--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:49:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1523/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -395.63          -398.87
2       -395.64          -398.42
--------------------------------------
TOTAL     -395.63          -398.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896569    0.088716    0.364753    1.492079    0.865948   1429.62   1465.31    1.000
r(A<->C){all}   0.164364    0.020207    0.000109    0.460436    0.123398    165.54    298.28    1.000
r(A<->G){all}   0.175485    0.021959    0.000111    0.476632    0.136343    238.54    245.64    1.000
r(A<->T){all}   0.153878    0.017526    0.000063    0.419009    0.118289    116.15    176.11    1.002
r(C<->G){all}   0.171717    0.019716    0.000127    0.458213    0.139008    321.67    333.99    1.000
r(C<->T){all}   0.172194    0.019816    0.000011    0.444855    0.138384    240.99    278.02    1.001
r(G<->T){all}   0.162362    0.019194    0.000038    0.432821    0.126298    259.38    289.25    1.000
pi(A){all}      0.178055    0.000498    0.134130    0.221433    0.177557   1187.44   1272.16    1.000
pi(C){all}      0.294746    0.000703    0.246508    0.351172    0.294059   1098.49   1148.49    1.000
pi(G){all}      0.287008    0.000692    0.234797    0.337725    0.286737   1178.77   1296.37    1.000
pi(T){all}      0.240190    0.000597    0.193106    0.287051    0.240206   1244.86   1305.99    1.000
alpha{1,2}      0.405508    0.212621    0.000147    1.325281    0.243990   1394.28   1407.19    1.000
alpha{3}        0.431717    0.214520    0.000166    1.380933    0.276220   1189.62   1345.31    1.000
pinvar{all}     0.993954    0.000055    0.980013    0.999995    0.996341    847.89   1125.92    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-379.089068
Model 2: PositiveSelection	-379.089099
Model 0: one-ratio	-379.089123
Model 7: beta	-379.089098
Model 8: beta&w>1	-379.0891


Model 0 vs 1	1.0999999994965037E-4

Model 2 vs 1	6.199999995715189E-5

Model 8 vs 7	3.999999989900971E-6
>C1
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C2
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C3
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C4
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C5
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C6
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 

C1              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C2              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C3              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C4              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C5              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C6              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
                **************************************************

C1              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C2              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C3              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C4              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C5              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C6              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2880]--->[2880]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C2              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C3              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C4              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C5              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
C6              MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
                **************************************************

C1              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C2              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C3              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C4              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C5              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
C6              DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C2              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C3              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C4              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C5              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
C6              ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
                **************************************************

C1              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C2              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C3              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C4              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C5              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
C6              CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
                **************************************************

C1              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C2              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C3              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C4              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C5              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
C6              GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
                **************************************************

C1              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C2              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C3              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C4              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C5              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
C6              GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
                **************************************************

C1              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C2              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C3              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C4              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C5              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
C6              AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
                **************************************************

C1              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C2              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C3              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C4              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C5              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
C6              TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
                **************************************



>C1
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C2
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C3
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C4
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C5
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C6
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>C1
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C2
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C3
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C4
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C5
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>C6
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 288 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855693
      Setting output file names to "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 366606530
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5490007798
      Seed = 1960593637
      Swapseed = 1579855693
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -644.557769 -- -24.965149
         Chain 2 -- -644.557769 -- -24.965149
         Chain 3 -- -644.557708 -- -24.965149
         Chain 4 -- -644.557769 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -644.557708 -- -24.965149
         Chain 2 -- -644.557769 -- -24.965149
         Chain 3 -- -644.557806 -- -24.965149
         Chain 4 -- -644.557806 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558) 
        500 -- (-406.097) (-407.562) [-401.630] (-410.831) * (-407.576) [-404.677] (-408.143) (-414.448) -- 0:33:19
       1000 -- (-407.354) [-400.459] (-408.024) (-409.706) * (-402.660) (-400.711) [-407.705] (-404.268) -- 0:16:39
       1500 -- [-407.347] (-404.711) (-402.983) (-407.587) * [-405.121] (-408.674) (-405.520) (-405.337) -- 0:11:05
       2000 -- [-401.071] (-407.529) (-406.265) (-411.852) * (-403.805) [-400.082] (-418.434) (-402.485) -- 0:08:19
       2500 -- (-406.572) [-402.562] (-404.693) (-403.201) * (-405.288) [-403.219] (-402.670) (-403.576) -- 0:06:39
       3000 -- (-406.380) [-409.375] (-405.047) (-406.649) * [-401.647] (-412.600) (-403.253) (-406.398) -- 0:05:32
       3500 -- (-411.820) [-407.911] (-408.539) (-403.798) * (-404.920) (-411.282) [-409.894] (-411.119) -- 0:04:44
       4000 -- (-406.882) (-402.245) (-403.286) [-404.460] * (-405.579) (-412.531) [-402.801] (-403.648) -- 0:04:09
       4500 -- (-403.338) [-403.456] (-415.973) (-401.363) * (-405.159) [-400.986] (-407.263) (-403.242) -- 0:03:41
       5000 -- (-408.795) (-406.114) [-407.971] (-409.152) * (-407.196) (-404.813) [-408.169] (-408.418) -- 0:03:19

      Average standard deviation of split frequencies: 0.089791

       5500 -- (-408.676) (-399.640) (-402.656) [-402.359] * [-406.393] (-414.132) (-406.166) (-403.729) -- 0:03:00
       6000 -- (-404.173) (-408.805) (-405.694) [-402.699] * [-411.464] (-406.158) (-401.546) (-405.935) -- 0:02:45
       6500 -- (-405.026) (-400.883) (-409.725) [-411.083] * [-401.985] (-403.994) (-401.038) (-403.842) -- 0:02:32
       7000 -- (-413.043) (-410.198) (-405.352) [-402.990] * (-403.351) [-399.679] (-404.293) (-411.364) -- 0:02:21
       7500 -- (-405.001) (-403.101) [-413.624] (-412.217) * (-404.616) (-402.182) [-407.350] (-411.568) -- 0:02:12
       8000 -- (-412.535) (-404.043) [-408.054] (-401.416) * (-403.859) (-411.443) (-402.946) [-404.144] -- 0:02:04
       8500 -- (-407.825) (-412.760) [-404.606] (-400.719) * (-408.585) [-404.499] (-403.660) (-409.906) -- 0:01:56
       9000 -- (-409.475) [-405.849] (-408.080) (-404.969) * (-405.747) [-404.476] (-412.441) (-402.898) -- 0:01:50
       9500 -- (-405.321) [-403.764] (-405.274) (-404.887) * (-408.808) (-406.657) (-413.407) [-405.560] -- 0:01:44
      10000 -- (-406.193) [-405.250] (-404.843) (-407.706) * (-401.358) (-403.703) [-405.853] (-409.107) -- 0:01:39

      Average standard deviation of split frequencies: 0.069448

      10500 -- (-403.759) [-403.784] (-404.901) (-406.155) * (-408.083) [-401.374] (-408.853) (-406.460) -- 0:01:34
      11000 -- (-410.126) (-412.025) [-403.310] (-403.552) * (-413.549) (-406.991) [-408.096] (-408.445) -- 0:01:29
      11500 -- (-416.257) (-408.323) [-405.689] (-404.328) * (-405.271) (-407.811) [-399.729] (-402.424) -- 0:01:25
      12000 -- (-415.870) (-411.045) (-404.989) [-406.890] * (-404.487) (-406.632) [-403.922] (-408.027) -- 0:01:22
      12500 -- (-410.262) [-400.708] (-403.820) (-405.565) * (-406.903) (-405.549) (-403.885) [-402.021] -- 0:01:19
      13000 -- (-414.289) (-408.144) [-399.960] (-403.204) * [-403.356] (-408.904) (-409.416) (-406.154) -- 0:01:15
      13500 -- (-404.852) (-403.706) [-407.271] (-401.740) * (-406.604) (-408.295) [-420.325] (-413.520) -- 0:01:13
      14000 -- (-405.147) (-411.545) [-404.693] (-413.349) * (-417.019) [-406.115] (-403.386) (-406.792) -- 0:01:10
      14500 -- (-415.036) [-396.151] (-399.019) (-409.392) * [-407.958] (-414.805) (-403.535) (-416.063) -- 0:01:07
      15000 -- (-409.062) (-405.427) (-400.778) [-399.448] * [-400.871] (-406.011) (-406.358) (-411.269) -- 0:01:05

      Average standard deviation of split frequencies: 0.052521

      15500 -- (-405.198) (-395.691) (-409.512) [-402.608] * (-402.947) (-414.533) [-401.933] (-408.929) -- 0:01:03
      16000 -- (-395.604) (-395.573) (-415.091) [-406.935] * [-407.947] (-405.201) (-403.491) (-399.800) -- 0:01:01
      16500 -- [-395.472] (-394.054) (-403.056) (-408.812) * (-401.254) [-407.050] (-410.755) (-395.939) -- 0:00:59
      17000 -- (-395.183) [-395.662] (-411.098) (-407.109) * (-413.733) (-411.696) [-402.410] (-395.562) -- 0:01:55
      17500 -- [-398.054] (-399.493) (-405.169) (-402.714) * (-424.851) (-409.760) [-402.485] (-397.095) -- 0:01:52
      18000 -- (-399.005) (-399.606) (-399.503) [-408.398] * (-401.536) (-407.095) [-403.299] (-396.286) -- 0:01:49
      18500 -- (-396.885) (-399.448) [-406.035] (-413.333) * (-405.419) (-417.811) (-402.227) [-396.665] -- 0:01:46
      19000 -- (-400.358) (-398.400) (-408.831) [-408.218] * [-407.317] (-412.455) (-405.261) (-394.095) -- 0:01:43
      19500 -- (-395.003) (-400.235) [-397.638] (-404.975) * (-408.823) (-408.909) (-407.748) [-395.841] -- 0:01:40
      20000 -- (-394.405) [-394.469] (-405.415) (-405.724) * [-403.972] (-409.775) (-402.959) (-395.333) -- 0:01:38

      Average standard deviation of split frequencies: 0.052823

      20500 -- (-395.844) (-395.518) [-402.398] (-413.339) * [-403.764] (-406.131) (-416.709) (-398.575) -- 0:01:35
      21000 -- (-397.627) (-395.968) [-410.610] (-406.819) * (-406.487) (-402.058) (-405.460) [-396.751] -- 0:01:33
      21500 -- (-395.577) [-396.205] (-409.044) (-407.222) * [-407.454] (-406.700) (-406.994) (-398.259) -- 0:01:31
      22000 -- (-396.484) [-395.744] (-402.789) (-410.767) * (-407.056) (-403.919) [-405.524] (-395.585) -- 0:01:28
      22500 -- (-397.269) [-396.932] (-406.588) (-409.839) * (-414.367) [-408.816] (-407.153) (-396.361) -- 0:01:26
      23000 -- (-396.790) (-397.331) [-398.958] (-411.458) * [-405.231] (-418.696) (-403.765) (-398.059) -- 0:01:24
      23500 -- (-399.888) (-397.027) [-412.487] (-426.067) * (-420.659) [-401.458] (-407.957) (-397.306) -- 0:01:23
      24000 -- [-396.740] (-395.652) (-402.456) (-431.144) * (-405.553) (-418.144) (-400.300) [-394.962] -- 0:01:21
      24500 -- [-394.955] (-396.194) (-405.178) (-419.549) * (-402.776) (-415.805) [-403.917] (-396.806) -- 0:01:19
      25000 -- (-395.587) [-399.627] (-406.777) (-405.155) * (-402.419) (-412.508) [-410.892] (-395.735) -- 0:01:18

      Average standard deviation of split frequencies: 0.047800

      25500 -- (-394.383) [-398.166] (-417.198) (-395.214) * (-416.971) [-408.200] (-411.849) (-397.255) -- 0:01:16
      26000 -- (-399.120) (-399.080) [-412.873] (-395.502) * (-400.533) [-410.640] (-408.954) (-398.939) -- 0:01:14
      26500 -- (-398.016) [-399.014] (-401.880) (-395.424) * (-401.373) (-409.052) [-401.232] (-398.757) -- 0:01:13
      27000 -- (-396.350) (-397.009) (-408.571) [-396.760] * (-407.898) (-413.315) [-411.675] (-395.890) -- 0:01:12
      27500 -- (-395.335) [-394.883] (-411.247) (-399.656) * (-427.778) [-396.689] (-404.885) (-396.133) -- 0:01:10
      28000 -- (-394.486) [-394.416] (-402.974) (-396.550) * (-406.925) (-397.086) (-404.591) [-396.625] -- 0:01:09
      28500 -- (-394.411) [-395.622] (-406.541) (-398.396) * (-406.242) (-395.756) (-408.801) [-396.710] -- 0:01:08
      29000 -- (-395.284) (-396.156) (-401.094) [-395.340] * (-401.017) [-396.432] (-409.261) (-396.457) -- 0:01:06
      29500 -- (-396.784) [-394.967] (-396.814) (-395.895) * (-407.238) [-396.455] (-415.208) (-396.326) -- 0:01:05
      30000 -- (-395.504) (-395.447) (-398.504) [-395.258] * (-402.896) [-397.322] (-415.006) (-396.774) -- 0:01:04

      Average standard deviation of split frequencies: 0.043689

      30500 -- [-396.674] (-396.541) (-402.438) (-396.903) * (-407.703) [-394.672] (-402.917) (-402.216) -- 0:01:03
      31000 -- (-394.256) (-395.213) (-394.874) [-394.166] * (-396.565) (-397.141) [-395.137] (-395.691) -- 0:01:02
      31500 -- [-394.159] (-395.736) (-393.954) (-396.202) * (-395.193) [-396.230] (-394.590) (-394.817) -- 0:01:01
      32000 -- (-398.478) [-394.698] (-395.669) (-400.724) * (-395.836) (-396.005) [-395.365] (-400.372) -- 0:01:00
      32500 -- (-398.843) (-397.004) [-397.894] (-397.439) * [-399.050] (-396.173) (-397.003) (-399.970) -- 0:00:59
      33000 -- (-395.943) (-395.666) (-395.809) [-398.626] * [-397.377] (-398.066) (-399.155) (-395.816) -- 0:00:58
      33500 -- (-398.077) (-395.068) (-394.327) [-398.185] * [-396.646] (-398.746) (-399.989) (-398.553) -- 0:01:26
      34000 -- (-399.491) [-395.730] (-395.202) (-397.420) * (-395.218) (-396.454) (-400.073) [-400.652] -- 0:01:25
      34500 -- (-396.840) [-396.629] (-399.202) (-395.830) * (-394.860) [-397.732] (-394.631) (-397.559) -- 0:01:23
      35000 -- (-400.082) (-398.683) [-397.800] (-396.633) * (-395.818) (-398.702) (-396.666) [-398.454] -- 0:01:22

      Average standard deviation of split frequencies: 0.038556

      35500 -- (-395.487) [-395.361] (-397.671) (-396.181) * (-397.370) [-399.674] (-396.495) (-400.786) -- 0:01:21
      36000 -- [-397.332] (-398.000) (-395.837) (-395.779) * (-395.723) [-397.341] (-394.920) (-396.221) -- 0:01:20
      36500 -- [-399.441] (-398.047) (-397.980) (-395.241) * (-397.258) (-397.370) [-396.931] (-396.124) -- 0:01:19
      37000 -- (-397.581) (-401.849) (-395.518) [-396.568] * (-396.367) (-397.117) [-395.651] (-396.165) -- 0:01:18
      37500 -- (-395.030) [-401.989] (-396.063) (-395.500) * [-397.652] (-401.282) (-398.180) (-394.792) -- 0:01:17
      38000 -- (-395.156) [-396.482] (-395.941) (-395.740) * (-395.813) (-397.563) [-398.343] (-399.847) -- 0:01:15
      38500 -- (-397.377) [-396.350] (-398.101) (-395.515) * (-399.222) (-395.906) (-397.667) [-397.094] -- 0:01:14
      39000 -- [-394.312] (-395.846) (-394.658) (-395.738) * (-395.037) [-395.181] (-395.972) (-394.945) -- 0:01:13
      39500 -- (-401.538) [-395.001] (-397.200) (-395.393) * (-396.225) (-396.982) (-397.124) [-394.579] -- 0:01:12
      40000 -- (-399.875) [-395.755] (-394.623) (-396.927) * [-395.196] (-395.588) (-399.337) (-396.173) -- 0:01:12

