-400.637) (-396.215) [-395.008] -- 0:00:23
617000 -- (-395.848) (-396.360) (-398.333) [-394.695] * (-397.003) [-395.575] (-396.445) (-397.859) -- 0:00:22
617500 -- (-396.237) (-396.437) (-398.666) [-394.859] * [-399.168] (-396.008) (-397.628) (-397.340) -- 0:00:23
618000 -- (-394.920) [-397.145] (-399.752) (-395.762) * (-399.144) (-394.785) [-397.394] (-401.629) -- 0:00:23
618500 -- (-398.321) (-395.792) [-397.216] (-396.149) * (-403.035) [-396.745] (-395.511) (-402.499) -- 0:00:23
619000 -- [-395.823] (-395.432) (-400.498) (-396.474) * [-400.395] (-398.895) (-397.034) (-400.781) -- 0:00:23
619500 -- (-398.181) (-396.644) [-400.939] (-395.984) * (-396.951) (-394.378) [-395.625] (-397.565) -- 0:00:23
620000 -- (-399.151) [-396.928] (-400.190) (-397.833) * (-398.253) [-394.473] (-396.141) (-398.955) -- 0:00:23
Average standard deviation of split frequencies: 0.007738
620500 -- (-396.726) [-394.679] (-398.805) (-397.543) * (-399.354) (-398.175) (-394.781) [-394.411] -- 0:00:23
621000 -- (-399.501) [-394.921] (-400.697) (-400.816) * [-396.912] (-397.717) (-396.022) (-394.793) -- 0:00:23
621500 -- (-402.421) [-395.486] (-399.147) (-396.622) * (-395.145) [-396.329] (-396.259) (-395.048) -- 0:00:23
622000 -- (-397.541) (-397.650) (-395.070) [-397.545] * (-395.679) [-396.120] (-397.984) (-396.168) -- 0:00:23
622500 -- [-397.048] (-398.107) (-395.157) (-398.149) * (-395.038) [-394.899] (-398.173) (-396.467) -- 0:00:23
623000 -- [-395.695] (-396.026) (-394.624) (-394.667) * (-395.268) (-395.151) (-399.562) [-397.808] -- 0:00:22
623500 -- (-394.824) [-394.891] (-396.580) (-395.327) * (-404.767) [-399.944] (-396.140) (-397.584) -- 0:00:22
624000 -- (-395.013) (-398.357) [-397.289] (-396.144) * (-398.917) (-396.369) (-396.864) [-397.401] -- 0:00:22
624500 -- [-395.326] (-398.507) (-397.741) (-395.994) * (-396.644) [-394.344] (-398.460) (-397.638) -- 0:00:22
625000 -- [-395.944] (-396.225) (-396.834) (-395.535) * (-396.926) (-396.495) (-400.575) [-396.013] -- 0:00:22
Average standard deviation of split frequencies: 0.008001
625500 -- (-398.453) (-397.187) [-399.801] (-398.865) * (-400.336) (-394.382) (-399.913) [-396.097] -- 0:00:22
626000 -- (-394.372) [-394.706] (-401.500) (-397.352) * (-395.579) (-395.306) (-398.656) [-396.325] -- 0:00:22
626500 -- (-396.360) [-397.159] (-395.251) (-401.920) * [-399.108] (-396.579) (-396.383) (-398.471) -- 0:00:22
627000 -- (-397.158) (-396.181) (-396.440) [-395.288] * (-395.021) (-400.293) (-396.976) [-396.906] -- 0:00:22
627500 -- (-396.117) [-397.949] (-396.277) (-398.041) * (-396.116) [-397.840] (-397.395) (-397.419) -- 0:00:22
628000 -- (-395.075) [-394.743] (-396.952) (-395.375) * [-398.009] (-395.913) (-397.769) (-398.613) -- 0:00:22
628500 -- (-396.535) (-399.072) (-397.492) [-394.597] * (-395.359) (-398.352) [-395.220] (-395.262) -- 0:00:22
629000 -- (-397.987) (-397.538) [-397.316] (-394.120) * (-397.804) [-395.390] (-394.984) (-395.900) -- 0:00:22
629500 -- (-399.425) (-396.936) (-394.141) [-394.074] * (-394.411) (-396.703) [-395.365] (-399.050) -- 0:00:22
630000 -- (-394.979) [-396.725] (-395.657) (-396.242) * (-394.439) [-396.526] (-396.811) (-400.336) -- 0:00:22
Average standard deviation of split frequencies: 0.008175
630500 -- [-395.321] (-396.313) (-395.973) (-396.573) * (-394.290) (-397.463) (-395.405) [-394.395] -- 0:00:22
631000 -- [-394.704] (-396.671) (-395.028) (-395.680) * (-395.410) (-396.947) [-395.411] (-394.397) -- 0:00:22
631500 -- (-396.601) (-395.356) (-396.261) [-394.509] * [-399.412] (-394.935) (-401.286) (-394.370) -- 0:00:22
632000 -- (-397.311) (-397.974) (-395.260) [-394.566] * (-396.983) (-394.896) (-400.467) [-397.533] -- 0:00:22
632500 -- (-395.899) (-396.891) [-398.581] (-394.979) * (-394.797) (-397.274) [-396.952] (-395.045) -- 0:00:22
633000 -- (-397.486) (-394.085) [-396.074] (-395.305) * (-394.715) (-396.800) [-397.035] (-395.610) -- 0:00:22
633500 -- [-397.203] (-395.188) (-397.892) (-394.495) * (-396.809) [-400.789] (-395.660) (-395.524) -- 0:00:21
634000 -- [-397.042] (-396.406) (-395.790) (-394.789) * (-398.547) (-398.374) (-398.904) [-395.361] -- 0:00:21
634500 -- (-395.815) (-396.809) [-399.138] (-396.033) * [-396.198] (-398.119) (-400.418) (-397.129) -- 0:00:22
635000 -- (-396.486) (-403.450) [-395.569] (-396.374) * (-395.216) [-394.539] (-395.820) (-398.680) -- 0:00:22
Average standard deviation of split frequencies: 0.008616
635500 -- [-395.714] (-397.817) (-396.478) (-399.031) * (-395.077) [-395.298] (-399.825) (-397.411) -- 0:00:22
636000 -- [-396.928] (-397.454) (-396.016) (-397.846) * (-396.319) [-394.739] (-398.670) (-394.659) -- 0:00:22
636500 -- (-399.855) (-394.485) [-396.129] (-399.524) * [-396.438] (-395.869) (-398.826) (-395.261) -- 0:00:22
637000 -- (-398.807) (-395.472) [-395.060] (-395.139) * (-400.671) (-394.942) (-394.483) [-394.592] -- 0:00:22
637500 -- (-404.256) (-394.486) (-394.484) [-399.687] * (-398.412) [-395.200] (-394.182) (-398.401) -- 0:00:22
638000 -- [-394.581] (-398.548) (-400.394) (-394.048) * (-395.088) [-395.216] (-394.004) (-395.194) -- 0:00:22
638500 -- (-396.356) [-399.776] (-402.056) (-396.233) * (-394.238) (-396.804) (-396.446) [-397.360] -- 0:00:22
639000 -- (-396.601) (-397.206) [-395.712] (-397.776) * [-394.340] (-398.120) (-400.110) (-397.461) -- 0:00:22
639500 -- (-397.722) (-399.842) [-396.170] (-400.641) * (-397.912) (-395.775) [-397.140] (-398.140) -- 0:00:21
640000 -- (-398.114) (-394.609) (-396.163) [-395.793] * (-405.370) (-407.454) [-395.296] (-396.630) -- 0:00:21
Average standard deviation of split frequencies: 0.008646