      Average standard deviation of split frequencies: 0.040267

      40500 -- (-405.947) [-395.849] (-395.364) (-399.252) * (-394.501) (-398.764) (-396.008) [-396.523] -- 0:01:11
      41000 -- (-396.271) (-398.601) (-394.644) [-397.141] * [-394.885] (-396.240) (-394.905) (-396.214) -- 0:01:10
      41500 -- (-398.926) (-396.077) (-394.588) [-395.812] * (-396.411) (-397.432) (-399.515) [-397.474] -- 0:01:09
      42000 -- (-396.345) (-394.563) (-399.946) [-396.081] * (-399.148) [-394.985] (-397.244) (-395.873) -- 0:01:08
      42500 -- (-396.583) [-395.588] (-396.519) (-396.770) * (-399.151) (-395.754) [-395.040] (-395.199) -- 0:01:07
      43000 -- (-398.063) (-395.906) [-394.918] (-397.334) * (-399.679) (-397.561) (-399.585) [-398.538] -- 0:01:06
      43500 -- (-395.368) [-396.614] (-397.067) (-396.847) * (-401.059) [-397.246] (-400.444) (-395.096) -- 0:01:05
      44000 -- (-394.126) (-394.434) (-395.286) [-395.198] * (-395.442) (-398.630) (-397.515) [-395.981] -- 0:01:05
      44500 -- (-396.043) (-396.906) [-399.090] (-394.802) * (-398.247) (-398.476) (-398.778) [-394.266] -- 0:01:04
      45000 -- [-399.488] (-395.582) (-395.668) (-397.997) * (-399.347) (-395.641) [-395.062] (-395.233) -- 0:01:03

      Average standard deviation of split frequencies: 0.039040

      45500 -- (-399.671) [-394.498] (-396.108) (-398.261) * [-395.959] (-395.598) (-395.484) (-395.647) -- 0:01:02
      46000 -- (-396.533) (-394.595) (-395.417) [-397.020] * [-396.984] (-397.326) (-396.057) (-399.097) -- 0:01:02
      46500 -- (-395.414) [-394.860] (-395.479) (-396.474) * [-395.141] (-395.999) (-399.425) (-397.480) -- 0:01:01
      47000 -- (-394.991) (-396.749) (-395.280) [-394.728] * (-395.334) (-395.351) [-400.696] (-401.243) -- 0:01:00
      47500 -- (-400.192) (-396.542) (-395.046) [-396.543] * [-395.285] (-396.341) (-396.480) (-396.961) -- 0:01:00
      48000 -- (-395.534) (-396.435) [-397.058] (-396.559) * (-404.171) (-398.285) (-397.453) [-395.487] -- 0:00:59
      48500 -- [-397.736] (-397.349) (-395.722) (-397.289) * (-403.969) (-403.579) [-396.225] (-395.088) -- 0:00:58
      49000 -- (-395.423) (-395.367) (-394.110) [-394.595] * (-399.405) (-399.075) (-396.988) [-395.759] -- 0:00:58
      49500 -- [-394.919] (-396.376) (-394.415) (-399.354) * (-395.793) (-400.713) (-395.198) [-393.913] -- 0:00:57
      50000 -- [-397.673] (-395.254) (-396.175) (-398.029) * [-397.503] (-399.951) (-395.441) (-396.966) -- 0:00:57

      Average standard deviation of split frequencies: 0.041351

      50500 -- [-395.167] (-394.268) (-395.825) (-395.006) * [-396.759] (-399.409) (-395.340) (-396.487) -- 0:01:15
      51000 -- (-397.543) [-394.571] (-397.380) (-395.440) * (-395.990) (-400.828) (-402.042) [-395.717] -- 0:01:14
      51500 -- (-394.213) (-394.033) [-396.030] (-396.365) * (-399.548) [-395.900] (-399.258) (-397.129) -- 0:01:13
      52000 -- (-394.586) (-395.947) [-396.546] (-396.330) * (-396.225) [-394.789] (-397.827) (-395.267) -- 0:01:12
      52500 -- (-395.726) [-395.467] (-397.097) (-408.692) * (-395.358) (-394.550) (-396.816) [-396.041] -- 0:01:12
      53000 -- [-398.014] (-398.946) (-396.597) (-403.517) * [-395.865] (-395.216) (-395.562) (-396.921) -- 0:01:11
      53500 -- [-395.016] (-396.299) (-395.593) (-394.824) * [-397.431] (-395.131) (-399.172) (-397.840) -- 0:01:10
      54000 -- (-396.503) (-398.830) [-396.491] (-394.855) * (-395.652) (-395.928) (-396.379) [-395.436] -- 0:01:10
      54500 -- (-399.025) [-394.907] (-394.669) (-396.179) * (-399.011) (-397.170) [-395.218] (-395.658) -- 0:01:09
      55000 -- (-397.795) [-395.053] (-395.396) (-395.715) * (-397.451) (-395.559) (-395.283) [-394.657] -- 0:01:08

      Average standard deviation of split frequencies: 0.040761

      55500 -- [-395.691] (-395.534) (-395.421) (-394.786) * [-396.332] (-397.987) (-394.714) (-395.606) -- 0:01:08
      56000 -- (-397.004) (-399.263) [-395.470] (-396.753) * (-397.574) (-396.019) [-394.336] (-394.495) -- 0:01:07
      56500 -- (-398.041) (-394.632) [-396.339] (-399.952) * (-397.031) (-400.763) (-397.057) [-394.599] -- 0:01:06
      57000 -- [-395.021] (-395.248) (-395.574) (-396.764) * (-395.179) (-397.447) [-400.549] (-396.604) -- 0:01:06
      57500 -- (-397.116) (-397.299) [-396.153] (-397.820) * (-397.789) [-396.997] (-395.402) (-397.252) -- 0:01:05
      58000 -- (-398.677) (-398.740) [-396.988] (-397.017) * (-394.818) (-394.471) [-394.740] (-394.771) -- 0:01:04
      58500 -- [-396.255] (-397.328) (-397.729) (-395.723) * (-400.817) [-396.718] (-395.438) (-396.728) -- 0:01:04
      59000 -- (-397.253) (-395.055) (-395.221) [-395.689] * (-398.379) (-397.114) [-396.120] (-396.711) -- 0:01:03
      59500 -- (-398.526) [-396.998] (-398.985) (-394.791) * [-396.296] (-398.066) (-395.836) (-396.556) -- 0:01:03
      60000 -- (-397.493) (-397.766) [-394.574] (-397.140) * (-403.252) (-396.246) [-397.748] (-395.829) -- 0:01:02

      Average standard deviation of split frequencies: 0.032309

      60500 -- (-394.537) (-400.503) (-397.357) [-395.234] * [-399.252] (-396.617) (-398.420) (-397.789) -- 0:01:02
      61000 -- (-396.035) (-395.028) (-396.667) [-396.227] * (-398.615) [-396.727] (-395.281) (-400.218) -- 0:01:01
      61500 -- (-395.378) [-396.888] (-396.730) (-398.056) * [-395.640] (-398.079) (-396.923) (-396.191) -- 0:01:01
      62000 -- (-395.680) (-395.130) (-396.759) [-398.553] * (-396.919) [-398.994] (-397.118) (-397.604) -- 0:01:00
      62500 -- (-399.444) (-396.325) [-398.651] (-394.844) * [-396.141] (-395.850) (-395.393) (-397.718) -- 0:01:00
      63000 -- (-402.163) [-394.912] (-396.640) (-394.735) * [-395.668] (-399.109) (-398.060) (-397.498) -- 0:00:59
      63500 -- (-402.189) (-395.348) (-398.847) [-398.534] * (-395.509) [-396.526] (-397.837) (-396.190) -- 0:00:58
      64000 -- (-400.820) [-395.861] (-398.350) (-396.062) * (-395.929) (-399.028) [-395.051] (-394.642) -- 0:00:58
      64500 -- (-396.913) (-396.444) (-398.157) [-396.358] * (-399.448) (-396.136) (-397.796) [-396.289] -- 0:00:58
      65000 -- (-395.076) (-401.465) (-397.808) [-398.460] * (-395.419) [-395.014] (-396.842) (-395.081) -- 0:00:57

      Average standard deviation of split frequencies: 0.026869

      65500 -- (-396.046) (-396.839) (-395.809) [-395.277] * (-396.301) [-396.311] (-395.948) (-397.598) -- 0:00:57
      66000 -- (-396.122) (-397.452) (-395.983) [-397.565] * (-395.391) (-396.240) (-396.237) [-396.676] -- 0:00:56
      66500 -- (-398.998) (-396.603) [-396.104] (-395.271) * (-396.411) (-397.398) (-396.090) [-396.661] -- 0:01:10
      67000 -- (-401.563) [-396.857] (-394.903) (-395.914) * (-396.918) (-397.612) [-396.474] (-397.520) -- 0:01:09
      67500 -- (-397.572) (-396.909) (-397.898) [-396.843] * (-396.127) (-403.066) [-394.689] (-395.888) -- 0:01:09
      68000 -- (-396.578) (-398.494) [-395.678] (-399.208) * (-396.069) [-400.473] (-395.746) (-397.401) -- 0:01:08
      68500 -- (-394.181) (-398.860) (-399.224) [-395.013] * (-394.210) [-397.710] (-396.702) (-396.140) -- 0:01:07
      69000 -- (-395.881) (-394.627) [-398.927] (-394.634) * (-395.648) (-396.848) (-398.880) [-396.209] -- 0:01:07
      69500 -- (-396.030) (-395.138) (-396.023) [-396.905] * [-396.366] (-396.463) (-395.563) (-396.535) -- 0:01:06
      70000 -- (-394.447) [-394.645] (-396.490) (-399.823) * (-400.334) (-395.491) [-394.845] (-401.057) -- 0:01:06

      Average standard deviation of split frequencies: 0.022347

      70500 -- [-396.531] (-394.845) (-395.438) (-395.051) * (-396.032) (-394.876) [-394.952] (-394.719) -- 0:01:05
      71000 -- (-401.329) [-396.343] (-395.506) (-396.414) * (-395.472) (-398.312) (-399.015) [-397.964] -- 0:01:05
      71500 -- [-395.807] (-395.491) (-396.847) (-396.268) * (-395.705) [-397.215] (-397.286) (-395.230) -- 0:01:04
      72000 -- (-394.835) (-394.716) [-395.899] (-397.868) * (-399.636) [-397.712] (-398.475) (-400.256) -- 0:01:04
      72500 -- (-395.407) (-396.680) (-396.862) [-395.897] * (-394.525) (-400.153) (-396.997) [-395.146] -- 0:01:03
      73000 -- (-399.969) (-396.474) (-397.107) [-395.575] * [-394.481] (-395.944) (-398.765) (-396.851) -- 0:01:03
      73500 -- (-400.711) [-396.614] (-396.787) (-396.377) * (-395.351) (-396.250) [-396.008] (-397.235) -- 0:01:03
      74000 -- [-394.162] (-396.819) (-397.395) (-394.003) * [-395.635] (-395.214) (-395.740) (-396.335) -- 0:01:02
      74500 -- (-395.977) [-395.298] (-396.810) (-397.553) * (-395.960) (-397.203) [-395.222] (-398.981) -- 0:01:02
      75000 -- [-395.789] (-395.733) (-394.739) (-400.766) * [-396.281] (-397.875) (-396.393) (-396.935) -- 0:01:01

      Average standard deviation of split frequencies: 0.024811

      75500 -- (-398.459) (-396.355) [-397.309] (-395.467) * (-396.792) (-396.284) (-397.289) [-397.123] -- 0:01:01
      76000 -- (-396.228) (-399.943) [-396.643] (-401.316) * (-396.736) (-396.054) [-394.738] (-398.447) -- 0:01:00
      76500 -- [-394.442] (-395.055) (-397.793) (-401.371) * [-394.639] (-396.591) (-396.864) (-396.492) -- 0:01:00
      77000 -- (-395.011) (-396.112) [-395.992] (-398.756) * (-396.027) (-400.376) [-396.829] (-399.519) -- 0:00:59
      77500 -- [-395.174] (-398.443) (-397.363) (-396.918) * [-398.393] (-400.201) (-395.094) (-397.792) -- 0:00:59
      78000 -- (-395.409) [-395.476] (-396.530) (-399.072) * (-399.219) (-395.271) [-397.001] (-394.733) -- 0:00:59
      78500 -- [-395.280] (-395.399) (-396.941) (-398.782) * (-398.576) (-398.228) (-400.669) [-397.676] -- 0:00:58
      79000 -- (-398.457) (-397.533) [-397.237] (-397.720) * (-398.550) [-396.932] (-395.454) (-399.375) -- 0:00:58
      79500 -- [-397.007] (-398.565) (-395.178) (-395.195) * (-397.825) (-397.687) [-397.002] (-396.626) -- 0:00:57
      80000 -- (-394.230) [-394.839] (-394.605) (-397.155) * [-395.305] (-396.360) (-395.843) (-395.517) -- 0:00:57

      Average standard deviation of split frequencies: 0.023097

      80500 -- (-396.294) (-395.610) [-395.200] (-397.431) * (-395.734) (-400.064) [-396.867] (-395.720) -- 0:00:57
      81000 -- (-394.504) (-400.509) [-395.706] (-396.039) * (-396.797) (-394.601) [-395.782] (-395.639) -- 0:00:56
      81500 -- [-395.670] (-398.871) (-395.128) (-394.944) * (-399.323) (-396.543) [-396.491] (-395.415) -- 0:00:56
      82000 -- (-395.890) (-399.498) [-395.215] (-396.370) * (-398.273) (-401.745) [-395.825] (-396.035) -- 0:00:55
      82500 -- (-394.208) [-397.575] (-397.896) (-398.009) * (-399.366) [-395.690] (-398.754) (-395.419) -- 0:00:55
      83000 -- [-395.486] (-394.822) (-395.179) (-394.875) * [-396.113] (-395.873) (-396.315) (-395.999) -- 0:00:55
      83500 -- (-394.752) (-396.399) [-396.762] (-393.990) * (-396.325) (-396.825) [-394.741] (-396.100) -- 0:01:05
      84000 -- (-395.659) (-397.608) (-396.292) [-395.804] * [-395.362] (-399.782) (-396.588) (-395.877) -- 0:01:05
      84500 -- [-395.437] (-397.934) (-394.745) (-394.972) * (-400.474) [-395.288] (-398.861) (-399.327) -- 0:01:05
      85000 -- (-395.152) [-395.131] (-394.321) (-395.863) * (-396.352) (-396.709) (-398.999) [-398.365] -- 0:01:04

      Average standard deviation of split frequencies: 0.022448

      85500 -- (-394.876) (-397.140) [-395.575] (-394.873) * [-396.716] (-397.380) (-398.810) (-397.069) -- 0:01:04
      86000 -- (-395.706) [-397.399] (-396.191) (-394.433) * (-401.632) (-395.398) (-396.746) [-396.204] -- 0:01:03
      86500 -- (-396.395) (-395.903) (-400.210) [-395.008] * (-397.581) (-397.798) [-396.885] (-394.692) -- 0:01:03
      87000 -- (-395.462) [-394.513] (-396.247) (-395.899) * (-398.088) (-395.382) [-398.446] (-397.080) -- 0:01:02
      87500 -- (-395.895) (-396.807) (-404.230) [-395.584] * (-395.415) [-397.635] (-399.807) (-397.116) -- 0:01:02
      88000 -- [-394.940] (-396.118) (-403.085) (-394.941) * [-395.250] (-396.764) (-396.031) (-394.699) -- 0:01:02
      88500 -- (-394.710) [-395.874] (-402.601) (-397.458) * (-394.887) (-395.362) [-395.410] (-396.411) -- 0:01:01
      89000 -- (-398.369) (-396.853) (-395.425) [-395.321] * (-396.700) (-403.393) (-395.448) [-396.410] -- 0:01:01
      89500 -- (-400.472) (-395.089) (-398.641) [-399.101] * (-398.656) (-398.058) (-397.101) [-395.248] -- 0:01:01
      90000 -- (-406.295) (-400.703) [-395.609] (-395.758) * (-396.854) (-398.503) (-397.532) [-395.626] -- 0:01:00

      Average standard deviation of split frequencies: 0.024342

      90500 -- (-398.596) [-396.762] (-395.689) (-399.141) * (-395.182) (-398.471) [-400.459] (-395.830) -- 0:01:00
      91000 -- (-397.326) (-396.053) [-396.109] (-397.487) * (-396.870) [-398.758] (-396.407) (-397.927) -- 0:00:59
      91500 -- [-397.760] (-396.715) (-398.545) (-395.054) * (-395.563) (-398.736) [-396.487] (-396.489) -- 0:00:59
      92000 -- (-394.895) (-394.869) [-398.951] (-395.686) * [-396.320] (-396.186) (-397.507) (-396.430) -- 0:00:59
      92500 -- (-395.909) (-400.600) (-396.516) [-395.394] * (-397.430) [-395.698] (-395.090) (-401.718) -- 0:00:58
      93000 -- [-397.782] (-395.039) (-397.049) (-399.821) * (-396.093) (-399.506) [-396.651] (-398.375) -- 0:00:58
      93500 -- [-400.546] (-399.345) (-396.632) (-396.478) * (-400.423) (-394.388) [-394.707] (-396.547) -- 0:00:58
      94000 -- (-398.232) (-397.645) [-396.855] (-397.260) * (-395.516) (-394.435) [-395.197] (-399.369) -- 0:00:57
      94500 -- (-394.364) (-398.179) (-402.036) [-397.045] * (-395.397) [-394.899] (-396.619) (-401.218) -- 0:00:57
      95000 -- (-395.331) (-396.982) (-397.141) [-397.995] * (-396.992) (-396.286) [-396.647] (-397.058) -- 0:00:57

      Average standard deviation of split frequencies: 0.026784

      95500 -- (-396.745) (-397.747) [-394.189] (-396.997) * [-394.963] (-396.239) (-396.336) (-396.350) -- 0:00:56
      96000 -- (-402.891) [-396.184] (-395.589) (-395.138) * (-395.576) (-396.348) (-395.172) [-396.256] -- 0:00:56
      96500 -- (-400.091) (-395.439) [-397.250] (-403.383) * (-395.555) [-394.751] (-394.360) (-395.508) -- 0:00:56
      97000 -- (-398.579) (-395.812) (-399.764) [-394.654] * (-396.046) (-395.947) (-398.853) [-395.082] -- 0:00:55
      97500 -- [-397.958] (-396.233) (-395.995) (-396.576) * (-396.298) (-396.644) (-398.656) [-394.898] -- 0:00:55
      98000 -- [-394.840] (-395.139) (-394.616) (-395.660) * (-398.486) (-396.961) [-396.929] (-396.217) -- 0:00:55
      98500 -- [-395.932] (-397.196) (-397.722) (-397.358) * [-395.551] (-400.732) (-397.321) (-395.814) -- 0:00:54
      99000 -- (-395.929) [-398.852] (-398.192) (-397.051) * (-397.650) [-395.767] (-397.032) (-395.154) -- 0:00:54
      99500 -- (-399.572) (-394.958) [-395.525] (-395.771) * (-395.389) (-395.618) (-395.026) [-395.419] -- 0:00:54
      100000 -- [-398.689] (-394.774) (-396.563) (-396.025) * (-397.263) (-398.638) [-399.416] (-396.278) -- 0:00:54

      Average standard deviation of split frequencies: 0.026090

      100500 -- (-399.076) (-395.634) [-395.737] (-394.974) * [-395.673] (-399.061) (-396.446) (-396.949) -- 0:01:02
      101000 -- (-399.719) (-395.220) [-397.602] (-397.576) * (-394.716) [-394.632] (-394.077) (-394.682) -- 0:01:02
      101500 -- (-394.875) [-394.696] (-395.402) (-395.512) * (-396.319) (-394.662) [-394.635] (-396.007) -- 0:01:01
      102000 -- (-397.743) (-398.207) (-396.620) [-397.542] * (-396.186) [-395.754] (-398.002) (-394.502) -- 0:01:01
      102500 -- (-400.289) (-396.172) (-395.856) [-397.141] * [-397.990] (-396.462) (-396.678) (-395.761) -- 0:01:01
      103000 -- (-395.990) [-396.682] (-394.881) (-401.060) * (-395.309) (-399.176) [-396.172] (-396.457) -- 0:01:00
      103500 -- (-404.993) (-396.294) [-396.781] (-395.039) * (-394.837) (-397.297) [-396.337] (-396.348) -- 0:01:00
      104000 -- [-403.663] (-394.922) (-396.525) (-395.322) * [-396.786] (-397.233) (-397.976) (-394.715) -- 0:01:00
      104500 -- (-402.827) [-396.761] (-398.014) (-401.760) * [-397.380] (-396.572) (-396.988) (-398.549) -- 0:00:59
      105000 -- (-395.494) [-397.982] (-394.977) (-395.700) * (-395.291) [-397.323] (-395.779) (-394.866) -- 0:00:59

      Average standard deviation of split frequencies: 0.027088

      105500 -- (-394.783) (-396.697) [-394.376] (-395.454) * (-396.829) [-395.018] (-401.382) (-395.896) -- 0:00:59
      106000 -- (-397.291) (-395.719) [-394.305] (-395.509) * [-396.445] (-394.567) (-395.628) (-395.112) -- 0:00:59
      106500 -- [-394.387] (-395.015) (-404.171) (-397.236) * (-394.802) [-394.639] (-396.086) (-395.407) -- 0:00:58
      107000 -- (-394.383) (-396.777) (-398.484) [-395.313] * (-399.893) (-398.281) (-395.561) [-397.230] -- 0:00:58
      107500 -- (-396.887) [-396.584] (-395.202) (-400.005) * (-398.966) (-396.243) (-395.474) [-395.484] -- 0:00:58
      108000 -- (-395.878) (-397.119) (-395.117) [-397.204] * [-395.865] (-398.198) (-397.073) (-400.458) -- 0:00:57
      108500 -- (-394.349) (-397.064) [-395.644] (-397.478) * (-396.286) (-396.419) [-394.686] (-394.934) -- 0:00:57
      109000 -- [-395.934] (-396.588) (-395.645) (-397.385) * (-396.174) [-395.031] (-395.864) (-400.184) -- 0:00:57
      109500 -- (-395.509) [-396.524] (-397.254) (-395.450) * [-395.112] (-397.091) (-396.741) (-396.462) -- 0:00:56
      110000 -- (-398.562) (-397.775) [-397.508] (-395.059) * (-395.228) (-399.845) (-394.487) [-395.677] -- 0:00:56

      Average standard deviation of split frequencies: 0.027107

      110500 -- (-396.279) [-396.899] (-397.561) (-395.441) * [-394.746] (-403.325) (-394.556) (-395.221) -- 0:00:56
      111000 -- (-396.509) (-394.904) (-396.546) [-395.127] * [-396.689] (-398.674) (-396.679) (-395.575) -- 0:00:56
      111500 -- [-394.845] (-397.485) (-395.347) (-394.963) * (-394.904) [-397.053] (-399.250) (-395.234) -- 0:00:55
      112000 -- [-399.390] (-397.137) (-396.636) (-394.431) * [-396.486] (-394.708) (-397.549) (-395.126) -- 0:00:55
      112500 -- [-395.820] (-396.682) (-396.234) (-396.635) * (-394.291) (-397.678) [-395.904] (-395.409) -- 0:00:55
      113000 -- [-395.283] (-396.662) (-396.062) (-401.009) * [-396.533] (-397.955) (-396.256) (-396.687) -- 0:00:54
      113500 -- (-397.328) (-395.624) [-396.102] (-395.962) * (-399.228) (-395.421) [-394.784] (-396.477) -- 0:00:54
      114000 -- (-398.382) (-395.002) [-397.293] (-398.686) * (-399.349) (-395.298) (-394.878) [-396.978] -- 0:00:54
      114500 -- (-394.810) (-395.222) [-396.076] (-396.157) * (-395.875) (-396.064) [-394.119] (-396.996) -- 0:00:54
      115000 -- (-394.700) (-395.686) (-397.128) [-397.352] * (-395.030) (-394.618) (-394.879) [-399.870] -- 0:00:53

      Average standard deviation of split frequencies: 0.025544

      115500 -- [-395.572] (-397.274) (-395.006) (-397.977) * (-394.306) (-396.946) (-395.483) [-396.488] -- 0:00:53
      116000 -- [-397.694] (-397.367) (-395.222) (-397.514) * (-397.202) [-396.103] (-396.820) (-395.711) -- 0:00:53
      116500 -- (-394.461) (-397.938) [-394.754] (-394.740) * [-394.898] (-395.804) (-396.553) (-398.294) -- 0:00:53
      117000 -- [-396.083] (-398.358) (-395.397) (-394.644) * [-398.261] (-402.489) (-398.921) (-395.619) -- 0:01:00
      117500 -- (-396.232) [-396.670] (-397.146) (-394.971) * (-397.877) (-394.432) (-399.771) [-396.974] -- 0:01:00
      118000 -- [-395.206] (-395.583) (-396.853) (-395.041) * (-399.313) (-394.860) (-396.363) [-397.104] -- 0:00:59
      118500 -- (-395.946) (-394.431) [-402.083] (-396.399) * [-395.727] (-394.644) (-395.309) (-397.716) -- 0:00:59
      119000 -- [-397.081] (-395.435) (-399.452) (-395.842) * (-397.329) (-398.009) (-396.122) [-396.308] -- 0:00:59
      119500 -- (-394.298) [-400.902] (-395.537) (-395.655) * (-397.215) [-399.663] (-396.563) (-394.886) -- 0:00:58
      120000 -- (-395.831) (-396.774) [-395.584] (-395.906) * (-398.885) (-396.720) (-397.211) [-396.795] -- 0:00:58

      Average standard deviation of split frequencies: 0.025300

      120500 -- (-396.514) [-396.056] (-394.952) (-395.667) * [-396.653] (-397.855) (-395.331) (-397.408) -- 0:00:58
      121000 -- (-394.834) (-395.531) [-396.887] (-395.074) * (-400.334) (-404.273) (-395.707) [-396.924] -- 0:00:58
      121500 -- (-395.740) [-396.747] (-394.108) (-396.993) * (-394.861) (-399.178) [-394.807] (-398.051) -- 0:00:57
      122000 -- (-395.252) [-394.574] (-394.459) (-397.205) * [-396.899] (-401.362) (-395.325) (-396.330) -- 0:00:57
      122500 -- (-397.170) [-394.501] (-396.359) (-396.039) * [-395.870] (-401.795) (-397.508) (-397.288) -- 0:00:57
      123000 -- (-396.258) (-398.938) [-395.798] (-397.724) * [-395.916] (-397.455) (-401.960) (-396.658) -- 0:00:57
      123500 -- [-395.968] (-395.401) (-400.051) (-401.391) * (-400.236) (-396.491) (-401.931) [-396.085] -- 0:00:56
      124000 -- (-399.182) [-396.195] (-397.996) (-400.041) * (-399.145) (-394.715) [-396.732] (-396.796) -- 0:00:56
      124500 -- (-405.260) (-395.356) [-395.794] (-394.716) * (-396.797) (-396.162) [-395.675] (-395.002) -- 0:00:56
      125000 -- (-399.857) (-399.291) [-398.007] (-395.631) * (-396.325) (-396.379) [-395.973] (-396.168) -- 0:00:56

      Average standard deviation of split frequencies: 0.026189

      125500 -- (-396.778) [-399.261] (-395.897) (-394.927) * (-398.340) (-397.851) (-398.493) [-395.290] -- 0:00:55
      126000 -- (-399.190) (-396.836) [-394.913] (-395.428) * (-395.416) (-395.358) [-395.087] (-394.688) -- 0:00:55
      126500 -- (-396.860) (-396.966) (-398.960) [-394.984] * (-397.542) (-394.640) (-394.751) [-396.814] -- 0:00:55
      127000 -- (-396.577) [-396.516] (-394.731) (-395.239) * [-395.424] (-394.877) (-395.461) (-395.243) -- 0:00:54
      127500 -- (-395.680) (-395.778) (-398.023) [-396.354] * (-394.604) [-396.287] (-397.769) (-395.399) -- 0:00:54
      128000 -- (-395.812) (-397.987) [-396.835] (-395.232) * (-396.512) (-396.190) (-400.639) [-396.374] -- 0:00:54
      128500 -- (-397.797) (-396.146) (-398.259) [-396.338] * [-395.790] (-396.202) (-397.395) (-400.296) -- 0:00:54
      129000 -- (-398.339) (-397.402) [-395.821] (-399.087) * (-396.820) [-397.126] (-395.716) (-396.483) -- 0:00:54
      129500 -- (-398.315) (-395.219) [-399.418] (-397.894) * (-401.289) (-397.011) [-394.233] (-395.206) -- 0:00:53
      130000 -- [-397.436] (-396.030) (-396.953) (-395.487) * (-397.443) [-396.239] (-394.369) (-395.903) -- 0:00:53

      Average standard deviation of split frequencies: 0.024910

      130500 -- (-395.324) (-405.476) (-396.352) [-399.384] * (-395.315) [-398.609] (-395.351) (-394.141) -- 0:00:53
      131000 -- (-404.285) (-400.628) [-398.906] (-397.600) * (-396.285) [-394.762] (-397.729) (-395.412) -- 0:00:53
      131500 -- [-396.633] (-397.444) (-399.115) (-394.085) * (-396.115) [-396.097] (-399.897) (-397.386) -- 0:00:52
      132000 -- [-398.922] (-399.602) (-397.447) (-394.643) * (-397.609) [-394.833] (-397.863) (-396.348) -- 0:00:52
      132500 -- (-399.278) [-398.353] (-395.525) (-395.496) * (-396.680) (-396.890) [-396.200] (-401.656) -- 0:00:52
      133000 -- (-399.821) (-394.159) [-395.806] (-400.514) * [-395.967] (-395.703) (-397.934) (-397.447) -- 0:00:52
      133500 -- (-397.152) [-396.842] (-395.932) (-399.658) * (-394.753) [-396.045] (-395.829) (-395.151) -- 0:00:58
      134000 -- (-396.060) (-395.756) [-395.309] (-394.555) * (-396.622) (-402.150) [-400.821] (-395.958) -- 0:00:58
      134500 -- [-397.849] (-394.812) (-396.949) (-396.036) * (-394.959) (-396.663) (-399.975) [-396.404] -- 0:00:57
      135000 -- (-395.984) [-394.787] (-396.333) (-397.343) * (-399.712) (-398.940) [-395.498] (-396.959) -- 0:00:57

      Average standard deviation of split frequencies: 0.024594

      135500 -- (-401.040) (-397.209) (-397.909) [-396.353] * (-398.557) (-395.991) (-396.277) [-399.297] -- 0:00:57
      136000 -- (-399.187) (-396.242) [-395.027] (-395.526) * (-395.638) [-397.088] (-396.418) (-396.626) -- 0:00:57
      136500 -- (-397.216) [-395.032] (-398.313) (-395.230) * (-394.295) [-396.799] (-396.226) (-396.902) -- 0:00:56
      137000 -- (-397.822) [-396.680] (-396.471) (-394.376) * (-396.446) [-396.228] (-395.639) (-398.849) -- 0:00:56
      137500 -- (-394.399) (-397.567) [-396.592] (-394.755) * (-397.612) (-399.994) (-395.656) [-395.476] -- 0:00:56
      138000 -- (-396.098) (-399.027) [-402.083] (-396.186) * (-395.130) (-394.612) (-399.665) [-397.855] -- 0:00:56
      138500 -- (-395.831) [-396.030] (-397.409) (-396.364) * (-397.911) (-396.547) [-397.131] (-396.344) -- 0:00:55
      139000 -- (-397.218) (-394.852) [-396.557] (-394.955) * (-397.834) (-397.812) [-394.304] (-396.508) -- 0:00:55
      139500 -- (-395.407) (-394.290) (-395.698) [-396.489] * (-398.268) [-396.170] (-396.357) (-396.771) -- 0:00:55
      140000 -- (-395.575) (-394.948) [-395.357] (-399.272) * (-397.511) (-395.365) (-394.768) [-397.208] -- 0:00:55

      Average standard deviation of split frequencies: 0.022661

      140500 -- (-397.697) (-396.171) (-400.898) [-395.900] * (-397.477) (-394.095) [-395.725] (-395.861) -- 0:00:55
      141000 -- (-394.746) (-396.797) (-401.714) [-396.695] * (-395.624) [-394.225] (-396.223) (-396.431) -- 0:00:54
      141500 -- (-395.942) [-395.879] (-397.902) (-395.787) * [-396.285] (-395.132) (-395.259) (-395.593) -- 0:00:54
      142000 -- (-400.888) [-398.558] (-396.883) (-394.878) * (-402.010) (-396.079) (-394.775) [-395.243] -- 0:00:54
      142500 -- (-395.878) (-398.263) [-396.005] (-395.184) * (-395.255) (-395.670) (-395.917) [-394.210] -- 0:00:54
      143000 -- (-394.453) [-396.724] (-396.972) (-396.063) * (-398.844) (-395.609) [-396.158] (-394.798) -- 0:00:53
      143500 -- (-398.640) [-395.573] (-394.884) (-396.202) * (-395.825) (-404.210) [-397.417] (-394.975) -- 0:00:53
      144000 -- (-397.606) [-395.645] (-394.390) (-397.550) * (-397.902) (-396.996) [-398.419] (-394.521) -- 0:00:53
      144500 -- (-399.576) (-395.372) [-396.151] (-396.269) * [-395.701] (-396.711) (-394.067) (-397.268) -- 0:00:53
      145000 -- (-396.233) [-395.380] (-399.362) (-398.627) * (-395.252) [-394.282] (-398.508) (-396.558) -- 0:00:53