640500 -- (-397.030) (-399.478) (-397.774) [-398.730] * (-397.930) (-402.913) (-399.608) [-395.587] -- 0:00:21
641000 -- (-396.435) (-396.042) (-396.590) [-394.756] * (-396.216) [-400.921] (-397.706) (-395.869) -- 0:00:21
641500 -- (-401.508) (-394.986) (-396.744) [-394.322] * (-397.324) (-395.070) [-398.429] (-398.113) -- 0:00:21
642000 -- (-399.395) (-396.181) [-398.393] (-398.245) * (-394.516) (-398.489) (-397.722) [-396.061] -- 0:00:21
642500 -- (-397.134) [-395.392] (-396.712) (-395.313) * [-396.152] (-395.181) (-399.700) (-394.292) -- 0:00:21
643000 -- [-397.750] (-400.796) (-396.969) (-397.170) * (-399.276) (-395.348) (-402.132) [-396.853] -- 0:00:21
643500 -- (-397.181) (-397.136) (-394.959) [-396.995] * [-401.089] (-398.330) (-398.087) (-396.319) -- 0:00:21
644000 -- [-395.249] (-395.659) (-395.140) (-394.452) * [-396.558] (-396.658) (-396.639) (-396.521) -- 0:00:21
644500 -- (-396.068) (-399.753) (-395.051) [-395.120] * (-398.563) (-398.204) [-396.027] (-395.074) -- 0:00:21
645000 -- (-395.391) (-398.102) [-395.370] (-396.039) * (-396.675) (-399.131) (-398.038) [-397.469] -- 0:00:21
Average standard deviation of split frequencies: 0.008346
645500 -- (-396.949) (-397.747) [-397.019] (-395.465) * (-396.524) [-397.200] (-395.889) (-398.338) -- 0:00:21
646000 -- (-399.500) (-398.624) (-396.481) [-396.002] * (-394.960) (-395.724) [-394.920] (-395.184) -- 0:00:21
646500 -- (-395.014) [-400.318] (-400.821) (-394.866) * [-395.315] (-395.972) (-399.924) (-400.923) -- 0:00:21
647000 -- [-396.298] (-399.963) (-396.578) (-397.707) * [-394.931] (-396.607) (-394.783) (-395.060) -- 0:00:21
647500 -- (-395.860) [-397.494] (-397.295) (-395.653) * (-398.099) (-398.958) (-397.674) [-395.445] -- 0:00:21
648000 -- (-396.742) (-396.908) (-398.003) [-396.746] * [-397.904] (-395.570) (-394.261) (-395.487) -- 0:00:21
648500 -- (-397.027) (-395.892) (-396.162) [-395.219] * (-397.208) [-400.517] (-395.315) (-396.402) -- 0:00:21
649000 -- (-399.979) (-394.912) [-394.579] (-398.512) * (-394.561) [-398.548] (-395.260) (-402.350) -- 0:00:21
649500 -- (-401.365) (-397.011) (-394.887) [-398.439] * (-396.908) [-398.745] (-398.492) (-399.119) -- 0:00:21
650000 -- (-396.674) [-397.101] (-394.770) (-398.192) * (-395.463) [-395.098] (-395.264) (-397.356) -- 0:00:21
Average standard deviation of split frequencies: 0.008784
650500 -- (-394.903) (-398.372) [-395.550] (-400.871) * [-394.480] (-395.188) (-395.150) (-396.111) -- 0:00:20
651000 -- (-395.231) (-400.828) (-399.644) [-395.109] * (-397.968) (-396.994) [-394.443] (-398.354) -- 0:00:20
651500 -- [-394.777] (-394.616) (-399.263) (-394.874) * [-394.402] (-397.620) (-395.103) (-399.697) -- 0:00:21
652000 -- [-394.311] (-395.817) (-397.622) (-396.001) * (-395.846) (-397.591) [-395.825] (-401.160) -- 0:00:21
652500 -- (-395.074) [-396.894] (-397.352) (-395.862) * (-395.339) [-397.393] (-396.291) (-398.410) -- 0:00:21
653000 -- (-400.249) (-395.627) [-394.619] (-394.365) * (-396.956) [-402.273] (-396.366) (-397.141) -- 0:00:21
653500 -- (-395.129) [-395.137] (-394.780) (-396.437) * (-400.555) [-396.170] (-395.230) (-396.756) -- 0:00:21
654000 -- (-395.463) [-395.663] (-394.809) (-395.723) * (-396.746) (-397.506) [-397.199] (-395.299) -- 0:00:21
654500 -- (-395.722) [-396.819] (-394.694) (-395.808) * [-396.796] (-399.869) (-394.587) (-398.490) -- 0:00:21
655000 -- [-394.440] (-396.754) (-394.766) (-396.476) * (-396.449) (-395.461) (-397.051) [-397.046] -- 0:00:21
Average standard deviation of split frequencies: 0.008219
655500 -- (-394.526) (-395.671) [-394.022] (-397.010) * [-395.689] (-394.965) (-399.031) (-396.006) -- 0:00:21
656000 -- (-395.800) [-394.405] (-394.731) (-395.513) * (-396.244) (-396.461) [-395.168] (-395.552) -- 0:00:20
656500 -- [-395.570] (-396.301) (-395.309) (-398.559) * [-395.769] (-394.439) (-397.492) (-395.541) -- 0:00:20
657000 -- [-394.393] (-399.199) (-394.491) (-397.123) * [-394.427] (-399.484) (-401.429) (-396.885) -- 0:00:20
657500 -- [-395.409] (-396.046) (-395.176) (-396.396) * (-394.554) (-396.668) [-396.892] (-396.241) -- 0:00:20
658000 -- (-396.370) (-397.000) (-396.893) [-395.054] * [-396.392] (-395.969) (-397.660) (-395.595) -- 0:00:20
658500 -- (-396.558) (-399.273) (-395.992) [-397.095] * [-402.208] (-395.078) (-397.893) (-394.887) -- 0:00:20
659000 -- [-396.144] (-396.803) (-396.383) (-396.721) * [-394.938] (-395.111) (-395.789) (-395.070) -- 0:00:20
659500 -- (-395.454) (-395.293) (-397.360) [-396.766] * (-395.358) (-394.203) (-394.665) [-394.462] -- 0:00:20
660000 -- (-398.678) (-396.214) [-395.643] (-394.403) * (-396.693) (-394.341) [-394.940] (-395.846) -- 0:00:20
Average standard deviation of split frequencies: 0.008072
660500 -- (-395.932) [-397.276] (-397.897) (-395.413) * [-397.213] (-397.735) (-398.196) (-396.441) -- 0:00:20
661000 -- (-395.960) (-398.838) [-395.477] (-398.437) * [-401.563] (-403.458) (-394.870) (-398.401) -- 0:00:20
661500 -- (-399.501) (-399.050) [-395.542] (-401.519) * (-395.051) [-394.922] (-394.879) (-398.124) -- 0:00:20
662000 -- (-398.924) [-397.637] (-395.216) (-397.109) * (-393.996) [-394.896] (-395.125) (-399.163) -- 0:00:20
662500 -- [-395.954] (-396.186) (-397.724) (-396.566) * (-393.996) [-395.594] (-395.586) (-396.176) -- 0:00:20
663000 -- [-394.946] (-399.175) (-397.496) (-400.366) * (-394.189) (-397.269) [-395.886] (-395.420) -- 0:00:20
663500 -- (-395.586) [-395.938] (-399.799) (-399.038) * (-400.393) (-401.884) [-395.779] (-394.901) -- 0:00:20
664000 -- (-395.869) (-397.526) (-398.284) [-395.540] * [-396.687] (-397.064) (-397.554) (-395.768) -- 0:00:20