      Average standard deviation of split frequencies: 0.019680

      145500 -- (-395.039) (-395.968) [-395.314] (-397.596) * [-395.831] (-394.206) (-398.421) (-398.064) -- 0:00:52
      146000 -- (-395.485) (-398.240) [-395.354] (-397.478) * (-395.751) [-395.784] (-394.919) (-394.735) -- 0:00:52
      146500 -- (-394.814) [-395.113] (-395.776) (-394.918) * [-400.576] (-399.280) (-395.742) (-396.023) -- 0:00:52
      147000 -- (-395.450) (-397.081) (-394.917) [-396.337] * (-401.291) (-395.993) [-394.834] (-394.804) -- 0:00:52
      147500 -- (-396.088) (-399.669) (-394.568) [-395.013] * (-396.406) (-395.548) (-397.505) [-395.805] -- 0:00:52
      148000 -- [-398.058] (-396.051) (-399.930) (-396.241) * [-396.587] (-396.004) (-396.222) (-395.187) -- 0:00:51
      148500 -- (-396.110) [-394.975] (-395.942) (-394.358) * (-396.244) (-397.034) [-394.358] (-399.173) -- 0:00:51
      149000 -- (-395.195) (-396.857) (-394.251) [-396.804] * (-395.253) [-395.161] (-396.251) (-400.001) -- 0:00:51
      149500 -- (-396.137) [-397.555] (-395.263) (-395.608) * (-397.297) (-396.689) [-397.844] (-397.319) -- 0:00:51
      150000 -- (-396.660) (-396.092) (-396.729) [-396.505] * (-395.417) (-396.105) (-397.113) [-398.410] -- 0:00:51

      Average standard deviation of split frequencies: 0.019086

      150500 -- [-394.399] (-398.950) (-399.210) (-396.587) * (-395.460) (-395.233) [-396.933] (-395.057) -- 0:00:56
      151000 -- (-395.277) [-398.154] (-394.592) (-400.909) * (-398.103) (-394.509) (-394.113) [-394.693] -- 0:00:56
      151500 -- [-394.772] (-396.766) (-396.599) (-400.467) * [-395.712] (-401.571) (-395.581) (-395.120) -- 0:00:56
      152000 -- [-399.334] (-394.784) (-395.144) (-397.874) * (-394.409) (-397.720) (-400.620) [-395.559] -- 0:00:55
      152500 -- (-395.533) (-398.990) [-395.481] (-396.300) * (-399.172) (-396.682) [-394.536] (-397.723) -- 0:00:55
      153000 -- (-397.748) (-394.900) [-396.763] (-394.668) * (-395.853) (-399.436) (-397.809) [-397.071] -- 0:00:55
      153500 -- (-402.139) [-394.391] (-394.544) (-397.204) * (-398.287) (-398.132) [-396.200] (-397.320) -- 0:00:55
      154000 -- (-398.902) (-396.859) [-394.703] (-394.807) * (-397.446) (-395.280) (-396.587) [-396.653] -- 0:00:54
      154500 -- (-397.297) (-397.194) [-395.371] (-399.068) * (-395.359) [-397.702] (-394.873) (-394.944) -- 0:00:54
      155000 -- [-395.450] (-397.218) (-396.011) (-398.397) * (-399.584) (-397.556) [-394.601] (-396.728) -- 0:00:54

      Average standard deviation of split frequencies: 0.018433

      155500 -- [-395.178] (-398.232) (-397.961) (-395.062) * (-395.420) (-399.935) [-396.319] (-395.576) -- 0:00:54
      156000 -- [-394.794] (-400.508) (-397.331) (-398.452) * [-395.839] (-400.660) (-396.294) (-394.808) -- 0:00:54
      156500 -- (-396.183) (-403.015) (-403.875) [-396.513] * (-395.528) [-396.497] (-395.338) (-395.650) -- 0:00:53
      157000 -- (-398.776) (-404.616) (-395.068) [-397.061] * [-394.774] (-397.798) (-400.084) (-398.335) -- 0:00:53
      157500 -- (-400.137) [-399.777] (-397.396) (-398.990) * (-394.602) (-397.219) [-396.598] (-397.717) -- 0:00:53
      158000 -- (-395.251) [-397.611] (-396.314) (-395.570) * [-395.348] (-396.333) (-395.674) (-395.105) -- 0:00:53
      158500 -- [-394.773] (-394.639) (-396.605) (-398.438) * (-398.131) (-397.682) [-396.134] (-394.376) -- 0:00:53
      159000 -- (-397.537) [-395.709] (-397.186) (-399.496) * [-396.631] (-397.897) (-395.290) (-397.213) -- 0:00:52
      159500 -- [-394.780] (-396.432) (-396.512) (-396.352) * (-397.230) (-395.917) (-396.193) [-397.469] -- 0:00:52
      160000 -- (-397.623) (-398.350) (-398.034) [-394.754] * (-396.463) (-397.772) (-397.034) [-396.997] -- 0:00:52

      Average standard deviation of split frequencies: 0.018925

      160500 -- [-396.284] (-396.033) (-396.522) (-395.083) * [-397.211] (-394.743) (-394.566) (-394.772) -- 0:00:52
      161000 -- (-397.558) (-401.917) [-394.969] (-395.177) * (-395.187) [-398.920] (-400.904) (-394.648) -- 0:00:52
      161500 -- [-400.619] (-398.742) (-395.332) (-396.527) * (-398.192) (-395.429) (-399.687) [-395.292] -- 0:00:51
      162000 -- (-395.377) (-397.274) [-397.246] (-397.150) * (-399.300) (-396.229) (-395.910) [-397.734] -- 0:00:51
      162500 -- (-397.850) [-395.083] (-394.556) (-398.767) * (-397.688) [-394.141] (-397.601) (-398.992) -- 0:00:51
      163000 -- [-396.198] (-394.875) (-398.149) (-395.955) * (-398.327) [-397.598] (-399.383) (-399.476) -- 0:00:51
      163500 -- (-396.178) (-397.119) [-397.214] (-395.779) * (-401.240) (-397.617) (-398.676) [-401.917] -- 0:00:51
      164000 -- (-399.304) (-396.690) (-397.003) [-396.894] * [-397.648] (-397.064) (-396.724) (-396.800) -- 0:00:50
      164500 -- [-396.400] (-395.807) (-396.205) (-396.642) * (-398.775) (-394.810) [-395.859] (-398.077) -- 0:00:50
      165000 -- (-397.288) (-395.461) (-398.221) [-399.692] * (-397.237) (-395.734) (-398.441) [-394.422] -- 0:00:50

      Average standard deviation of split frequencies: 0.018175

      165500 -- [-394.179] (-396.471) (-396.182) (-395.173) * [-395.565] (-396.141) (-396.978) (-394.417) -- 0:00:50
      166000 -- [-394.221] (-394.441) (-395.376) (-398.872) * (-401.841) (-396.655) (-396.731) [-394.184] -- 0:00:50
      166500 -- [-396.098] (-396.865) (-395.211) (-399.775) * (-396.332) (-396.057) (-396.874) [-394.916] -- 0:00:50
      167000 -- (-399.501) (-394.406) (-394.200) [-397.398] * (-395.950) (-404.177) (-395.281) [-395.587] -- 0:00:54
      167500 -- (-396.578) (-397.004) [-394.480] (-394.455) * [-396.836] (-395.483) (-395.974) (-395.996) -- 0:00:54
      168000 -- (-396.703) (-394.804) [-396.478] (-395.527) * [-396.048] (-395.803) (-395.228) (-395.608) -- 0:00:54
      168500 -- (-401.550) (-395.228) (-396.060) [-396.677] * (-394.902) [-395.302] (-395.548) (-396.084) -- 0:00:54
      169000 -- [-395.419] (-397.184) (-394.182) (-396.081) * (-395.512) (-398.393) [-396.648] (-401.372) -- 0:00:54
      169500 -- (-395.469) (-394.871) (-394.430) [-395.141] * (-397.181) [-396.362] (-400.355) (-398.430) -- 0:00:53
      170000 -- [-396.360] (-395.354) (-396.093) (-395.543) * (-397.063) (-398.369) (-398.070) [-395.321] -- 0:00:53

      Average standard deviation of split frequencies: 0.017678

      170500 -- (-397.682) (-394.802) [-397.549] (-397.451) * (-394.955) (-404.758) (-398.568) [-394.624] -- 0:00:53
      171000 -- (-402.752) (-395.004) [-394.793] (-399.284) * [-395.529] (-396.081) (-395.615) (-395.059) -- 0:00:53
      171500 -- (-400.094) [-394.895] (-395.836) (-396.528) * [-397.802] (-400.172) (-397.705) (-397.543) -- 0:00:53
      172000 -- (-398.685) (-395.380) [-399.612] (-397.327) * (-398.981) [-398.166] (-397.138) (-396.251) -- 0:00:52
      172500 -- (-396.175) (-394.597) (-402.968) [-394.570] * [-395.274] (-397.476) (-395.033) (-397.898) -- 0:00:52
      173000 -- (-398.910) (-396.273) (-398.856) [-395.561] * (-396.399) (-399.510) (-395.131) [-397.981] -- 0:00:52
      173500 -- (-397.605) (-398.835) (-397.316) [-395.482] * (-397.571) (-396.943) (-400.309) [-395.447] -- 0:00:52
      174000 -- (-394.989) (-395.315) (-396.939) [-395.078] * [-394.815] (-398.675) (-394.078) (-394.894) -- 0:00:52
      174500 -- (-400.100) (-395.438) (-397.169) [-397.401] * (-395.144) (-397.279) [-395.794] (-394.887) -- 0:00:52
      175000 -- [-399.392] (-396.070) (-396.868) (-398.851) * (-396.135) (-396.773) (-398.237) [-396.045] -- 0:00:51

      Average standard deviation of split frequencies: 0.017276

      175500 -- (-394.651) (-397.734) (-398.510) [-394.979] * (-394.353) (-395.668) (-402.015) [-398.177] -- 0:00:51
      176000 -- (-399.321) [-397.598] (-396.643) (-395.075) * (-395.260) (-394.773) (-396.386) [-394.776] -- 0:00:51
      176500 -- (-396.101) (-398.737) [-396.487] (-395.204) * (-403.135) (-395.120) [-394.151] (-396.008) -- 0:00:51
      177000 -- (-395.429) [-397.950] (-394.831) (-397.431) * (-395.259) (-398.051) (-399.754) [-395.345] -- 0:00:51
      177500 -- (-396.213) (-397.258) (-395.987) [-397.116] * (-395.005) (-397.013) (-399.046) [-394.756] -- 0:00:50
      178000 -- (-395.584) (-396.698) [-396.796] (-394.413) * (-395.565) (-395.608) [-396.199] (-394.612) -- 0:00:50
      178500 -- (-395.982) [-398.335] (-397.662) (-397.889) * (-394.820) [-398.167] (-395.332) (-398.494) -- 0:00:50
      179000 -- (-396.578) [-394.603] (-395.564) (-396.309) * (-397.174) [-395.091] (-398.788) (-395.559) -- 0:00:50
      179500 -- (-395.790) (-397.826) (-394.274) [-396.934] * (-395.985) [-400.591] (-401.454) (-397.776) -- 0:00:50
      180000 -- [-398.257] (-395.606) (-398.370) (-398.464) * (-395.733) [-395.678] (-395.035) (-395.718) -- 0:00:50

      Average standard deviation of split frequencies: 0.017221

      180500 -- [-395.718] (-399.815) (-396.414) (-397.205) * [-395.925] (-395.863) (-395.957) (-399.090) -- 0:00:49
      181000 -- (-395.815) (-395.548) (-395.786) [-398.664] * [-395.344] (-397.691) (-394.540) (-395.049) -- 0:00:49
      181500 -- [-395.971] (-395.276) (-396.040) (-396.832) * (-398.278) [-396.882] (-394.628) (-396.861) -- 0:00:49
      182000 -- [-394.989] (-396.293) (-394.346) (-395.269) * (-397.936) (-394.861) (-398.848) [-396.312] -- 0:00:49
      182500 -- (-395.054) (-396.979) [-395.864] (-395.111) * (-396.541) [-394.473] (-396.681) (-396.796) -- 0:00:49
      183000 -- (-396.897) (-396.603) [-394.268] (-402.669) * [-396.189] (-395.354) (-394.886) (-394.651) -- 0:00:49
      183500 -- (-398.004) (-394.808) [-396.085] (-395.618) * (-397.281) [-397.293] (-398.186) (-400.191) -- 0:00:48
      184000 -- (-396.599) (-395.271) (-394.557) [-395.150] * (-396.678) (-394.573) (-396.326) [-395.684] -- 0:00:53
      184500 -- (-399.070) (-398.754) [-397.355] (-398.188) * (-398.215) [-395.652] (-395.268) (-401.971) -- 0:00:53
      185000 -- (-393.972) (-395.257) [-394.909] (-395.717) * [-397.197] (-394.729) (-397.539) (-404.282) -- 0:00:52

      Average standard deviation of split frequencies: 0.017107

      185500 -- (-395.129) (-397.493) [-394.353] (-396.034) * (-395.414) [-395.017] (-399.975) (-401.779) -- 0:00:52
      186000 -- (-396.741) (-397.130) (-395.019) [-395.743] * (-394.942) [-395.156] (-395.288) (-403.351) -- 0:00:52
      186500 -- (-394.995) (-397.767) (-396.683) [-397.182] * (-394.912) (-397.041) (-395.791) [-399.338] -- 0:00:52
      187000 -- (-396.361) (-395.306) (-394.896) [-395.782] * [-399.708] (-397.476) (-398.153) (-397.420) -- 0:00:52
      187500 -- [-396.841] (-395.734) (-395.124) (-394.408) * (-399.020) (-395.527) (-395.948) [-398.243] -- 0:00:52
      188000 -- (-398.327) (-399.702) (-398.550) [-396.617] * [-398.229] (-396.191) (-395.469) (-398.105) -- 0:00:51
      188500 -- (-395.155) (-398.483) (-397.691) [-399.202] * [-397.532] (-398.111) (-398.245) (-397.276) -- 0:00:51
      189000 -- (-395.893) [-395.695] (-395.488) (-397.220) * (-394.893) [-395.403] (-396.094) (-394.738) -- 0:00:51
      189500 -- (-396.053) [-397.131] (-398.434) (-396.389) * (-396.744) (-396.516) (-395.300) [-395.593] -- 0:00:51
      190000 -- (-396.230) (-396.723) (-396.787) [-399.888] * (-396.821) (-395.774) (-396.881) [-395.471] -- 0:00:51

      Average standard deviation of split frequencies: 0.016194

      190500 -- (-400.865) (-395.010) (-394.490) [-401.202] * (-396.079) (-395.124) (-396.954) [-394.922] -- 0:00:50
      191000 -- [-396.254] (-398.032) (-395.781) (-397.212) * (-394.875) [-395.698] (-396.246) (-397.539) -- 0:00:50
      191500 -- (-396.630) (-395.811) (-396.679) [-397.762] * (-395.408) (-394.400) (-398.006) [-394.345] -- 0:00:50
      192000 -- [-397.411] (-396.967) (-398.430) (-399.195) * (-397.078) [-394.982] (-398.753) (-394.407) -- 0:00:50
      192500 -- (-397.101) (-395.820) [-395.407] (-396.039) * (-397.711) (-395.609) (-397.235) [-395.434] -- 0:00:50
      193000 -- (-396.231) (-396.618) [-395.175] (-398.977) * (-399.522) (-396.056) [-396.640] (-396.144) -- 0:00:50
      193500 -- (-395.179) [-396.706] (-395.559) (-395.292) * (-397.885) (-397.844) [-394.544] (-396.286) -- 0:00:50
      194000 -- [-394.919] (-399.057) (-398.983) (-398.073) * (-394.367) (-397.013) (-396.836) [-394.583] -- 0:00:49
      194500 -- [-397.207] (-396.544) (-396.397) (-396.014) * (-394.702) (-394.416) (-396.269) [-397.440] -- 0:00:49
      195000 -- (-396.744) [-396.660] (-395.573) (-395.244) * (-397.587) (-395.618) (-397.682) [-397.745] -- 0:00:49

      Average standard deviation of split frequencies: 0.015950

      195500 -- (-395.409) [-397.637] (-397.263) (-398.163) * (-397.874) [-396.300] (-402.433) (-396.827) -- 0:00:49
      196000 -- (-401.985) [-395.336] (-403.374) (-395.916) * (-397.139) [-398.315] (-399.981) (-398.282) -- 0:00:49
      196500 -- (-396.348) (-395.562) [-395.372] (-395.322) * (-396.643) (-398.397) [-395.068] (-396.210) -- 0:00:49
      197000 -- (-395.424) (-394.450) [-398.863] (-395.695) * (-398.599) (-394.810) [-394.753] (-397.346) -- 0:00:48
      197500 -- [-395.561] (-396.284) (-397.736) (-394.930) * [-395.665] (-394.012) (-395.787) (-398.384) -- 0:00:48
      198000 -- (-398.820) [-396.032] (-394.818) (-401.060) * (-398.826) (-399.178) (-396.364) [-396.653] -- 0:00:48
      198500 -- (-397.755) (-396.870) [-396.534] (-397.620) * (-395.125) (-396.474) (-394.835) [-394.489] -- 0:00:48
      199000 -- (-396.860) [-394.733] (-397.977) (-399.736) * (-396.205) [-396.007] (-395.960) (-395.295) -- 0:00:48
      199500 -- [-395.701] (-394.914) (-398.118) (-397.923) * (-395.143) (-396.581) [-400.066] (-396.973) -- 0:00:48
      200000 -- (-395.822) [-397.104] (-397.349) (-395.251) * (-395.732) (-399.194) [-398.489] (-397.875) -- 0:00:48