664500 -- [-395.456] (-397.273) (-395.816) (-399.192) * [-397.096] (-394.529) (-395.974) (-395.487) -- 0:00:20
665000 -- (-399.489) (-395.312) (-395.348) [-398.130] * [-396.531] (-396.142) (-395.752) (-394.108) -- 0:00:20
Average standard deviation of split frequencies: 0.007742
665500 -- (-398.704) (-397.311) [-397.395] (-394.536) * [-397.131] (-396.315) (-397.727) (-396.591) -- 0:00:20
666000 -- (-397.669) (-396.328) [-396.966] (-398.383) * [-394.522] (-398.004) (-395.168) (-395.755) -- 0:00:20
666500 -- [-396.761] (-395.115) (-398.649) (-396.376) * [-395.002] (-395.665) (-397.181) (-394.262) -- 0:00:20
667000 -- (-396.060) (-395.156) [-397.108] (-395.132) * (-396.173) [-395.545] (-394.507) (-395.193) -- 0:00:19
667500 -- (-396.783) [-394.745] (-395.716) (-395.724) * (-395.650) (-394.592) (-398.621) [-397.469] -- 0:00:19
668000 -- (-397.426) (-394.599) [-397.990] (-396.398) * (-395.468) (-400.013) (-399.023) [-400.068] -- 0:00:20
668500 -- (-397.827) (-394.653) [-397.255] (-396.982) * [-395.124] (-396.261) (-396.669) (-398.403) -- 0:00:20
669000 -- [-396.247] (-395.984) (-395.573) (-396.398) * (-394.624) [-394.888] (-396.374) (-395.515) -- 0:00:20
669500 -- (-395.613) (-398.230) [-395.496] (-394.283) * (-396.613) (-394.771) [-394.500] (-396.638) -- 0:00:20
670000 -- (-394.939) (-395.621) [-396.061] (-397.769) * (-395.881) [-394.274] (-397.451) (-395.018) -- 0:00:20
Average standard deviation of split frequencies: 0.007556
670500 -- [-395.026] (-398.121) (-398.392) (-398.476) * (-396.867) (-396.282) [-396.573] (-394.831) -- 0:00:20
671000 -- (-397.190) (-397.063) (-395.223) [-395.410] * (-397.262) [-394.958] (-396.237) (-394.611) -- 0:00:20
671500 -- (-394.699) [-401.472] (-396.498) (-396.147) * [-395.988] (-394.947) (-397.685) (-396.859) -- 0:00:20
672000 -- [-396.730] (-397.481) (-394.648) (-396.390) * (-394.123) (-397.985) [-395.088] (-397.550) -- 0:00:20
672500 -- (-396.132) (-395.150) (-395.542) [-398.041] * (-394.950) (-395.228) [-395.494] (-396.525) -- 0:00:19
673000 -- (-397.004) (-394.866) [-396.648] (-397.279) * (-398.757) (-396.592) (-394.131) [-397.913] -- 0:00:19
673500 -- (-398.570) (-399.855) (-398.533) [-395.259] * (-402.344) (-396.409) [-394.813] (-399.639) -- 0:00:19
674000 -- [-394.754] (-397.742) (-397.598) (-395.794) * (-399.577) (-397.167) (-395.485) [-395.091] -- 0:00:19
674500 -- [-396.890] (-397.309) (-395.524) (-394.556) * (-397.607) (-394.739) [-395.547] (-394.934) -- 0:00:19
675000 -- (-399.597) (-395.769) [-394.757] (-395.175) * (-396.293) (-395.912) [-395.171] (-395.107) -- 0:00:19
Average standard deviation of split frequencies: 0.007017
675500 -- (-398.230) (-400.654) (-394.432) [-394.223] * (-395.712) (-398.332) [-396.156] (-395.113) -- 0:00:19
676000 -- (-398.287) (-397.547) (-396.853) [-394.213] * (-397.176) (-396.236) (-399.450) [-399.530] -- 0:00:19
676500 -- (-397.193) [-394.886] (-398.032) (-394.213) * [-395.878] (-395.627) (-399.126) (-396.804) -- 0:00:19
677000 -- (-401.372) [-399.990] (-395.708) (-395.940) * (-401.817) (-395.691) (-397.365) [-395.000] -- 0:00:19
677500 -- [-395.696] (-396.999) (-396.333) (-396.243) * [-396.717] (-396.144) (-398.049) (-398.349) -- 0:00:19
678000 -- [-396.748] (-396.084) (-397.625) (-398.662) * (-394.085) (-399.204) (-394.394) [-396.562] -- 0:00:19
678500 -- (-395.483) (-394.291) (-395.092) [-398.524] * (-398.954) [-397.514] (-401.059) (-397.221) -- 0:00:19
679000 -- (-397.575) (-394.412) (-394.640) [-396.443] * (-397.467) (-395.916) (-401.999) [-401.379] -- 0:00:19
679500 -- (-397.219) (-398.980) [-394.559] (-395.021) * (-395.936) [-395.536] (-401.511) (-398.968) -- 0:00:19
680000 -- (-396.912) (-397.100) [-398.398] (-396.703) * (-396.510) [-396.461] (-396.581) (-397.531) -- 0:00:19
Average standard deviation of split frequencies: 0.006882
680500 -- (-397.784) [-397.599] (-397.195) (-396.200) * (-395.811) (-395.845) (-397.863) [-394.940] -- 0:00:19
681000 -- (-395.466) [-398.788] (-395.559) (-396.045) * (-395.960) [-394.135] (-397.505) (-394.720) -- 0:00:19
681500 -- (-395.243) (-396.747) (-396.549) [-397.142] * (-396.766) (-395.576) [-397.038] (-394.683) -- 0:00:19
682000 -- [-396.162] (-396.711) (-394.535) (-396.054) * (-396.747) [-396.215] (-394.824) (-396.449) -- 0:00:19
682500 -- [-395.641] (-402.870) (-395.535) (-395.499) * [-396.469] (-398.613) (-394.514) (-397.962) -- 0:00:19
683000 -- (-396.000) [-395.550] (-396.888) (-395.981) * (-398.144) (-399.376) (-395.496) [-395.741] -- 0:00:19
683500 -- [-395.799] (-398.586) (-397.919) (-396.791) * [-398.342] (-396.199) (-398.471) (-402.046) -- 0:00:18
684000 -- [-397.157] (-398.452) (-397.360) (-395.059) * (-395.674) (-400.653) (-395.525) [-401.202] -- 0:00:19
684500 -- (-397.607) (-395.255) (-397.724) [-395.682] * [-394.776] (-400.853) (-395.149) (-404.686) -- 0:00:19
685000 -- (-398.750) [-394.834] (-397.032) (-395.409) * [-395.795] (-401.846) (-394.471) (-400.016) -- 0:00:19
Average standard deviation of split frequencies: 0.006786
685500 -- [-395.824] (-398.705) (-396.272) (-395.022) * [-396.621] (-394.949) (-394.889) (-397.045) -- 0:00:19
686000 -- (-396.483) [-397.006] (-395.483) (-397.410) * (-396.657) (-394.546) (-395.355) [-396.399] -- 0:00:19
686500 -- (-394.739) (-395.175) [-397.118] (-395.882) * (-395.034) (-396.855) [-395.223] (-397.106) -- 0:00:19
687000 -- (-394.816) (-396.383) [-396.329] (-396.857) * (-394.813) (-395.906) [-396.045] (-398.671) -- 0:00:19
687500 -- (-394.626) (-395.177) [-396.511] (-395.605) * (-395.121) [-399.047] (-400.287) (-404.564) -- 0:00:19