      Average standard deviation of split frequencies: 0.016939

      200500 -- (-396.817) (-397.642) [-395.228] (-394.941) * (-396.696) (-401.226) (-397.707) [-394.857] -- 0:00:51
      201000 -- (-397.296) [-397.547] (-395.243) (-395.892) * (-394.675) (-397.392) [-396.737] (-396.176) -- 0:00:51
      201500 -- (-398.011) (-394.479) (-397.192) [-394.963] * (-395.841) (-395.771) [-395.855] (-394.763) -- 0:00:51
      202000 -- [-397.356] (-394.114) (-397.181) (-396.506) * (-398.049) (-398.049) [-397.025] (-399.402) -- 0:00:51
      202500 -- [-398.499] (-398.040) (-394.157) (-395.948) * (-398.495) [-396.433] (-394.255) (-396.148) -- 0:00:51
      203000 -- [-398.008] (-396.193) (-397.173) (-397.223) * (-397.453) (-397.520) (-398.533) [-395.865] -- 0:00:51
      203500 -- [-394.685] (-395.447) (-395.068) (-401.311) * (-395.260) (-397.513) [-397.398] (-398.986) -- 0:00:50
      204000 -- (-395.761) (-395.739) [-394.416] (-394.770) * [-397.344] (-396.151) (-394.298) (-394.202) -- 0:00:50
      204500 -- (-398.487) (-396.342) (-396.194) [-394.090] * [-395.500] (-397.779) (-396.756) (-397.259) -- 0:00:50
      205000 -- (-395.137) (-400.337) [-398.206] (-395.968) * (-396.091) (-398.635) (-396.919) [-398.093] -- 0:00:50

      Average standard deviation of split frequencies: 0.015447

      205500 -- (-395.641) [-398.267] (-396.901) (-397.620) * (-398.491) (-399.253) [-394.355] (-394.882) -- 0:00:50
      206000 -- (-396.584) (-397.813) (-396.431) [-399.829] * (-398.730) (-397.996) (-397.433) [-399.491] -- 0:00:50
      206500 -- (-395.275) (-394.685) (-396.994) [-395.441] * (-395.725) (-395.145) (-398.890) [-394.751] -- 0:00:49
      207000 -- (-395.170) (-394.423) [-396.342] (-395.634) * (-395.875) [-396.166] (-398.121) (-394.918) -- 0:00:49
      207500 -- [-394.488] (-400.175) (-394.804) (-396.348) * (-396.261) (-399.911) (-394.980) [-395.236] -- 0:00:49
      208000 -- (-398.027) (-394.984) (-398.293) [-398.261] * (-395.233) (-395.786) (-394.339) [-399.261] -- 0:00:49
      208500 -- (-395.856) [-397.291] (-397.146) (-396.574) * (-398.029) [-397.194] (-397.682) (-399.522) -- 0:00:49
      209000 -- (-396.044) (-399.789) [-398.104] (-402.919) * (-394.631) (-396.782) (-394.993) [-395.135] -- 0:00:49
      209500 -- (-396.308) (-396.243) (-396.536) [-396.063] * (-395.271) (-396.105) (-396.993) [-396.371] -- 0:00:49
      210000 -- (-394.215) (-397.852) (-394.184) [-401.096] * (-397.814) [-396.873] (-397.786) (-394.369) -- 0:00:48

      Average standard deviation of split frequencies: 0.016253

      210500 -- (-399.541) (-396.405) [-398.431] (-397.898) * (-397.267) (-396.370) (-396.576) [-396.367] -- 0:00:48
      211000 -- (-397.813) (-396.877) [-394.990] (-396.893) * [-396.950] (-394.628) (-396.575) (-395.614) -- 0:00:48
      211500 -- (-403.650) (-395.140) (-396.761) [-400.478] * (-395.649) [-394.345] (-399.664) (-396.914) -- 0:00:48
      212000 -- (-396.066) [-395.237] (-396.121) (-397.935) * (-395.632) (-394.892) (-397.122) [-397.149] -- 0:00:48
      212500 -- [-394.677] (-403.379) (-394.236) (-397.572) * (-402.151) (-398.238) (-396.808) [-396.212] -- 0:00:48
      213000 -- (-395.500) [-397.049] (-400.290) (-396.142) * (-399.781) (-400.039) (-399.757) [-394.775] -- 0:00:48
      213500 -- (-395.438) [-398.567] (-397.736) (-394.285) * (-403.199) [-394.587] (-396.597) (-396.285) -- 0:00:47
      214000 -- (-398.173) (-401.251) [-396.591] (-395.393) * (-397.666) (-395.842) (-398.455) [-395.695] -- 0:00:47
      214500 -- (-398.719) (-395.365) (-400.010) [-395.353] * (-397.508) [-401.023] (-394.888) (-396.890) -- 0:00:47
      215000 -- (-397.955) (-394.904) (-395.866) [-396.236] * (-395.449) (-398.959) [-395.637] (-396.812) -- 0:00:47

      Average standard deviation of split frequencies: 0.015059

      215500 -- [-396.890] (-394.696) (-397.161) (-396.015) * (-397.069) (-399.997) [-397.144] (-396.628) -- 0:00:47
      216000 -- (-398.000) [-394.860] (-396.286) (-395.417) * (-398.361) (-397.972) [-396.741] (-398.020) -- 0:00:47
      216500 -- (-395.727) (-395.871) (-395.352) [-397.155] * (-394.880) (-395.379) [-395.819] (-400.681) -- 0:00:47
      217000 -- (-400.664) (-396.725) (-402.757) [-397.292] * [-395.049] (-399.048) (-396.928) (-396.104) -- 0:00:50
      217500 -- (-398.487) (-396.140) [-396.002] (-397.115) * (-395.913) [-395.576] (-396.952) (-394.993) -- 0:00:50
      218000 -- (-395.584) [-394.468] (-398.551) (-396.271) * (-395.121) [-394.134] (-397.565) (-401.179) -- 0:00:50
      218500 -- (-396.198) [-394.264] (-394.929) (-397.154) * (-394.770) [-394.398] (-394.935) (-395.803) -- 0:00:50
      219000 -- (-395.362) (-397.252) (-398.500) [-397.093] * (-396.463) (-398.236) [-396.157] (-394.839) -- 0:00:49
      219500 -- (-394.526) (-395.595) (-396.884) [-396.561] * (-396.597) (-396.918) [-396.748] (-394.126) -- 0:00:49
      220000 -- [-395.966] (-396.455) (-394.728) (-401.671) * (-396.266) (-396.306) (-398.030) [-395.145] -- 0:00:49

      Average standard deviation of split frequencies: 0.015274

      220500 -- (-400.637) (-396.072) [-395.282] (-397.834) * [-398.783] (-396.175) (-397.496) (-395.413) -- 0:00:49
      221000 -- (-397.301) (-395.783) (-396.958) [-394.622] * (-399.586) (-399.444) (-397.113) [-396.636] -- 0:00:49
      221500 -- [-396.411] (-395.303) (-398.061) (-397.831) * (-398.356) (-395.188) [-398.304] (-397.384) -- 0:00:49
      222000 -- (-394.888) (-397.423) (-395.772) [-394.699] * [-394.503] (-395.750) (-395.045) (-401.832) -- 0:00:49
      222500 -- (-395.322) (-395.612) (-404.163) [-395.355] * (-395.965) (-396.748) [-395.541] (-403.831) -- 0:00:48
      223000 -- (-394.718) (-397.894) (-408.603) [-396.501] * (-397.300) (-396.609) [-396.907] (-397.689) -- 0:00:48
      223500 -- (-395.927) (-394.606) (-405.039) [-395.017] * (-395.406) [-398.685] (-395.755) (-398.320) -- 0:00:48
      224000 -- (-399.764) (-394.900) (-394.941) [-395.533] * (-396.048) [-396.648] (-394.154) (-395.132) -- 0:00:48
      224500 -- (-397.710) (-396.073) [-395.434] (-394.572) * [-398.276] (-396.459) (-394.291) (-394.626) -- 0:00:48
      225000 -- (-396.350) (-396.643) (-396.704) [-394.038] * (-399.144) (-395.031) [-394.845] (-396.276) -- 0:00:48

      Average standard deviation of split frequencies: 0.014810

      225500 -- [-398.025] (-398.384) (-395.424) (-395.037) * [-396.718] (-395.360) (-396.673) (-397.515) -- 0:00:48
      226000 -- (-395.915) [-395.067] (-395.378) (-395.216) * (-395.499) [-395.680] (-397.150) (-395.970) -- 0:00:47
      226500 -- (-397.468) (-398.099) (-396.802) [-394.802] * (-394.848) (-394.760) (-396.313) [-394.637] -- 0:00:47
      227000 -- (-396.224) (-397.622) [-397.690] (-394.642) * (-394.567) [-395.703] (-397.057) (-398.802) -- 0:00:47
      227500 -- (-395.184) (-400.007) (-395.557) [-394.620] * [-398.363] (-400.529) (-394.819) (-397.732) -- 0:00:47
      228000 -- (-396.560) [-400.893] (-394.593) (-396.893) * (-396.669) (-394.464) [-398.141] (-395.377) -- 0:00:47
      228500 -- (-396.516) (-397.609) (-398.998) [-394.314] * (-397.508) (-394.679) (-395.844) [-395.956] -- 0:00:47
      229000 -- [-398.002] (-394.435) (-396.334) (-394.631) * [-394.758] (-396.771) (-396.517) (-396.075) -- 0:00:47
      229500 -- [-394.600] (-395.509) (-396.518) (-395.585) * [-394.467] (-402.114) (-396.723) (-396.102) -- 0:00:47
      230000 -- [-397.426] (-396.035) (-395.870) (-395.922) * (-394.463) (-399.095) [-398.474] (-396.603) -- 0:00:46

      Average standard deviation of split frequencies: 0.014079

      230500 -- (-395.179) (-395.973) [-396.159] (-397.281) * (-399.253) [-395.456] (-396.828) (-396.072) -- 0:00:46
      231000 -- [-397.019] (-394.437) (-396.647) (-396.018) * (-396.616) (-396.053) (-400.155) [-400.928] -- 0:00:46
      231500 -- (-394.907) [-395.404] (-396.226) (-395.335) * (-396.305) (-394.157) [-400.436] (-395.583) -- 0:00:46
      232000 -- (-397.796) (-402.653) (-397.767) [-394.868] * [-397.752] (-394.361) (-395.449) (-397.781) -- 0:00:46
      232500 -- [-395.579] (-396.976) (-397.611) (-397.075) * [-396.083] (-394.228) (-397.177) (-397.452) -- 0:00:46
      233000 -- (-395.443) (-394.788) (-395.340) [-394.712] * (-395.625) (-397.999) (-396.688) [-397.376] -- 0:00:46
      233500 -- (-395.549) [-395.680] (-396.696) (-399.400) * (-395.041) (-399.229) [-398.339] (-395.946) -- 0:00:49
      234000 -- (-394.916) [-396.014] (-401.708) (-397.230) * (-394.713) (-398.125) [-400.404] (-395.327) -- 0:00:49
      234500 -- [-397.255] (-398.680) (-394.692) (-396.170) * (-396.271) [-396.549] (-397.546) (-395.894) -- 0:00:48
      235000 -- (-396.084) [-395.657] (-396.684) (-398.470) * (-397.293) (-397.993) (-394.305) [-394.929] -- 0:00:48

      Average standard deviation of split frequencies: 0.013871

      235500 -- (-397.043) (-397.093) (-398.024) [-394.750] * (-400.644) (-402.338) (-395.822) [-396.243] -- 0:00:48
      236000 -- (-402.803) (-396.546) [-395.718] (-398.579) * (-397.241) [-396.514] (-397.512) (-396.050) -- 0:00:48
      236500 -- (-401.328) (-397.919) [-395.086] (-398.839) * (-395.752) (-398.333) [-395.734] (-402.094) -- 0:00:48
      237000 -- (-397.863) (-397.141) [-394.790] (-395.645) * (-396.723) (-397.460) (-399.081) [-401.023] -- 0:00:48
      237500 -- (-396.982) (-397.751) [-396.682] (-396.495) * (-395.557) (-397.794) (-394.478) [-397.421] -- 0:00:48
      238000 -- (-396.448) (-396.255) [-398.834] (-394.724) * (-397.189) [-395.946] (-394.953) (-395.692) -- 0:00:48
      238500 -- (-395.225) (-397.062) [-397.050] (-397.570) * (-398.370) (-400.240) (-395.638) [-395.430] -- 0:00:47
      239000 -- (-396.366) [-400.884] (-396.910) (-399.808) * [-397.049] (-399.116) (-395.732) (-395.559) -- 0:00:47
      239500 -- [-397.227] (-396.518) (-397.675) (-395.509) * [-395.575] (-397.210) (-395.567) (-395.887) -- 0:00:47
      240000 -- (-400.611) [-396.659] (-398.254) (-396.323) * [-397.290] (-396.888) (-394.282) (-395.931) -- 0:00:47

      Average standard deviation of split frequencies: 0.014473

      240500 -- [-395.214] (-396.205) (-397.116) (-395.621) * (-395.903) (-399.776) [-396.774] (-395.417) -- 0:00:47
      241000 -- (-397.056) [-400.303] (-395.108) (-396.952) * (-397.691) (-396.264) [-397.941] (-396.314) -- 0:00:47
      241500 -- (-395.421) (-394.760) [-396.628] (-395.145) * (-395.119) (-395.507) [-395.931] (-398.073) -- 0:00:47
      242000 -- (-395.778) (-395.483) [-398.971] (-397.256) * (-398.214) (-399.889) [-395.148] (-396.102) -- 0:00:46
      242500 -- [-395.750] (-402.609) (-397.471) (-401.988) * (-396.630) (-398.865) [-395.527] (-397.665) -- 0:00:46
      243000 -- (-395.741) (-401.054) (-396.549) [-394.987] * [-396.996] (-397.753) (-396.798) (-395.374) -- 0:00:46
      243500 -- (-396.299) (-400.096) (-396.536) [-401.494] * (-394.153) (-397.078) (-399.122) [-394.815] -- 0:00:46
      244000 -- (-394.792) (-395.754) (-397.712) [-399.593] * [-396.426] (-396.162) (-397.081) (-395.596) -- 0:00:46
      244500 -- (-394.513) (-397.650) [-395.819] (-397.195) * (-396.487) [-396.597] (-395.045) (-401.074) -- 0:00:46
      245000 -- (-398.021) (-397.239) [-395.749] (-395.484) * [-396.542] (-408.110) (-398.849) (-395.943) -- 0:00:46

      Average standard deviation of split frequencies: 0.013414

      245500 -- (-399.424) (-394.451) [-399.562] (-394.910) * (-397.107) (-399.057) (-398.152) [-395.554] -- 0:00:46
      246000 -- (-400.206) [-399.387] (-396.840) (-395.325) * (-397.073) (-396.397) (-399.626) [-395.981] -- 0:00:45
      246500 -- [-397.304] (-399.332) (-399.161) (-396.228) * [-395.210] (-397.946) (-396.658) (-396.266) -- 0:00:45
      247000 -- [-397.046] (-395.993) (-398.044) (-396.838) * (-396.526) (-399.267) (-397.361) [-398.751] -- 0:00:45
      247500 -- [-398.497] (-395.719) (-397.597) (-395.761) * (-397.029) (-397.811) (-394.601) [-395.927] -- 0:00:45
      248000 -- (-395.407) (-396.985) (-396.938) [-396.238] * (-397.306) [-395.686] (-395.974) (-397.026) -- 0:00:45
      248500 -- [-397.228] (-397.115) (-396.032) (-396.554) * [-397.197] (-396.047) (-396.249) (-396.182) -- 0:00:45
      249000 -- [-395.473] (-402.877) (-395.779) (-396.286) * (-395.643) (-395.944) [-397.772] (-395.959) -- 0:00:45
      249500 -- [-395.708] (-396.081) (-395.203) (-396.106) * (-401.402) (-395.353) (-397.798) [-398.709] -- 0:00:45
      250000 -- (-396.025) [-401.733] (-396.800) (-396.766) * (-397.071) (-395.126) (-401.482) [-400.356] -- 0:00:48

      Average standard deviation of split frequencies: 0.012328

      250500 -- (-397.173) (-394.908) [-394.605] (-397.825) * (-396.750) (-395.799) [-396.703] (-395.491) -- 0:00:47
      251000 -- (-393.993) [-398.688] (-398.852) (-398.538) * (-396.520) [-395.645] (-396.662) (-394.394) -- 0:00:47
      251500 -- [-394.681] (-397.081) (-397.473) (-396.193) * (-396.641) (-395.716) (-394.983) [-396.276] -- 0:00:47
      252000 -- (-398.871) (-398.070) (-398.072) [-395.170] * (-396.751) [-397.873] (-396.868) (-396.241) -- 0:00:47
      252500 -- (-394.756) (-397.101) (-396.409) [-395.704] * (-404.119) (-396.174) [-400.436] (-400.714) -- 0:00:47
      253000 -- (-396.459) (-395.962) (-394.876) [-399.935] * [-395.942] (-395.940) (-398.464) (-395.362) -- 0:00:47
      253500 -- (-397.576) (-401.001) [-395.742] (-396.488) * [-394.358] (-395.014) (-397.335) (-398.338) -- 0:00:47
      254000 -- (-395.041) (-399.118) [-397.260] (-396.066) * (-396.629) [-395.013] (-395.845) (-398.324) -- 0:00:46
      254500 -- (-394.588) (-397.122) (-395.383) [-396.622] * (-395.221) [-398.439] (-398.384) (-401.469) -- 0:00:46
      255000 -- [-398.517] (-410.369) (-397.134) (-397.016) * [-396.685] (-397.383) (-394.671) (-397.507) -- 0:00:46

      Average standard deviation of split frequencies: 0.012174

      255500 -- [-396.655] (-404.959) (-396.443) (-397.538) * (-395.263) (-395.392) (-397.122) [-397.311] -- 0:00:46
      256000 -- (-397.180) (-397.320) (-397.072) [-395.381] * (-397.272) (-395.969) [-395.052] (-403.400) -- 0:00:46
      256500 -- [-401.126] (-396.294) (-400.368) (-397.069) * (-395.648) [-394.778] (-398.141) (-403.740) -- 0:00:46
      257000 -- (-401.801) (-397.894) [-400.549] (-399.656) * (-397.037) (-397.071) (-395.927) [-397.167] -- 0:00:46
      257500 -- (-399.679) (-395.701) [-394.915] (-395.079) * (-397.737) (-399.248) [-394.748] (-398.577) -- 0:00:46
      258000 -- (-397.198) (-395.640) [-395.826] (-397.688) * (-394.764) [-397.221] (-395.980) (-395.602) -- 0:00:46
      258500 -- [-395.651] (-400.171) (-396.110) (-396.956) * (-395.940) (-396.733) [-396.132] (-396.384) -- 0:00:45
      259000 -- (-395.513) (-397.872) [-396.214] (-396.742) * (-396.479) (-395.774) (-397.766) [-395.080] -- 0:00:45
      259500 -- (-396.576) (-398.668) (-396.096) [-396.549] * (-396.850) (-396.882) (-397.414) [-395.053] -- 0:00:45
      260000 -- [-395.484] (-399.412) (-397.689) (-397.640) * [-400.064] (-396.928) (-399.856) (-396.347) -- 0:00:45

      Average standard deviation of split frequencies: 0.011655

      260500 -- (-396.794) (-395.919) (-398.598) [-401.378] * (-394.761) (-394.565) [-397.595] (-397.914) -- 0:00:45
      261000 -- (-397.269) [-394.798] (-394.940) (-398.363) * (-394.977) (-394.745) (-398.992) [-394.942] -- 0:00:45
      261500 -- (-397.923) [-394.191] (-397.266) (-394.815) * (-397.596) (-399.566) (-397.540) [-395.202] -- 0:00:45
      262000 -- (-396.643) (-395.934) [-394.495] (-395.978) * [-394.833] (-397.116) (-397.789) (-398.015) -- 0:00:45
      262500 -- (-396.826) (-395.473) [-394.054] (-395.422) * (-396.187) [-400.978] (-397.599) (-395.874) -- 0:00:44
      263000 -- (-395.379) [-399.479] (-397.085) (-397.774) * [-395.490] (-395.783) (-395.482) (-396.331) -- 0:00:44
      263500 -- (-397.003) (-398.211) (-398.601) [-397.951] * (-395.466) [-395.303] (-395.560) (-399.714) -- 0:00:44
      264000 -- (-400.591) (-398.677) (-396.352) [-394.951] * (-396.839) [-395.428] (-396.251) (-398.291) -- 0:00:44
      264500 -- (-402.996) (-395.873) (-398.644) [-395.788] * (-396.099) [-396.060] (-395.470) (-395.165) -- 0:00:44
      265000 -- (-397.172) (-398.955) [-395.378] (-396.736) * (-396.547) [-396.099] (-395.756) (-398.014) -- 0:00:44

      Average standard deviation of split frequencies: 0.012701

      265500 -- (-397.689) (-399.137) [-399.576] (-394.959) * [-394.901] (-394.620) (-396.839) (-395.051) -- 0:00:44
      266000 -- (-400.701) (-398.308) (-397.927) [-396.262] * (-397.480) [-396.032] (-396.284) (-396.147) -- 0:00:44
      266500 -- (-401.651) [-396.326] (-397.547) (-395.411) * (-396.933) (-402.525) [-395.840] (-396.417) -- 0:00:46
      267000 -- (-396.204) [-395.682] (-397.187) (-396.281) * [-394.970] (-397.421) (-396.524) (-398.911) -- 0:00:46
      267500 -- (-395.054) [-394.770] (-398.149) (-396.251) * [-395.774] (-396.807) (-395.086) (-395.991) -- 0:00:46
      268000 -- (-395.087) (-395.567) [-394.087] (-404.133) * (-397.955) (-400.861) (-395.354) [-395.447] -- 0:00:46
      268500 -- [-395.805] (-401.372) (-394.100) (-401.362) * (-394.940) [-394.217] (-397.574) (-396.712) -- 0:00:46
      269000 -- [-396.584] (-396.688) (-394.920) (-398.452) * (-399.281) (-394.504) [-397.418] (-394.716) -- 0:00:46
      269500 -- (-399.109) [-398.636] (-398.071) (-395.013) * (-397.197) (-395.146) (-394.584) [-395.206] -- 0:00:46
      270000 -- (-396.915) (-396.268) (-396.798) [-396.726] * (-396.945) (-397.066) [-397.468] (-401.261) -- 0:00:45

      Average standard deviation of split frequencies: 0.011708

      270500 -- (-397.205) (-396.575) (-396.433) [-395.567] * [-397.725] (-397.469) (-395.482) (-397.678) -- 0:00:45
      271000 -- (-400.239) [-394.187] (-394.878) (-397.611) * [-396.651] (-397.472) (-395.413) (-396.329) -- 0:00:45
      271500 -- [-400.781] (-395.435) (-395.672) (-396.163) * [-395.327] (-395.397) (-394.850) (-397.716) -- 0:00:45
      272000 -- (-396.232) [-396.130] (-400.426) (-396.247) * (-398.606) (-396.925) [-395.624] (-395.903) -- 0:00:45
      272500 -- (-395.169) (-396.552) [-398.551] (-397.657) * (-396.695) (-397.369) [-396.065] (-396.970) -- 0:00:45
      273000 -- (-397.290) (-398.886) (-398.605) [-397.575] * (-395.630) (-394.984) (-397.133) [-395.598] -- 0:00:45
      273500 -- (-395.983) (-395.778) (-394.462) [-399.054] * (-397.695) (-399.235) [-395.139] (-396.220) -- 0:00:45
      274000 -- (-395.358) [-395.986] (-394.463) (-398.681) * [-395.501] (-395.449) (-394.797) (-397.491) -- 0:00:45
      274500 -- (-395.390) [-394.977] (-394.772) (-402.512) * (-396.666) (-394.035) [-394.809] (-397.576) -- 0:00:44
      275000 -- [-395.681] (-398.963) (-394.509) (-397.943) * [-395.456] (-395.525) (-399.077) (-394.965) -- 0:00:44

      Average standard deviation of split frequencies: 0.010722

      275500 -- (-396.874) (-397.489) (-395.735) [-396.930] * [-395.212] (-397.436) (-398.404) (-400.246) -- 0:00:44
      276000 -- [-395.748] (-394.639) (-399.197) (-398.683) * (-394.065) [-396.389] (-394.954) (-399.429) -- 0:00:44
      276500 -- (-396.498) [-399.556] (-397.581) (-395.327) * (-395.145) [-394.688] (-397.014) (-395.988) -- 0:00:44
      277000 -- [-395.414] (-396.607) (-395.972) (-397.814) * (-398.470) [-395.143] (-395.454) (-396.718) -- 0:00:44
      277500 -- [-394.344] (-395.467) (-398.578) (-402.346) * [-397.808] (-396.068) (-394.917) (-403.494) -- 0:00:44
      278000 -- (-395.701) (-398.686) [-396.136] (-397.414) * (-396.104) (-397.069) [-396.492] (-397.372) -- 0:00:44
      278500 -- [-396.261] (-399.797) (-396.901) (-395.274) * (-394.752) (-395.033) (-397.800) [-395.708] -- 0:00:44
      279000 -- [-396.880] (-395.766) (-394.887) (-396.202) * (-394.424) (-396.281) [-398.188] (-395.663) -- 0:00:43
      279500 -- (-396.416) (-396.561) (-394.897) [-395.308] * (-397.912) (-395.583) (-396.749) [-397.576] -- 0:00:43
      280000 -- (-397.995) (-396.806) (-398.189) [-397.760] * (-395.401) [-396.461] (-398.323) (-398.716) -- 0:00:43

      Average standard deviation of split frequencies: 0.010264

      280500 -- (-396.451) (-395.183) [-398.734] (-396.634) * (-397.723) (-397.880) [-397.031] (-397.138) -- 0:00:43
      281000 -- (-399.338) (-395.289) (-396.541) [-395.719] * [-394.777] (-399.193) (-395.354) (-395.788) -- 0:00:43
      281500 -- (-396.613) [-395.335] (-398.119) (-399.365) * (-395.439) (-398.926) [-394.409] (-395.324) -- 0:00:43
      282000 -- (-395.462) [-395.997] (-395.488) (-396.151) * (-396.693) (-396.501) [-396.220] (-399.346) -- 0:00:43
      282500 -- (-394.933) [-394.232] (-395.147) (-396.315) * (-396.659) [-399.446] (-396.572) (-399.266) -- 0:00:43
      283000 -- (-395.819) [-398.156] (-395.614) (-395.023) * (-398.736) (-395.955) (-395.895) [-398.940] -- 0:00:45
      283500 -- (-394.695) (-394.693) [-395.003] (-396.701) * (-395.366) (-399.059) (-396.043) [-394.695] -- 0:00:45
      284000 -- (-395.234) (-399.125) [-396.403] (-397.085) * (-396.057) (-394.632) [-394.304] (-395.753) -- 0:00:45
      284500 -- (-396.886) (-399.859) [-396.440] (-396.151) * (-397.005) (-395.033) [-397.414] (-396.815) -- 0:00:45
      285000 -- (-395.520) [-397.522] (-396.480) (-396.470) * [-395.498] (-396.267) (-395.036) (-399.881) -- 0:00:45

      Average standard deviation of split frequencies: 0.008608

      285500 -- (-395.371) (-394.276) (-397.191) [-395.687] * [-395.036] (-395.041) (-394.819) (-396.167) -- 0:00:45
      286000 -- (-395.467) (-394.929) (-395.176) [-394.954] * (-396.283) [-396.828] (-398.523) (-394.938) -- 0:00:44
      286500 -- (-397.633) [-394.284] (-396.083) (-396.836) * (-396.450) (-395.716) [-395.312] (-394.631) -- 0:00:44
      287000 -- (-395.636) [-396.669] (-398.411) (-395.371) * (-394.358) (-397.095) (-395.049) [-395.145] -- 0:00:44
      287500 -- (-396.752) (-396.704) (-394.706) [-395.138] * (-400.518) (-396.993) [-399.033] (-398.447) -- 0:00:44
      288000 -- (-399.011) [-394.971] (-404.184) (-403.271) * [-395.449] (-394.870) (-399.030) (-399.358) -- 0:00:44
      288500 -- (-398.129) [-395.998] (-397.426) (-395.434) * (-398.214) (-394.471) [-396.370] (-399.644) -- 0:00:44
      289000 -- (-397.942) [-396.386] (-398.994) (-394.797) * (-394.729) (-395.949) (-397.502) [-395.615] -- 0:00:44
      289500 -- (-394.226) (-395.898) (-396.243) [-395.346] * (-394.448) [-395.210] (-397.374) (-398.834) -- 0:00:44
      290000 -- (-397.275) (-396.651) [-395.175] (-396.664) * [-396.987] (-399.052) (-397.099) (-396.873) -- 0:00:44

      Average standard deviation of split frequencies: 0.007749

      290500 -- (-397.218) [-394.513] (-397.382) (-396.357) * (-395.581) (-397.363) [-394.487] (-399.997) -- 0:00:43
      291000 -- (-398.704) (-394.871) (-397.297) [-397.235] * [-397.576] (-394.072) (-397.383) (-397.234) -- 0:00:43
      291500 -- (-395.836) (-396.159) (-399.181) [-395.517] * [-395.636] (-395.477) (-394.810) (-397.023) -- 0:00:43
      292000 -- (-397.989) (-396.285) (-394.541) [-394.879] * (-396.797) [-395.413] (-397.615) (-396.125) -- 0:00:43
      292500 -- [-395.175] (-395.596) (-395.048) (-401.045) * (-395.542) [-394.663] (-398.184) (-396.113) -- 0:00:43
      293000 -- (-395.298) [-394.349] (-396.063) (-399.615) * [-398.059] (-395.138) (-397.095) (-396.523) -- 0:00:43
      293500 -- (-394.981) (-397.792) (-397.444) [-394.175] * [-399.322] (-396.008) (-394.667) (-396.080) -- 0:00:43
      294000 -- [-395.895] (-397.508) (-394.637) (-398.102) * (-397.961) (-395.991) [-395.070] (-396.212) -- 0:00:43
      294500 -- [-396.871] (-399.938) (-394.517) (-396.115) * (-400.808) [-396.153] (-395.838) (-396.047) -- 0:00:43
      295000 -- (-396.420) (-396.224) [-394.274] (-396.387) * (-396.417) (-396.735) (-398.306) [-396.909] -- 0:00:43

      Average standard deviation of split frequencies: 0.007697

      295500 -- (-399.657) [-394.221] (-395.185) (-399.200) * (-395.760) (-397.942) (-396.012) [-394.359] -- 0:00:42
      296000 -- (-400.486) [-394.859] (-398.196) (-396.994) * (-397.073) [-395.484] (-395.427) (-395.351) -- 0:00:42
      296500 -- [-395.391] (-395.316) (-395.585) (-395.595) * (-396.158) (-395.516) [-399.145] (-397.084) -- 0:00:42
      297000 -- (-395.361) [-397.023] (-396.214) (-394.411) * (-396.209) (-396.714) (-396.955) [-395.334] -- 0:00:42
      297500 -- [-396.458] (-403.645) (-396.535) (-394.459) * (-396.659) [-396.362] (-394.952) (-402.007) -- 0:00:42
      298000 -- (-395.890) (-396.431) (-397.156) [-394.034] * (-395.660) (-395.976) [-395.250] (-395.418) -- 0:00:42
      298500 -- (-398.582) [-396.667] (-397.243) (-394.408) * (-394.813) (-395.508) (-396.185) [-396.972] -- 0:00:42
      299000 -- (-398.024) [-394.817] (-395.516) (-396.471) * [-396.099] (-394.808) (-394.697) (-397.564) -- 0:00:42
      299500 -- (-397.734) [-398.505] (-395.645) (-394.693) * [-395.181] (-395.028) (-397.767) (-398.710) -- 0:00:44
      300000 -- (-396.627) (-402.524) [-397.328] (-396.786) * (-394.005) (-395.924) (-395.636) [-395.315] -- 0:00:44

      Average standard deviation of split frequencies: 0.007747

      300500 -- (-394.994) [-399.075] (-397.698) (-397.733) * (-396.981) (-395.296) [-395.975] (-396.786) -- 0:00:44
      301000 -- [-396.835] (-394.433) (-394.476) (-395.858) * (-397.903) [-395.626] (-394.388) (-398.081) -- 0:00:44
      301500 -- (-396.507) [-398.825] (-402.222) (-394.860) * (-398.877) (-398.572) [-397.403] (-394.728) -- 0:00:44
      302000 -- (-403.671) [-396.139] (-396.422) (-394.252) * (-395.123) (-395.809) [-397.056] (-399.470) -- 0:00:43
      302500 -- (-395.844) (-396.275) [-395.249] (-395.924) * (-398.207) (-394.950) (-395.574) [-394.670] -- 0:00:43
      303000 -- (-396.187) (-395.698) (-395.693) [-397.964] * (-398.328) [-395.330] (-397.017) (-399.691) -- 0:00:43
      303500 -- [-394.376] (-396.762) (-394.903) (-399.108) * [-394.767] (-395.701) (-396.840) (-396.281) -- 0:00:43
      304000 -- (-394.685) [-394.922] (-394.412) (-396.217) * (-395.267) [-395.030] (-395.265) (-399.944) -- 0:00:43
      304500 -- (-396.564) (-395.783) [-396.620] (-396.364) * (-396.338) (-395.390) (-394.661) [-397.202] -- 0:00:43
      305000 -- (-396.002) [-394.902] (-397.448) (-394.213) * (-395.325) (-394.262) [-395.693] (-401.916) -- 0:00:43