688000 -- (-397.626) (-394.630) (-397.814) [-396.981] * (-394.453) (-397.534) (-395.109) [-397.340] -- 0:00:19
688500 -- (-398.128) [-397.514] (-397.844) (-396.172) * (-399.857) (-396.252) (-397.991) [-395.347] -- 0:00:19
689000 -- [-398.578] (-398.067) (-397.300) (-396.680) * (-394.981) (-396.315) (-395.756) [-397.461] -- 0:00:18
689500 -- [-396.709] (-395.896) (-398.504) (-395.155) * (-394.981) (-396.853) (-394.066) [-396.738] -- 0:00:18
690000 -- (-396.071) [-396.555] (-399.858) (-395.587) * (-395.251) [-395.533] (-393.971) (-396.038) -- 0:00:18
Average standard deviation of split frequencies: 0.006740
690500 -- (-395.266) (-394.313) [-398.220] (-399.255) * (-395.869) (-395.074) [-395.997] (-395.534) -- 0:00:18
691000 -- [-398.283] (-395.180) (-395.600) (-396.750) * [-395.100] (-395.127) (-395.635) (-395.876) -- 0:00:18
691500 -- (-399.567) [-397.916] (-396.350) (-394.874) * (-398.407) (-395.636) [-394.865] (-398.362) -- 0:00:18
692000 -- (-395.121) [-395.604] (-396.611) (-394.419) * (-397.346) [-396.234] (-396.105) (-399.561) -- 0:00:18
692500 -- [-395.795] (-395.151) (-395.134) (-395.546) * (-396.170) [-395.050] (-396.696) (-397.363) -- 0:00:18
693000 -- [-395.718] (-400.370) (-397.938) (-396.566) * [-394.185] (-399.078) (-395.764) (-398.583) -- 0:00:18
693500 -- (-395.278) (-395.225) [-394.729] (-397.713) * (-394.152) (-396.121) [-394.859] (-394.436) -- 0:00:18
694000 -- (-394.695) [-395.231] (-395.282) (-397.830) * (-396.743) (-401.136) (-395.525) [-394.859] -- 0:00:18
694500 -- [-394.065] (-396.465) (-398.201) (-400.941) * (-395.231) (-396.993) (-397.371) [-396.442] -- 0:00:18
695000 -- [-394.428] (-396.980) (-396.325) (-401.687) * [-395.919] (-398.580) (-397.883) (-396.737) -- 0:00:18
Average standard deviation of split frequencies: 0.006813
695500 -- (-394.398) (-395.709) (-394.897) [-394.811] * (-400.891) (-395.706) (-395.796) [-395.598] -- 0:00:18
696000 -- (-396.991) (-394.897) (-395.108) [-398.473] * (-396.072) (-398.326) [-395.703] (-394.969) -- 0:00:18
696500 -- (-396.377) (-396.394) (-394.587) [-396.010] * (-394.480) [-395.558] (-394.554) (-398.423) -- 0:00:18
697000 -- (-397.268) (-401.815) [-396.495] (-395.631) * (-396.037) (-396.653) [-395.028] (-397.438) -- 0:00:18
697500 -- (-398.596) (-403.974) [-399.440] (-395.617) * (-395.432) (-395.712) (-399.362) [-399.041] -- 0:00:18
698000 -- (-395.882) (-397.938) [-395.240] (-396.885) * (-397.102) (-396.064) (-395.206) [-397.608] -- 0:00:18
698500 -- [-396.876] (-396.042) (-397.993) (-395.794) * (-395.556) [-397.263] (-398.827) (-399.189) -- 0:00:18
699000 -- [-399.221] (-396.256) (-394.695) (-396.055) * [-396.337] (-395.705) (-397.780) (-395.635) -- 0:00:18
699500 -- (-395.498) (-401.981) (-395.581) [-395.683] * (-400.251) [-399.573] (-395.438) (-395.426) -- 0:00:18
700000 -- [-399.022] (-394.529) (-398.642) (-395.802) * (-399.529) [-398.587] (-399.189) (-394.424) -- 0:00:18
Average standard deviation of split frequencies: 0.006807
700500 -- (-399.371) (-395.377) [-395.039] (-394.172) * (-395.830) (-396.147) (-395.429) [-396.454] -- 0:00:18
701000 -- (-394.338) (-396.236) (-397.069) [-394.191] * [-395.965] (-395.929) (-398.062) (-398.653) -- 0:00:18
701500 -- (-396.623) (-396.626) (-394.713) [-397.844] * (-396.101) (-402.330) [-395.742] (-395.947) -- 0:00:18
702000 -- [-396.089] (-395.253) (-396.468) (-395.226) * (-395.217) (-398.285) (-396.778) [-397.157] -- 0:00:18
702500 -- (-397.551) (-396.234) [-395.266] (-395.204) * (-395.977) (-397.479) (-396.316) [-396.574] -- 0:00:18
703000 -- [-397.021] (-396.359) (-396.024) (-397.432) * (-399.143) (-398.546) (-395.652) [-395.249] -- 0:00:18
703500 -- (-396.512) (-395.059) (-395.043) [-397.015] * [-396.770] (-398.911) (-397.669) (-395.240) -- 0:00:18
704000 -- (-394.928) (-396.149) [-394.716] (-397.761) * [-395.702] (-397.689) (-398.329) (-394.742) -- 0:00:18
704500 -- (-396.114) (-395.738) (-394.192) [-395.099] * [-395.812] (-395.531) (-395.241) (-399.884) -- 0:00:18
705000 -- (-397.162) (-395.544) (-394.794) [-398.175] * (-396.775) (-395.886) (-395.903) [-396.379] -- 0:00:17
Average standard deviation of split frequencies: 0.006874
705500 -- (-396.689) (-397.798) (-395.031) [-396.624] * [-394.646] (-397.186) (-397.817) (-398.332) -- 0:00:17
706000 -- (-395.760) (-394.684) [-396.143] (-399.938) * [-396.841] (-399.068) (-396.062) (-396.288) -- 0:00:17
706500 -- (-396.512) [-395.371] (-394.639) (-397.674) * (-398.092) [-394.486] (-396.849) (-395.908) -- 0:00:17
707000 -- (-399.518) (-395.641) [-394.999] (-396.645) * (-397.603) [-395.924] (-395.521) (-396.907) -- 0:00:17
707500 -- [-396.641] (-396.055) (-396.077) (-396.261) * (-395.468) (-395.700) [-396.401] (-395.769) -- 0:00:17
708000 -- (-398.817) (-395.233) [-394.348] (-397.433) * [-394.951] (-398.744) (-395.004) (-398.213) -- 0:00:17
708500 -- (-395.905) [-395.084] (-394.555) (-397.658) * (-396.036) [-395.511] (-395.652) (-396.496) -- 0:00:17
709000 -- [-396.076] (-398.192) (-397.709) (-396.160) * (-395.449) (-395.490) (-397.689) [-397.349] -- 0:00:17
709500 -- (-396.594) (-397.905) (-395.060) [-395.394] * [-395.491] (-399.480) (-400.660) (-397.482) -- 0:00:17
710000 -- (-401.584) [-397.112] (-396.241) (-394.495) * (-395.085) (-397.328) [-395.119] (-398.957) -- 0:00:17
Average standard deviation of split frequencies: 0.007062
710500 -- (-396.555) (-396.673) [-401.101] (-394.730) * (-395.090) [-394.975] (-396.362) (-397.924) -- 0:00:17
711000 -- (-402.917) (-394.387) [-397.758] (-397.043) * (-397.145) (-399.386) (-395.436) [-395.562] -- 0:00:17