      Average standard deviation of split frequencies: 0.007189

      305500 -- (-397.312) (-402.335) (-397.232) [-397.528] * (-395.069) (-398.411) [-397.916] (-405.676) -- 0:00:43
      306000 -- [-396.255] (-398.357) (-397.194) (-396.798) * [-394.433] (-397.204) (-394.824) (-402.832) -- 0:00:43
      306500 -- (-395.743) (-395.633) (-396.341) [-395.629] * (-394.912) [-395.465] (-394.527) (-399.610) -- 0:00:42
      307000 -- (-396.527) (-394.712) (-396.294) [-395.598] * (-395.692) [-400.347] (-395.092) (-394.267) -- 0:00:42
      307500 -- (-396.895) (-394.907) (-396.484) [-394.520] * (-395.356) (-397.584) [-394.033] (-395.643) -- 0:00:42
      308000 -- (-407.048) (-395.914) (-398.381) [-396.048] * (-395.978) (-398.373) [-396.440] (-396.336) -- 0:00:42
      308500 -- [-397.434] (-398.075) (-394.624) (-397.210) * (-394.945) (-396.187) (-395.345) [-395.328] -- 0:00:42
      309000 -- [-398.337] (-399.175) (-396.877) (-397.049) * (-394.549) [-395.883] (-394.934) (-395.021) -- 0:00:42
      309500 -- (-396.700) (-398.740) (-399.681) [-399.021] * [-394.744] (-395.452) (-396.046) (-398.568) -- 0:00:42
      310000 -- (-397.312) [-397.440] (-395.672) (-394.434) * (-395.686) (-394.193) [-398.944] (-396.365) -- 0:00:42

      Average standard deviation of split frequencies: 0.007165

      310500 -- [-395.308] (-394.991) (-396.072) (-395.935) * [-395.041] (-396.963) (-396.504) (-397.444) -- 0:00:42
      311000 -- [-393.985] (-397.823) (-395.384) (-394.678) * [-396.554] (-394.317) (-403.762) (-397.962) -- 0:00:42
      311500 -- (-398.778) [-394.949] (-395.425) (-394.882) * (-396.073) [-395.344] (-398.246) (-395.419) -- 0:00:41
      312000 -- (-398.290) (-395.676) (-397.175) [-398.000] * (-397.281) (-397.502) [-396.550] (-395.501) -- 0:00:41
      312500 -- (-399.157) [-394.512] (-401.065) (-395.954) * [-396.045] (-398.980) (-397.020) (-395.549) -- 0:00:41
      313000 -- (-395.061) [-394.742] (-395.637) (-394.868) * (-398.131) (-396.051) [-395.688] (-395.808) -- 0:00:41
      313500 -- (-396.040) [-395.461] (-396.935) (-397.375) * (-396.283) (-397.549) (-395.634) [-394.910] -- 0:00:41
      314000 -- [-395.324] (-397.605) (-395.914) (-396.341) * [-394.800] (-397.902) (-396.115) (-397.013) -- 0:00:41
      314500 -- [-394.258] (-397.050) (-394.947) (-395.983) * (-400.570) [-399.212] (-396.758) (-396.109) -- 0:00:41
      315000 -- (-399.475) [-398.299] (-401.088) (-394.630) * (-396.672) [-397.454] (-401.810) (-395.340) -- 0:00:41

      Average standard deviation of split frequencies: 0.007045

      315500 -- (-402.887) (-395.614) [-394.336] (-396.410) * [-395.742] (-395.352) (-398.479) (-395.183) -- 0:00:41
      316000 -- [-397.871] (-395.825) (-396.379) (-395.279) * [-394.510] (-395.137) (-398.225) (-395.506) -- 0:00:43
      316500 -- (-394.991) [-395.866] (-398.168) (-396.350) * [-394.790] (-395.648) (-395.907) (-394.724) -- 0:00:43
      317000 -- [-394.516] (-399.344) (-396.842) (-400.157) * (-395.694) (-395.086) [-396.625] (-396.335) -- 0:00:43
      317500 -- (-395.406) [-395.389] (-398.313) (-399.619) * (-399.193) [-395.594] (-394.779) (-396.074) -- 0:00:42
      318000 -- [-395.976] (-395.789) (-396.836) (-397.393) * (-395.269) (-397.288) (-399.225) [-399.131] -- 0:00:42
      318500 -- (-396.509) (-396.770) [-398.418] (-398.219) * (-396.697) (-395.960) [-396.046] (-398.719) -- 0:00:42
      319000 -- (-402.165) [-395.151] (-396.026) (-396.743) * (-395.443) (-395.800) [-395.147] (-396.813) -- 0:00:42
      319500 -- (-395.560) (-395.722) [-395.613] (-396.619) * (-395.921) (-395.062) (-394.916) [-397.208] -- 0:00:42
      320000 -- (-396.579) [-396.329] (-395.158) (-395.700) * (-395.443) (-396.170) [-396.276] (-394.678) -- 0:00:42

      Average standard deviation of split frequencies: 0.008129

      320500 -- [-399.069] (-395.813) (-396.793) (-394.977) * (-395.513) (-394.573) [-396.025] (-398.612) -- 0:00:42
      321000 -- [-403.510] (-396.380) (-398.462) (-394.846) * [-398.069] (-396.129) (-395.206) (-397.010) -- 0:00:42
      321500 -- (-401.747) (-397.484) (-398.006) [-395.908] * (-396.186) (-395.192) (-394.621) [-396.552] -- 0:00:42
      322000 -- (-398.293) (-397.548) [-403.699] (-394.322) * (-395.301) [-395.643] (-394.966) (-397.545) -- 0:00:42
      322500 -- [-395.680] (-394.114) (-397.421) (-395.774) * (-396.080) (-397.966) (-393.926) [-396.418] -- 0:00:42
      323000 -- [-396.772] (-396.055) (-396.172) (-399.515) * (-400.642) (-396.260) (-394.341) [-395.229] -- 0:00:41
      323500 -- (-396.208) (-398.383) (-395.347) [-394.642] * (-394.872) (-397.385) [-401.881] (-397.542) -- 0:00:41
      324000 -- [-397.251] (-396.384) (-400.157) (-398.657) * (-396.035) [-396.247] (-397.744) (-395.357) -- 0:00:41
      324500 -- [-398.340] (-400.507) (-399.402) (-396.944) * (-397.821) (-397.148) (-394.917) [-394.603] -- 0:00:41
      325000 -- (-395.603) (-394.504) [-401.259] (-401.195) * (-399.240) [-397.159] (-396.796) (-394.600) -- 0:00:41

      Average standard deviation of split frequencies: 0.008421

      325500 -- (-398.062) (-396.358) [-395.562] (-394.921) * (-394.932) [-401.006] (-398.961) (-394.783) -- 0:00:41
      326000 -- (-397.036) (-395.226) [-396.670] (-396.755) * [-397.641] (-398.053) (-398.283) (-395.335) -- 0:00:41
      326500 -- (-400.885) [-396.240] (-394.925) (-396.696) * (-399.323) (-398.610) (-399.913) [-396.961] -- 0:00:41
      327000 -- (-397.601) [-395.170] (-397.055) (-394.885) * (-395.854) (-397.290) (-395.173) [-397.540] -- 0:00:41
      327500 -- (-396.110) [-396.401] (-394.384) (-397.387) * (-395.962) (-400.276) (-403.392) [-397.713] -- 0:00:41
      328000 -- [-396.724] (-396.131) (-395.828) (-394.904) * (-394.298) (-395.541) (-401.103) [-395.665] -- 0:00:40
      328500 -- [-394.808] (-396.078) (-395.432) (-395.979) * (-397.145) [-394.221] (-396.089) (-399.832) -- 0:00:40
      329000 -- (-396.385) (-395.594) (-397.124) [-397.955] * [-399.248] (-395.271) (-395.499) (-395.366) -- 0:00:40
      329500 -- (-399.429) (-399.424) [-397.508] (-395.095) * [-398.574] (-399.287) (-394.685) (-394.404) -- 0:00:40
      330000 -- (-399.568) (-396.039) (-396.121) [-395.293] * (-398.694) (-398.943) (-395.616) [-396.458] -- 0:00:40

      Average standard deviation of split frequencies: 0.008134

      330500 -- (-397.086) [-396.272] (-402.138) (-399.037) * [-395.508] (-398.513) (-397.299) (-395.864) -- 0:00:40
      331000 -- (-397.023) [-395.746] (-395.940) (-395.285) * (-397.583) (-396.777) [-395.306] (-394.908) -- 0:00:40
      331500 -- (-396.754) (-395.538) (-396.056) [-396.768] * (-395.242) (-395.456) [-396.812] (-395.948) -- 0:00:40
      332000 -- (-396.174) (-395.281) (-394.621) [-394.898] * (-395.305) [-396.592] (-397.393) (-398.088) -- 0:00:40
      332500 -- (-395.040) [-395.305] (-396.212) (-397.507) * [-397.697] (-397.334) (-397.916) (-398.282) -- 0:00:42
      333000 -- (-395.250) (-395.796) [-397.982] (-398.000) * (-395.621) [-395.322] (-397.255) (-396.260) -- 0:00:42
      333500 -- (-400.668) [-395.233] (-396.907) (-394.242) * (-395.637) (-396.000) (-395.608) [-394.631] -- 0:00:41
      334000 -- [-397.463] (-397.825) (-397.853) (-394.604) * [-395.640] (-395.692) (-396.426) (-398.699) -- 0:00:41
      334500 -- (-397.980) (-395.275) [-396.445] (-394.243) * (-394.640) (-397.886) [-399.163] (-396.523) -- 0:00:41
      335000 -- (-398.059) [-397.453] (-395.076) (-395.279) * (-395.107) [-398.461] (-395.040) (-400.056) -- 0:00:41

      Average standard deviation of split frequencies: 0.008748

      335500 -- (-395.128) (-399.133) (-398.399) [-394.611] * (-397.394) (-395.335) [-394.788] (-397.521) -- 0:00:41
      336000 -- [-394.723] (-397.326) (-394.682) (-394.942) * (-396.182) (-395.471) [-394.443] (-394.852) -- 0:00:41
      336500 -- (-394.973) (-396.636) (-396.672) [-394.711] * (-395.236) [-397.471] (-395.994) (-394.447) -- 0:00:41
      337000 -- (-396.585) (-402.693) [-394.819] (-394.699) * (-394.357) (-396.541) [-395.239] (-395.396) -- 0:00:41
      337500 -- (-396.332) [-395.554] (-395.364) (-396.487) * (-394.310) (-396.722) [-395.541] (-395.306) -- 0:00:41
      338000 -- (-397.134) [-397.252] (-398.138) (-395.148) * (-395.790) (-396.934) (-395.778) [-401.493] -- 0:00:41
      338500 -- (-397.936) [-396.014] (-394.831) (-397.170) * [-394.432] (-396.911) (-395.359) (-397.894) -- 0:00:41
      339000 -- (-396.424) (-397.874) (-398.183) [-397.399] * (-394.441) [-396.565] (-397.000) (-395.837) -- 0:00:40
      339500 -- (-398.761) [-395.922] (-398.999) (-397.756) * (-396.677) (-395.058) [-397.972] (-400.843) -- 0:00:40
      340000 -- (-400.046) [-395.424] (-398.672) (-396.848) * (-396.736) (-398.693) [-398.513] (-395.201) -- 0:00:40

      Average standard deviation of split frequencies: 0.008465

      340500 -- (-396.794) [-397.525] (-397.497) (-396.378) * (-401.884) [-398.052] (-396.730) (-397.096) -- 0:00:40
      341000 -- [-394.649] (-398.892) (-397.728) (-398.086) * (-394.934) (-397.208) [-395.616] (-397.566) -- 0:00:40
      341500 -- (-395.801) [-400.393] (-395.539) (-398.013) * (-394.892) (-394.908) [-395.430] (-398.676) -- 0:00:40
      342000 -- (-395.461) (-398.753) (-394.870) [-397.081] * (-395.990) (-396.755) (-396.158) [-395.487] -- 0:00:40
      342500 -- [-397.229] (-397.561) (-394.115) (-395.817) * (-396.436) (-398.065) [-397.007] (-394.331) -- 0:00:40
      343000 -- (-394.467) (-401.585) (-394.494) [-396.619] * (-395.252) (-397.023) [-394.547] (-394.300) -- 0:00:40
      343500 -- [-394.958] (-397.124) (-394.450) (-395.635) * (-396.646) (-396.111) [-394.846] (-396.860) -- 0:00:40
      344000 -- (-396.461) (-394.274) (-395.195) [-395.763] * (-395.455) [-395.754] (-393.953) (-398.362) -- 0:00:40
      344500 -- (-395.276) (-395.433) [-397.460] (-396.572) * (-397.166) [-396.815] (-395.876) (-396.654) -- 0:00:39
      345000 -- (-396.939) [-398.458] (-401.067) (-396.568) * [-398.532] (-399.513) (-395.238) (-396.702) -- 0:00:39

      Average standard deviation of split frequencies: 0.007645

      345500 -- [-399.516] (-396.188) (-397.368) (-398.808) * (-395.798) (-398.614) (-396.796) [-396.825] -- 0:00:39
      346000 -- (-399.009) (-396.879) [-398.484] (-397.341) * [-396.023] (-399.362) (-395.467) (-394.633) -- 0:00:39
      346500 -- (-396.262) [-397.857] (-395.508) (-396.467) * (-396.596) (-396.854) [-397.779] (-401.783) -- 0:00:39
      347000 -- [-396.138] (-395.452) (-396.833) (-398.132) * (-396.086) (-395.792) [-397.268] (-397.856) -- 0:00:39
      347500 -- [-395.055] (-395.201) (-398.201) (-396.630) * [-397.607] (-395.753) (-396.605) (-397.392) -- 0:00:39
      348000 -- [-398.431] (-396.107) (-394.296) (-397.310) * (-397.027) (-395.490) [-401.874] (-398.685) -- 0:00:39
      348500 -- (-396.602) (-398.261) [-396.568] (-395.833) * [-395.682] (-395.378) (-396.842) (-404.226) -- 0:00:39
      349000 -- (-398.160) (-394.737) [-396.947] (-396.184) * (-395.776) [-395.705] (-396.373) (-396.327) -- 0:00:41
      349500 -- (-395.711) (-396.295) [-395.525] (-396.621) * [-396.977] (-402.840) (-396.473) (-400.352) -- 0:00:40
      350000 -- (-395.245) (-397.958) (-395.625) [-396.187] * (-394.651) [-398.535] (-396.978) (-406.069) -- 0:00:40

      Average standard deviation of split frequencies: 0.007394

      350500 -- (-394.931) (-396.001) [-396.457] (-397.596) * [-395.786] (-395.360) (-396.155) (-397.643) -- 0:00:40
      351000 -- [-396.589] (-395.131) (-395.454) (-394.785) * (-396.770) (-398.269) (-395.295) [-400.402] -- 0:00:40
      351500 -- (-400.405) (-394.358) [-396.268] (-395.784) * (-394.547) [-398.753] (-395.866) (-397.048) -- 0:00:40
      352000 -- (-397.131) [-394.381] (-396.953) (-394.285) * [-395.869] (-396.922) (-395.283) (-395.009) -- 0:00:40
      352500 -- (-401.450) (-395.417) (-394.370) [-395.553] * (-397.407) (-395.975) [-394.454] (-395.789) -- 0:00:40
      353000 -- (-395.556) [-396.641] (-402.631) (-395.779) * (-396.907) (-396.122) (-398.106) [-395.047] -- 0:00:40
      353500 -- (-397.909) (-395.715) (-398.237) [-396.761] * [-396.199] (-394.734) (-396.299) (-395.494) -- 0:00:40
      354000 -- [-398.576] (-396.092) (-394.744) (-401.563) * (-395.791) (-395.949) (-394.196) [-395.215] -- 0:00:40
      354500 -- (-396.654) (-398.417) [-395.540] (-398.752) * [-396.839] (-394.726) (-395.401) (-397.189) -- 0:00:40
      355000 -- [-395.975] (-395.859) (-394.644) (-396.467) * (-398.979) (-394.056) [-394.860] (-396.788) -- 0:00:39