711500 -- (-400.370) (-394.975) (-395.434) [-395.267] * [-396.965] (-400.190) (-395.071) (-398.005) -- 0:00:17
712000 -- (-394.532) [-397.724] (-395.523) (-399.604) * (-395.782) (-395.793) [-395.152] (-398.884) -- 0:00:17
712500 -- (-398.427) [-396.380] (-399.212) (-396.225) * [-394.847] (-395.339) (-396.373) (-395.974) -- 0:00:17
713000 -- (-396.334) (-396.013) (-396.337) [-399.286] * (-394.893) (-396.024) (-394.900) [-396.053] -- 0:00:17
713500 -- (-396.884) (-396.608) [-398.198] (-398.292) * (-398.205) (-395.069) [-397.786] (-398.728) -- 0:00:17
714000 -- (-396.350) (-396.975) [-395.696] (-396.014) * (-396.759) (-397.143) [-395.917] (-395.847) -- 0:00:17
714500 -- (-396.819) (-394.104) (-396.243) [-396.882] * (-398.155) [-396.266] (-396.974) (-394.468) -- 0:00:17
715000 -- [-398.267] (-398.531) (-395.291) (-398.242) * (-401.895) [-397.182] (-395.945) (-398.812) -- 0:00:17
Average standard deviation of split frequencies: 0.006995
715500 -- (-397.224) (-395.447) [-394.783] (-396.874) * (-395.728) (-396.268) (-395.115) [-396.681] -- 0:00:17
716000 -- (-402.889) (-396.435) [-396.430] (-395.800) * (-394.053) [-395.554] (-394.334) (-397.128) -- 0:00:17
716500 -- [-397.977] (-397.806) (-396.303) (-396.144) * [-397.070] (-394.808) (-395.867) (-397.464) -- 0:00:17
717000 -- (-397.453) (-397.651) (-400.413) [-395.318] * (-395.850) (-395.528) [-396.608] (-397.644) -- 0:00:16
717500 -- (-402.139) (-397.992) (-396.938) [-395.040] * (-400.883) (-394.374) (-396.908) [-395.378] -- 0:00:17
718000 -- (-396.041) (-397.091) (-397.831) [-395.764] * (-399.546) (-399.783) [-394.658] (-394.868) -- 0:00:17
718500 -- (-396.049) (-395.559) (-396.442) [-394.964] * (-397.574) (-398.421) (-395.602) [-399.719] -- 0:00:17
719000 -- (-394.740) [-397.656] (-396.908) (-396.774) * (-395.506) (-397.317) (-396.692) [-395.327] -- 0:00:17
719500 -- [-395.483] (-397.490) (-397.929) (-398.794) * (-396.028) (-395.363) (-396.545) [-399.489] -- 0:00:17
720000 -- (-397.834) (-396.072) [-395.025] (-395.932) * (-397.452) (-395.128) [-395.659] (-396.106) -- 0:00:17
Average standard deviation of split frequencies: 0.007154
720500 -- (-402.739) (-395.971) [-397.749] (-397.786) * (-395.334) [-395.112] (-394.933) (-394.755) -- 0:00:17
721000 -- (-398.155) [-396.455] (-395.761) (-397.296) * (-400.207) (-394.822) [-396.240] (-395.704) -- 0:00:17
721500 -- (-395.746) (-396.359) [-395.632] (-398.009) * (-397.075) (-396.285) (-396.136) [-395.823] -- 0:00:16
722000 -- (-399.019) [-394.644] (-397.327) (-397.940) * (-395.464) (-398.323) [-395.923] (-398.570) -- 0:00:16
722500 -- (-396.501) [-398.059] (-394.567) (-395.876) * (-395.134) [-397.547] (-395.869) (-394.561) -- 0:00:16
723000 -- [-397.455] (-394.219) (-394.099) (-395.071) * (-394.786) (-396.249) [-395.467] (-397.445) -- 0:00:16
723500 -- (-397.748) (-393.960) [-394.311] (-395.205) * (-396.203) (-398.546) [-397.445] (-395.772) -- 0:00:16
724000 -- (-396.683) [-396.001] (-397.834) (-397.551) * (-397.764) (-397.688) [-396.628] (-396.736) -- 0:00:16
724500 -- (-398.941) (-400.088) [-394.106] (-399.227) * (-396.112) [-396.430] (-396.555) (-395.744) -- 0:00:16
725000 -- (-399.339) (-399.842) [-397.505] (-395.734) * (-396.547) (-395.980) (-395.102) [-396.105] -- 0:00:16
Average standard deviation of split frequencies: 0.007061
725500 -- [-397.492] (-396.706) (-396.133) (-394.915) * [-395.874] (-395.749) (-395.218) (-397.385) -- 0:00:16
726000 -- (-396.578) (-398.800) (-396.266) [-395.411] * (-398.178) [-399.064] (-397.513) (-397.617) -- 0:00:16
726500 -- (-395.886) (-397.057) [-394.297] (-394.025) * (-397.092) (-400.316) (-395.201) [-397.997] -- 0:00:16
727000 -- (-398.976) [-395.263] (-395.190) (-395.694) * (-396.579) (-397.651) [-395.876] (-398.055) -- 0:00:16
727500 -- (-399.842) [-396.893] (-398.260) (-396.375) * (-394.928) (-395.691) [-394.755] (-396.210) -- 0:00:16
728000 -- (-405.211) [-399.161] (-398.077) (-400.669) * [-395.341] (-396.035) (-394.130) (-394.845) -- 0:00:16
728500 -- (-403.486) (-395.005) (-400.371) [-395.643] * (-396.086) (-396.060) [-395.588] (-396.678) -- 0:00:16
729000 -- (-395.504) (-395.294) [-402.290] (-394.618) * [-397.883] (-397.145) (-397.491) (-398.182) -- 0:00:16
729500 -- (-398.520) (-394.633) (-398.101) [-396.590] * [-398.694] (-394.900) (-396.569) (-398.524) -- 0:00:16
730000 -- (-400.992) (-394.936) [-395.102] (-396.873) * (-396.573) (-395.257) (-400.319) [-398.865] -- 0:00:16
Average standard deviation of split frequencies: 0.007419
730500 -- (-396.223) (-396.897) [-397.722] (-399.682) * (-397.543) [-395.953] (-397.108) (-399.752) -- 0:00:16
731000 -- (-397.059) (-399.653) [-395.128] (-396.989) * (-397.190) (-394.846) (-395.852) [-395.420] -- 0:00:16
731500 -- (-394.842) (-396.592) [-394.314] (-398.297) * (-396.442) (-396.143) (-395.270) [-396.065] -- 0:00:16
732000 -- (-403.640) [-395.115] (-394.426) (-399.169) * (-396.468) (-397.977) (-394.715) [-396.330] -- 0:00:16
732500 -- (-402.551) (-396.341) [-397.663] (-397.159) * (-395.975) (-396.384) [-395.970] (-394.753) -- 0:00:16
733000 -- (-403.118) (-396.136) (-398.863) [-397.945] * (-394.832) (-398.983) [-395.996] (-395.476) -- 0:00:16
733500 -- (-403.802) [-395.892] (-396.598) (-396.289) * (-395.643) [-395.904] (-394.772) (-395.394) -- 0:00:16
734000 -- (-399.696) (-394.934) (-396.227) [-395.906] * (-395.146) [-396.061] (-397.404) (-395.396) -- 0:00:16
734500 -- (-397.155) (-394.086) (-395.185) [-396.019] * (-396.273) (-398.128) [-395.918] (-398.994) -- 0:00:16
735000 -- (-397.999) (-395.733) (-396.524) [-394.540] * (-394.948) [-396.724] (-395.398) (-395.219) -- 0:00:16
Average standard deviation of split frequencies: 0.007326
735500 -- (-399.950) (-399.424) (-397.447) [-395.838] * (-395.497) (-400.571) (-402.331) [-400.346] -- 0:00:16
736000 -- (-394.924) [-395.020] (-396.981) (-398.582) * (-394.204) (-397.281) (-405.751) [-394.541] -- 0:00:16
736500 -- (-397.404) [-395.015] (-395.873) (-394.866) * [-394.789] (-394.502) (-409.130) (-395.092) -- 0:00:16
737000 -- (-398.182) [-396.852] (-395.304) (-395.333) * [-395.359] (-396.435) (-398.053) (-403.954) -- 0:00:16
737500 -- [-396.841] (-395.903) (-395.328) (-395.200) * (-399.339) (-396.499) (-395.625) [-399.326] -- 0:00:16
738000 -- [-395.814] (-396.885) (-398.049) (-394.294) * [-400.483] (-394.730) (-395.306) (-397.553) -- 0:00:15
738500 -- (-396.571) (-395.459) (-397.436) [-396.010] * (-396.153) (-396.908) [-394.846] (-400.340) -- 0:00:15
739000 -- (-394.932) [-396.565] (-397.187) (-394.460) * [-394.344] (-400.398) (-395.104) (-395.326) -- 0:00:15
739500 -- (-396.398) (-395.413) [-395.872] (-394.225) * (-394.851) (-398.221) [-396.779] (-399.191) -- 0:00:15
740000 -- (-400.048) (-395.438) [-396.362] (-395.656) * (-396.269) (-399.829) (-394.587) [-397.808] -- 0:00:15
Average standard deviation of split frequencies: 0.006921
740500 -- (-397.487) [-395.800] (-399.573) (-395.059) * (-396.301) [-394.454] (-398.240) (-397.144) -- 0:00:15
741000 -- (-395.788) (-396.502) (-402.769) [-395.108] * (-396.259) [-394.933] (-394.648) (-396.163) -- 0:00:15
741500 -- (-395.217) (-396.789) (-394.791) [-394.329] * (-399.689) [-398.203] (-398.386) (-395.523) -- 0:00:15
742000 -- (-395.745) [-397.023] (-396.300) (-394.106) * (-396.517) [-397.687] (-397.471) (-395.266) -- 0:00:15
742500 -- [-397.913] (-398.345) (-400.985) (-394.419) * (-402.018) [-394.731] (-397.440) (-395.263) -- 0:00:15
743000 -- (-397.465) (-395.059) [-397.559] (-394.603) * (-396.675) (-395.875) (-398.322) [-395.267] -- 0:00:15
743500 -- (-398.946) [-396.532] (-398.239) (-394.603) * (-396.294) [-398.980] (-394.726) (-395.636) -- 0:00:15
744000 -- (-394.458) (-394.673) [-397.678] (-395.544) * (-397.819) (-394.876) [-396.025] (-395.277) -- 0:00:15
744500 -- [-394.729] (-395.007) (-396.250) (-395.912) * (-401.792) (-397.023) (-395.520) [-396.358] -- 0:00:15
745000 -- (-397.326) (-395.823) (-395.123) [-397.922] * (-396.727) (-397.781) [-394.426] (-396.910) -- 0:00:15
Average standard deviation of split frequencies: 0.006912
745500 -- (-396.345) [-395.729] (-395.430) (-395.566) * (-397.642) (-397.881) (-394.947) [-397.237] -- 0:00:15
746000 -- (-397.015) [-400.344] (-398.086) (-396.887) * (-397.740) [-395.987] (-394.995) (-397.736) -- 0:00:15
746500 -- (-397.589) (-396.733) [-395.956] (-397.529) * [-397.525] (-399.006) (-395.363) (-394.773) -- 0:00:15
747000 -- (-395.494) [-394.506] (-395.959) (-395.109) * [-395.015] (-396.785) (-395.181) (-395.649) -- 0:00:15
747500 -- [-395.664] (-395.954) (-399.276) (-396.671) * [-394.535] (-400.028) (-397.846) (-398.060) -- 0:00:15
748000 -- (-395.932) (-394.483) (-396.306) [-396.904] * (-394.563) [-395.451] (-398.164) (-398.342) -- 0:00:15
748500 -- (-398.011) [-394.149] (-395.029) (-398.176) * [-394.198] (-394.865) (-398.786) (-395.689) -- 0:00:15
749000 -- (-395.985) (-397.364) (-394.576) [-400.736] * (-394.270) (-394.689) [-398.420] (-394.644) -- 0:00:15
749500 -- [-396.861] (-395.653) (-395.464) (-398.902) * [-395.812] (-395.078) (-395.511) (-397.351) -- 0:00:15
750000 -- (-398.496) (-396.189) (-397.457) [-395.376] * (-394.719) (-395.137) [-396.687] (-397.666) -- 0:00:15
Average standard deviation of split frequencies: 0.006790
750500 -- (-398.151) (-398.153) [-397.253] (-396.876) * (-396.136) (-396.246) [-395.220] (-396.726) -- 0:00:15
751000 -- (-397.442) (-396.553) [-394.953] (-394.479) * (-398.825) (-399.496) (-397.509) [-396.239] -- 0:00:15
751500 -- (-397.210) (-395.962) (-395.237) [-395.558] * (-397.574) (-397.210) (-399.928) [-396.137] -- 0:00:15
752000 -- (-395.184) (-395.214) (-398.915) [-397.660] * (-397.792) (-396.283) (-408.632) [-395.537] -- 0:00:15
752500 -- (-398.639) (-396.788) (-396.474) [-396.690] * (-394.585) (-398.226) (-396.002) [-394.469] -- 0:00:15
753000 -- (-397.647) [-394.001] (-397.811) (-395.823) * [-395.228] (-397.409) (-396.588) (-395.422) -- 0:00:15
753500 -- (-397.839) [-395.283] (-396.865) (-396.164) * (-397.658) (-396.381) (-396.135) [-395.715] -- 0:00:15
754000 -- [-398.454] (-397.379) (-398.067) (-394.206) * [-397.658] (-394.980) (-394.352) (-394.810) -- 0:00:15
754500 -- (-398.676) (-394.314) (-396.118) [-394.759] * (-397.674) (-394.372) [-394.970] (-396.415) -- 0:00:14
755000 -- [-394.826] (-396.876) (-398.939) (-394.678) * (-398.233) (-396.669) (-396.952) [-396.249] -- 0:00:14
Average standard deviation of split frequencies: 0.006526
755500 -- (-395.993) [-396.625] (-396.668) (-398.541) * (-399.493) (-398.870) (-396.646) [-394.918] -- 0:00:14
756000 -- (-395.033) [-395.051] (-397.149) (-396.427) * (-394.921) [-398.613] (-398.306) (-394.865) -- 0:00:14
756500 -- (-394.997) [-395.519] (-395.528) (-395.495) * (-396.444) [-394.632] (-396.348) (-400.086) -- 0:00:14
757000 -- (-395.428) (-396.341) (-395.269) [-394.030] * (-397.147) (-397.081) [-397.506] (-396.652) -- 0:00:14
757500 -- (-395.539) (-394.735) (-394.598) [-394.113] * (-396.189) (-395.345) (-399.741) [-395.360] -- 0:00:14
758000 -- (-395.555) (-394.891) [-394.695] (-394.886) * (-395.230) [-394.717] (-399.795) (-397.179) -- 0:00:14
758500 -- (-396.124) (-395.894) (-400.271) [-394.219] * (-398.725) (-397.096) (-398.538) [-394.575] -- 0:00:14
759000 -- (-399.754) (-396.225) (-395.027) [-394.216] * (-402.775) [-394.881] (-400.304) (-394.740) -- 0:00:14
759500 -- [-399.681] (-395.813) (-394.609) (-395.411) * (-396.632) [-394.690] (-401.576) (-396.182) -- 0:00:14
760000 -- (-397.488) (-395.315) (-396.104) [-397.281] * (-400.355) (-395.509) (-397.357) [-396.718] -- 0:00:14
Average standard deviation of split frequencies: 0.006858
760500 -- (-398.268) [-396.089] (-398.065) (-399.382) * (-399.276) (-395.235) (-396.165) [-395.631] -- 0:00:14
761000 -- (-397.168) (-394.590) (-399.479) [-395.798] * [-399.584] (-398.011) (-398.905) (-395.587) -- 0:00:14
761500 -- (-395.418) (-397.760) [-402.228] (-394.979) * (-394.811) [-396.613] (-395.797) (-396.783) -- 0:00:14
762000 -- (-394.883) (-394.374) [-394.929] (-396.424) * (-398.412) (-395.793) [-399.569] (-397.307) -- 0:00:14
762500 -- (-396.456) (-394.685) (-397.068) [-398.197] * [-395.384] (-397.115) (-395.299) (-401.803) -- 0:00:14
763000 -- [-396.053] (-395.900) (-396.657) (-395.691) * (-397.588) (-401.416) (-396.160) [-396.064] -- 0:00:14
763500 -- (-397.354) [-394.720] (-395.903) (-397.127) * (-394.093) [-402.771] (-398.182) (-398.266) -- 0:00:14
764000 -- (-395.487) (-397.417) [-394.687] (-398.566) * (-395.542) (-397.551) (-399.850) [-395.831] -- 0:00:14
764500 -- [-394.533] (-396.785) (-397.139) (-397.570) * (-394.780) (-395.606) [-398.654] (-395.251) -- 0:00:14
765000 -- [-396.862] (-395.422) (-396.143) (-398.472) * [-396.498] (-395.587) (-397.099) (-395.135) -- 0:00:14
Average standard deviation of split frequencies: 0.007508
765500 -- (-398.188) (-394.387) (-400.405) [-395.170] * (-395.669) [-398.405] (-394.324) (-396.474) -- 0:00:14
766000 -- (-402.437) (-396.145) [-402.929] (-396.804) * (-398.079) [-396.354] (-395.308) (-396.166) -- 0:00:14
766500 -- [-398.613] (-395.985) (-401.477) (-396.427) * (-400.466) [-396.192] (-395.463) (-396.668) -- 0:00:14
767000 -- (-396.316) (-394.992) (-398.320) [-394.609] * [-395.258] (-395.796) (-395.579) (-394.592) -- 0:00:14
767500 -- (-396.110) [-396.481] (-395.487) (-394.933) * (-395.887) (-395.873) (-396.415) [-395.625] -- 0:00:14
768000 -- [-395.699] (-395.621) (-396.878) (-395.059) * (-398.367) (-395.603) (-396.413) [-396.419] -- 0:00:14
768500 -- [-395.027] (-396.026) (-396.925) (-394.210) * (-399.055) (-395.948) (-396.448) [-395.331] -- 0:00:14
769000 -- (-397.831) (-395.559) (-403.371) [-400.083] * (-396.891) (-397.701) (-395.520) [-397.575] -- 0:00:14
769500 -- (-395.094) (-394.528) (-397.063) [-396.358] * [-397.136] (-395.729) (-401.013) (-396.713) -- 0:00:14
770000 -- (-395.617) (-401.165) (-394.599) [-396.104] * (-395.682) (-397.636) (-396.751) [-394.853] -- 0:00:14
Average standard deviation of split frequencies: 0.006810
770500 -- (-395.241) [-396.110] (-397.898) (-398.447) * (-399.196) (-398.140) [-397.519] (-394.419) -- 0:00:13
771000 -- [-395.255] (-395.055) (-399.667) (-397.266) * (-395.225) [-394.289] (-395.901) (-397.358) -- 0:00:13
771500 -- (-400.018) (-397.298) [-402.176] (-395.871) * [-395.561] (-394.318) (-394.833) (-396.487) -- 0:00:13
772000 -- (-395.643) [-396.297] (-398.330) (-395.089) * [-396.832] (-395.118) (-395.287) (-397.365) -- 0:00:13
772500 -- (-394.742) [-395.513] (-396.759) (-395.623) * [-394.978] (-394.948) (-396.318) (-400.099) -- 0:00:13
773000 -- (-397.702) [-395.436] (-395.855) (-394.406) * [-395.066] (-395.168) (-396.688) (-397.128) -- 0:00:13
773500 -- [-396.689] (-400.694) (-394.392) (-394.863) * [-396.806] (-401.077) (-397.770) (-399.964) -- 0:00:13
774000 -- (-397.469) [-397.521] (-396.439) (-398.898) * (-396.917) (-397.076) [-396.989] (-404.484) -- 0:00:13
774500 -- (-400.082) [-395.959] (-397.253) (-396.247) * [-398.368] (-399.492) (-399.623) (-399.645) -- 0:00:13
775000 -- (-398.839) (-396.683) (-396.909) [-396.367] * (-396.714) [-396.201] (-396.215) (-395.350) -- 0:00:13
Average standard deviation of split frequencies: 0.006601
775500 -- [-396.952] (-394.227) (-396.739) (-396.678) * (-400.350) (-395.865) [-395.881] (-397.472) -- 0:00:13
776000 -- (-399.533) (-397.012) [-395.833] (-403.032) * (-401.526) (-395.620) [-394.627] (-395.671) -- 0:00:13
776500 -- (-395.244) (-399.198) (-396.597) [-397.622] * (-395.622) [-397.513] (-396.191) (-395.300) -- 0:00:13
777000 -- [-400.528] (-397.458) (-396.673) (-395.773) * (-396.403) (-395.185) [-395.075] (-395.091) -- 0:00:13
777500 -- [-396.780] (-394.700) (-402.422) (-397.146) * (-396.688) (-399.922) (-395.177) [-394.314] -- 0:00:13
778000 -- (-394.998) (-394.831) (-400.943) [-397.233] * (-397.069) (-395.175) (-397.530) [-395.367] -- 0:00:13
778500 -- [-394.438] (-396.703) (-397.602) (-396.661) * (-397.260) (-397.285) [-394.884] (-396.104) -- 0:00:13
779000 -- (-398.445) (-399.383) [-396.397] (-397.880) * (-398.658) (-397.509) [-394.559] (-401.768) -- 0:00:13
779500 -- (-394.987) (-400.859) (-396.378) [-395.861] * (-395.751) (-395.572) [-395.557] (-396.509) -- 0:00:13
780000 -- [-395.534] (-394.496) (-397.429) (-397.147) * (-398.680) [-401.638] (-395.525) (-397.755) -- 0:00:13
Average standard deviation of split frequencies: 0.006441
780500 -- [-394.611] (-395.113) (-395.762) (-395.899) * (-395.615) [-395.196] (-398.519) (-396.857) -- 0:00:13
781000 -- [-395.650] (-397.277) (-394.728) (-396.982) * (-397.492) [-395.473] (-394.990) (-397.227) -- 0:00:13
781500 -- (-394.855) (-397.779) [-397.989] (-395.758) * [-396.266] (-396.637) (-395.153) (-398.296) -- 0:00:13
782000 -- (-394.886) (-395.649) [-396.354] (-397.151) * [-396.884] (-394.505) (-394.961) (-397.228) -- 0:00:13
782500 -- (-395.802) [-397.435] (-394.538) (-396.659) * (-395.164) (-397.043) (-394.834) [-394.435] -- 0:00:13
783000 -- (-396.022) (-397.065) (-395.784) [-400.796] * (-394.803) (-395.086) [-396.240] (-394.686) -- 0:00:13
783500 -- (-394.824) [-395.858] (-395.939) (-395.339) * (-394.282) [-394.787] (-395.896) (-395.470) -- 0:00:13
784000 -- (-400.247) [-394.666] (-395.454) (-396.125) * (-394.765) (-398.043) [-394.734] (-395.345) -- 0:00:13
784500 -- (-394.144) [-397.250] (-395.896) (-395.970) * (-395.724) (-396.866) [-396.495] (-396.107) -- 0:00:13
785000 -- (-396.812) [-396.411] (-395.999) (-401.251) * (-394.948) [-396.618] (-399.019) (-399.221) -- 0:00:13
Average standard deviation of split frequencies: 0.006437
785500 -- (-395.399) (-395.952) (-397.328) [-397.567] * (-403.364) (-394.858) [-395.789] (-396.089) -- 0:00:13
786000 -- [-395.039] (-395.310) (-395.164) (-395.287) * (-395.030) (-397.911) [-396.273] (-398.887) -- 0:00:13
786500 -- (-398.422) (-395.556) (-398.563) [-401.217] * (-400.133) (-399.154) [-396.659] (-396.154) -- 0:00:13
787000 -- (-397.669) [-398.088] (-396.124) (-397.817) * (-395.955) (-396.159) [-395.969] (-398.535) -- 0:00:12
787500 -- (-396.916) (-398.091) [-397.800] (-394.830) * (-398.612) [-396.609] (-397.213) (-397.610) -- 0:00:12
788000 -- [-397.383] (-395.096) (-403.379) (-398.759) * (-395.947) (-398.936) (-397.559) [-395.742] -- 0:00:12
788500 -- (-399.458) [-394.298] (-398.748) (-396.403) * (-395.420) (-395.894) [-399.430] (-395.027) -- 0:00:12
789000 -- [-397.271] (-396.302) (-396.214) (-397.460) * [-395.608] (-396.419) (-397.738) (-395.659) -- 0:00:12
789500 -- (-394.988) [-395.943] (-397.307) (-398.277) * [-395.490] (-396.906) (-400.655) (-395.514) -- 0:00:12
790000 -- (-396.513) [-397.441] (-396.018) (-397.173) * [-396.262] (-396.046) (-395.837) (-395.117) -- 0:00:12
Average standard deviation of split frequencies: 0.006876
790500 -- (-397.018) [-395.282] (-395.994) (-398.544) * (-394.887) (-396.842) [-396.934] (-395.733) -- 0:00:12
791000 -- (-396.233) (-398.967) [-395.832] (-395.485) * [-394.511] (-396.134) (-394.861) (-401.427) -- 0:00:12
791500 -- (-398.190) (-396.854) [-396.655] (-394.532) * [-394.916] (-395.712) (-395.308) (-408.653) -- 0:00:12
792000 -- (-397.713) [-395.812] (-397.916) (-396.266) * [-396.947] (-395.320) (-396.072) (-398.729) -- 0:00:12
792500 -- (-396.444) [-398.836] (-395.769) (-397.041) * [-397.137] (-395.214) (-401.216) (-395.390) -- 0:00:12
793000 -- (-403.159) (-396.511) [-395.139] (-398.120) * (-402.477) (-398.661) [-394.965] (-394.387) -- 0:00:12
793500 -- (-396.969) (-396.349) [-397.871] (-396.755) * (-399.319) [-396.623] (-395.105) (-397.587) -- 0:00:12
794000 -- (-395.328) (-396.980) [-396.582] (-398.960) * (-396.616) (-397.580) (-395.580) [-396.325] -- 0:00:12
794500 -- (-396.691) (-399.467) [-396.532] (-395.692) * (-396.474) (-397.675) [-397.141] (-398.313) -- 0:00:12
795000 -- (-402.616) (-397.461) [-395.953] (-395.147) * [-397.314] (-394.403) (-399.845) (-400.359) -- 0:00:12
Average standard deviation of split frequencies: 0.007146
795500 -- (-396.927) (-398.931) [-396.102] (-397.595) * [-395.880] (-394.949) (-397.366) (-395.650) -- 0:00:12
796000 -- (-400.009) (-395.885) [-396.572] (-398.567) * (-394.705) (-397.133) (-397.193) [-395.356] -- 0:00:12
796500 -- [-400.305] (-395.996) (-399.311) (-398.073) * [-394.682] (-398.275) (-397.153) (-397.341) -- 0:00:12
797000 -- (-396.398) (-395.670) [-397.957] (-396.553) * (-395.726) (-396.601) (-396.503) [-396.405] -- 0:00:12
797500 -- (-394.492) (-397.520) (-395.190) [-395.273] * (-396.971) (-400.626) (-394.680) [-397.802] -- 0:00:12
798000 -- (-394.486) (-397.758) (-396.794) [-394.802] * (-399.185) (-397.013) [-394.332] (-400.364) -- 0:00:12
798500 -- (-396.131) (-397.982) [-395.883] (-395.093) * (-395.330) [-395.109] (-394.665) (-394.283) -- 0:00:12
799000 -- [-395.845] (-395.370) (-395.225) (-395.129) * (-395.217) [-396.866] (-396.724) (-394.430) -- 0:00:12
799500 -- (-399.273) (-396.732) [-395.765] (-396.637) * [-395.220] (-395.709) (-402.061) (-394.579) -- 0:00:12
800000 -- [-397.164] (-395.413) (-395.595) (-397.563) * (-397.732) [-396.352] (-397.090) (-394.630) -- 0:00:12
Average standard deviation of split frequencies: 0.007497
800500 -- (-395.688) (-400.217) (-400.796) [-395.880] * [-396.630] (-397.547) (-396.505) (-395.179) -- 0:00:12
801000 -- [-397.633] (-396.970) (-395.793) (-394.987) * [-395.872] (-396.164) (-399.369) (-398.630) -- 0:00:12
801500 -- [-397.591] (-396.462) (-396.892) (-395.348) * [-397.666] (-401.562) (-398.610) (-395.506) -- 0:00:12
802000 -- (-396.652) (-398.496) (-397.711) [-395.057] * (-397.811) [-394.989] (-398.567) (-394.984) -- 0:00:12
802500 -- (-394.809) [-398.712] (-395.629) (-397.812) * [-397.101] (-396.376) (-400.251) (-395.079) -- 0:00:12
803000 -- (-395.475) (-397.122) (-395.797) [-399.267] * (-397.539) (-397.391) (-395.921) [-398.965] -- 0:00:12
803500 -- (-394.487) [-395.385] (-395.653) (-396.321) * (-396.704) (-396.581) [-394.969] (-395.335) -- 0:00:11
804000 -- (-395.068) (-400.277) [-394.490] (-394.173) * (-397.451) (-394.322) [-395.587] (-398.389) -- 0:00:11
804500 -- (-395.334) [-396.631] (-395.209) (-395.801) * [-397.000] (-398.272) (-395.474) (-395.287) -- 0:00:11
805000 -- (-395.857) (-394.537) (-396.684) [-394.713] * [-396.672] (-394.796) (-397.249) (-396.692) -- 0:00:11
Average standard deviation of split frequencies: 0.007057
805500 -- (-394.265) [-397.186] (-397.384) (-399.038) * [-398.402] (-396.811) (-396.312) (-398.952) -- 0:00:11
806000 -- [-396.312] (-397.097) (-396.611) (-400.093) * (-398.236) [-396.555] (-395.469) (-397.773) -- 0:00:11
806500 -- (-395.227) [-396.54 