      Average standard deviation of split frequencies: 0.007209

      355500 -- [-396.233] (-398.228) (-395.215) (-394.689) * [-397.935] (-395.550) (-398.877) (-396.476) -- 0:00:39
      356000 -- (-395.555) [-398.162] (-397.872) (-397.200) * [-398.111] (-396.729) (-395.979) (-394.946) -- 0:00:39
      356500 -- (-397.004) (-395.376) [-397.736] (-397.729) * [-395.430] (-395.814) (-395.779) (-398.913) -- 0:00:39
      357000 -- (-396.522) (-395.589) (-395.425) [-394.723] * (-394.984) (-397.044) (-400.710) [-396.279] -- 0:00:39
      357500 -- (-399.423) [-396.053] (-396.683) (-397.063) * (-398.875) (-394.442) [-398.856] (-396.777) -- 0:00:39
      358000 -- (-394.976) (-395.983) (-397.402) [-398.752] * [-398.458] (-394.776) (-398.323) (-394.973) -- 0:00:39
      358500 -- [-396.176] (-399.515) (-398.966) (-397.873) * (-397.469) (-396.931) (-398.400) [-394.523] -- 0:00:39
      359000 -- (-397.322) (-397.465) (-396.073) [-397.964] * (-396.885) (-397.162) (-401.275) [-396.942] -- 0:00:39
      359500 -- (-396.162) (-396.712) (-399.471) [-397.593] * (-396.197) [-397.752] (-400.256) (-396.850) -- 0:00:39
      360000 -- (-395.096) [-397.140] (-397.093) (-401.311) * (-395.663) (-395.616) [-396.866] (-396.234) -- 0:00:39

      Average standard deviation of split frequencies: 0.007552

      360500 -- [-395.598] (-394.864) (-395.602) (-395.810) * (-395.267) (-401.827) (-397.150) [-396.678] -- 0:00:39
      361000 -- (-394.956) [-395.006] (-397.209) (-396.302) * (-397.280) (-399.780) [-395.821] (-399.546) -- 0:00:38
      361500 -- (-396.553) (-395.660) (-395.870) [-395.521] * (-396.341) (-397.190) (-395.562) [-398.076] -- 0:00:38
      362000 -- [-399.796] (-397.878) (-394.636) (-396.559) * (-394.591) (-395.651) (-397.511) [-397.361] -- 0:00:38
      362500 -- (-396.013) (-396.293) [-396.812] (-396.617) * [-398.147] (-395.686) (-398.134) (-399.706) -- 0:00:38
      363000 -- [-395.240] (-398.235) (-397.976) (-397.702) * [-397.154] (-398.923) (-396.790) (-398.496) -- 0:00:38
      363500 -- [-395.333] (-395.885) (-395.089) (-398.752) * [-396.128] (-394.515) (-394.273) (-407.060) -- 0:00:38
      364000 -- (-397.631) (-398.244) (-400.325) [-397.594] * (-400.766) [-395.408] (-395.132) (-397.215) -- 0:00:38
      364500 -- (-395.075) (-399.276) (-395.138) [-396.549] * (-395.442) (-396.378) (-395.974) [-397.071] -- 0:00:38
      365000 -- [-395.134] (-397.901) (-395.724) (-394.566) * (-395.669) [-396.635] (-394.059) (-397.808) -- 0:00:38

      Average standard deviation of split frequencies: 0.007513

      365500 -- (-395.911) (-394.933) (-394.819) [-394.940] * (-394.455) (-394.540) (-401.099) [-395.895] -- 0:00:38
      366000 -- [-395.491] (-395.606) (-395.112) (-396.081) * (-395.632) (-396.150) (-403.396) [-397.948] -- 0:00:39
      366500 -- [-397.066] (-395.666) (-394.147) (-395.600) * (-396.199) [-396.582] (-398.790) (-400.602) -- 0:00:39
      367000 -- (-396.804) (-394.739) (-398.030) [-396.453] * (-399.683) (-394.430) [-396.214] (-396.726) -- 0:00:39
      367500 -- (-396.589) [-399.319] (-394.785) (-396.341) * (-400.351) [-396.016] (-398.455) (-396.629) -- 0:00:39
      368000 -- (-394.556) (-399.889) [-394.043] (-396.481) * (-399.604) (-397.294) [-396.080] (-395.937) -- 0:00:39
      368500 -- [-394.329] (-397.882) (-394.257) (-396.473) * [-398.644] (-394.560) (-396.766) (-396.676) -- 0:00:39
      369000 -- (-396.502) [-400.804] (-395.595) (-397.692) * (-398.447) (-395.513) (-397.717) [-397.080] -- 0:00:39
      369500 -- (-396.174) (-396.720) [-394.475] (-396.092) * [-395.270] (-396.440) (-398.564) (-396.244) -- 0:00:39
      370000 -- (-399.207) [-395.754] (-394.519) (-397.534) * [-396.602] (-396.628) (-400.359) (-400.232) -- 0:00:39

      Average standard deviation of split frequencies: 0.008408

      370500 -- (-397.051) [-399.005] (-396.907) (-405.214) * (-395.335) [-396.460] (-399.330) (-400.919) -- 0:00:39
      371000 -- [-395.871] (-399.776) (-396.396) (-404.088) * (-393.908) (-394.818) (-397.716) [-395.707] -- 0:00:38
      371500 -- (-396.301) (-395.105) (-396.209) [-397.318] * (-397.576) (-398.111) (-396.213) [-395.850] -- 0:00:38
      372000 -- (-395.073) (-394.659) [-395.532] (-395.730) * (-396.954) [-397.242] (-395.797) (-395.753) -- 0:00:38
      372500 -- (-394.832) (-394.586) [-397.455] (-401.325) * (-397.048) [-396.627] (-396.895) (-399.186) -- 0:00:38
      373000 -- (-394.701) (-399.366) (-397.170) [-396.173] * [-396.795] (-399.227) (-395.839) (-396.582) -- 0:00:38
      373500 -- (-394.919) (-400.836) (-394.507) [-398.884] * (-396.699) (-397.440) [-394.515] (-397.246) -- 0:00:38
      374000 -- (-397.273) (-399.408) (-399.076) [-397.194] * (-396.354) (-396.581) [-395.062] (-396.563) -- 0:00:38
      374500 -- [-394.297] (-395.869) (-396.128) (-398.974) * (-395.558) (-394.972) (-396.080) [-395.565] -- 0:00:38
      375000 -- (-397.546) (-395.495) [-394.928] (-395.387) * (-397.666) (-396.795) (-397.663) [-394.529] -- 0:00:38

      Average standard deviation of split frequencies: 0.008149

      375500 -- (-394.980) (-401.457) [-395.099] (-395.312) * (-394.264) (-396.744) [-395.783] (-396.882) -- 0:00:38
      376000 -- (-397.513) [-403.532] (-395.055) (-394.815) * (-394.275) (-398.170) (-395.909) [-394.965] -- 0:00:38
      376500 -- (-395.777) [-400.067] (-395.813) (-401.792) * (-394.244) (-397.944) (-397.331) [-396.428] -- 0:00:38
      377000 -- (-396.982) (-397.745) (-397.025) [-398.804] * (-396.931) (-399.855) [-397.658] (-394.609) -- 0:00:38
      377500 -- [-398.709] (-396.114) (-398.865) (-394.763) * (-396.130) (-399.597) (-397.356) [-396.596] -- 0:00:37
      378000 -- (-395.423) [-397.087] (-400.082) (-395.758) * (-397.521) (-398.832) [-396.827] (-395.827) -- 0:00:37
      378500 -- (-395.910) (-400.340) (-398.100) [-397.744] * (-396.001) [-399.650] (-395.138) (-395.740) -- 0:00:37
      379000 -- (-400.724) [-402.063] (-396.866) (-398.864) * (-397.881) (-402.838) (-395.259) [-395.908] -- 0:00:37
      379500 -- (-396.720) [-395.603] (-395.844) (-395.787) * (-399.226) [-397.530] (-396.818) (-395.420) -- 0:00:37
      380000 -- (-398.167) [-397.791] (-395.643) (-394.539) * [-398.756] (-398.165) (-396.500) (-394.243) -- 0:00:37

      Average standard deviation of split frequencies: 0.008204

      380500 -- (-397.284) (-395.452) [-398.478] (-394.515) * (-397.118) (-398.619) (-395.221) [-397.523] -- 0:00:37
      381000 -- (-397.494) (-395.444) [-395.792] (-396.425) * (-396.628) (-396.755) (-396.563) [-395.360] -- 0:00:37
      381500 -- [-395.810] (-398.522) (-395.921) (-400.370) * (-394.516) (-395.995) [-394.846] (-400.073) -- 0:00:37
      382000 -- (-395.759) [-397.913] (-394.333) (-401.066) * (-396.801) [-394.359] (-395.467) (-394.523) -- 0:00:37
      382500 -- (-395.236) (-395.806) [-395.814] (-396.189) * [-396.227] (-395.448) (-395.402) (-401.431) -- 0:00:37
      383000 -- (-399.358) (-396.674) [-396.511] (-395.798) * (-395.618) (-395.580) [-397.256] (-396.198) -- 0:00:38
      383500 -- (-398.445) (-396.279) [-397.955] (-396.358) * [-400.679] (-395.104) (-403.410) (-394.451) -- 0:00:38
      384000 -- [-395.328] (-401.404) (-395.367) (-395.509) * (-399.257) (-399.068) (-397.726) [-394.007] -- 0:00:38
      384500 -- (-396.045) [-398.430] (-398.173) (-398.003) * [-395.234] (-396.890) (-396.284) (-400.789) -- 0:00:38
      385000 -- (-394.811) [-396.039] (-395.901) (-394.967) * (-396.467) (-397.888) (-395.884) [-398.707] -- 0:00:38

      Average standard deviation of split frequencies: 0.008549

      385500 -- (-396.518) (-396.650) (-396.765) [-396.602] * (-398.770) [-395.110] (-396.388) (-395.004) -- 0:00:38
      386000 -- (-397.993) [-394.698] (-396.041) (-395.425) * (-396.072) [-395.715] (-397.802) (-395.403) -- 0:00:38
      386500 -- (-397.815) (-398.901) (-395.733) [-397.025] * (-395.080) (-398.539) [-395.840] (-397.465) -- 0:00:38
      387000 -- (-395.746) [-394.968] (-395.062) (-396.808) * (-396.823) (-398.363) [-395.188] (-396.103) -- 0:00:38
      387500 -- (-399.272) [-397.565] (-394.060) (-399.312) * (-397.452) (-397.426) (-399.468) [-395.203] -- 0:00:37
      388000 -- (-395.250) [-400.618] (-394.726) (-395.032) * (-398.054) (-396.682) [-399.288] (-395.000) -- 0:00:37
      388500 -- [-395.340] (-399.878) (-394.688) (-396.460) * (-395.524) (-398.560) (-397.050) [-395.967] -- 0:00:37
      389000 -- (-395.548) [-397.530] (-395.165) (-394.832) * (-397.769) (-395.767) (-396.742) [-396.846] -- 0:00:37
      389500 -- [-396.287] (-402.446) (-396.102) (-397.212) * (-400.194) [-397.964] (-396.336) (-398.209) -- 0:00:37
      390000 -- (-398.281) (-395.263) (-395.165) [-394.387] * (-397.597) (-396.058) [-397.017] (-395.186) -- 0:00:37

      Average standard deviation of split frequencies: 0.007542

      390500 -- (-395.621) (-396.320) [-396.307] (-398.270) * (-397.562) (-396.427) (-401.858) [-396.427] -- 0:00:37
      391000 -- (-396.817) (-395.184) (-395.708) [-395.434] * (-396.108) (-395.454) [-397.782] (-395.727) -- 0:00:37
      391500 -- (-396.061) (-397.329) [-397.112] (-396.472) * (-396.120) (-401.593) [-396.421] (-396.413) -- 0:00:37
      392000 -- (-399.424) (-398.245) (-397.591) [-396.559] * [-400.802] (-399.865) (-397.554) (-394.796) -- 0:00:37
      392500 -- [-399.217] (-399.638) (-395.864) (-400.958) * (-395.686) (-396.289) [-395.071] (-397.853) -- 0:00:37
      393000 -- (-398.335) (-399.723) [-396.167] (-396.302) * (-395.353) [-396.240] (-394.612) (-396.372) -- 0:00:37
      393500 -- (-397.701) (-394.909) [-395.831] (-396.635) * (-394.914) (-397.026) (-395.182) [-397.093] -- 0:00:36
      394000 -- (-397.321) [-395.772] (-395.669) (-395.781) * (-395.027) (-397.803) [-394.660] (-394.249) -- 0:00:36
      394500 -- [-394.745] (-397.061) (-397.515) (-398.060) * (-398.280) (-396.506) (-394.333) [-395.165] -- 0:00:36
      395000 -- (-401.725) [-397.078] (-399.272) (-399.237) * [-396.536] (-398.430) (-396.122) (-397.605) -- 0:00:36

      Average standard deviation of split frequencies: 0.007843

      395500 -- (-395.317) [-394.999] (-395.587) (-396.931) * (-399.368) (-396.680) (-397.554) [-397.958] -- 0:00:36
      396000 -- (-394.628) (-397.555) [-394.422] (-397.460) * (-395.659) (-396.078) [-396.906] (-396.286) -- 0:00:36
      396500 -- (-398.696) [-395.825] (-395.761) (-395.510) * (-395.612) (-394.710) [-397.245] (-395.556) -- 0:00:36
      397000 -- (-396.552) (-396.257) [-395.824] (-394.367) * [-394.000] (-395.478) (-395.375) (-397.036) -- 0:00:36
      397500 -- (-400.197) [-395.020] (-394.864) (-394.765) * (-396.760) [-397.926] (-396.193) (-397.283) -- 0:00:36
      398000 -- [-397.658] (-395.294) (-395.232) (-395.322) * (-399.114) [-396.851] (-398.565) (-396.615) -- 0:00:36
      398500 -- (-395.898) [-396.443] (-396.924) (-395.260) * [-396.605] (-396.604) (-398.050) (-395.665) -- 0:00:36
      399000 -- [-394.767] (-396.164) (-394.995) (-396.132) * (-397.094) (-402.620) (-395.777) [-396.841] -- 0:00:36
      399500 -- (-396.716) (-397.843) (-395.065) [-400.523] * (-395.302) (-402.382) [-396.587] (-396.040) -- 0:00:36
      400000 -- (-396.128) (-401.803) (-395.077) [-396.289] * (-397.601) (-396.922) (-396.900) [-396.272] -- 0:00:36

      Average standard deviation of split frequencies: 0.007475

      400500 -- (-396.058) (-398.987) (-395.818) [-395.447] * (-395.644) (-397.938) (-399.416) [-397.418] -- 0:00:37
      401000 -- [-400.366] (-395.698) (-395.855) (-395.077) * (-395.771) (-397.611) [-396.806] (-399.700) -- 0:00:37
      401500 -- (-398.310) (-398.735) (-396.976) [-394.994] * [-395.025] (-397.221) (-398.784) (-397.339) -- 0:00:37
      402000 -- (-396.321) (-399.213) (-397.068) [-397.880] * (-396.600) (-402.425) (-395.360) [-396.853] -- 0:00:37
      402500 -- (-398.423) (-395.598) [-399.153] (-395.670) * (-402.900) (-398.477) [-397.037] (-400.662) -- 0:00:37
      403000 -- (-396.641) [-395.913] (-397.387) (-394.857) * [-399.893] (-396.351) (-396.409) (-395.175) -- 0:00:37
      403500 -- (-398.969) [-395.196] (-396.939) (-396.138) * [-398.190] (-395.794) (-399.402) (-396.782) -- 0:00:36
      404000 -- (-394.961) (-396.309) [-396.244] (-394.658) * (-396.679) (-395.810) (-397.079) [-394.433] -- 0:00:36
      404500 -- (-396.024) [-395.861] (-396.099) (-396.860) * [-396.175] (-394.285) (-395.653) (-394.587) -- 0:00:36
      405000 -- (-397.205) (-397.194) (-394.333) [-394.424] * (-395.083) [-397.323] (-396.815) (-396.038) -- 0:00:36

      Average standard deviation of split frequencies: 0.007934

      405500 -- (-399.131) (-398.447) [-398.290] (-396.884) * (-394.864) (-397.051) (-397.004) [-395.942] -- 0:00:36
      406000 -- [-396.672] (-396.775) (-400.227) (-398.426) * (-395.841) (-396.885) [-397.852] (-396.902) -- 0:00:36
      406500 -- [-395.406] (-396.359) (-399.442) (-396.340) * [-395.865] (-394.430) (-397.930) (-396.188) -- 0:00:36
      407000 -- (-394.781) [-396.065] (-394.900) (-394.978) * (-395.484) (-395.763) (-401.023) [-398.143] -- 0:00:36
      407500 -- (-394.829) (-397.260) [-394.614] (-394.868) * [-397.390] (-395.582) (-402.983) (-396.761) -- 0:00:36
      408000 -- (-396.824) (-397.099) (-394.139) [-399.072] * (-395.646) (-396.035) (-396.489) [-398.837] -- 0:00:36
      408500 -- (-399.442) (-398.702) [-394.033] (-401.114) * [-394.701] (-395.624) (-401.646) (-394.877) -- 0:00:36
      409000 -- (-395.292) (-397.354) [-394.614] (-403.237) * (-399.351) (-394.602) [-401.318] (-395.412) -- 0:00:36
      409500 -- [-394.757] (-395.969) (-394.626) (-399.658) * [-396.505] (-394.664) (-396.556) (-401.366) -- 0:00:36
      410000 -- (-398.507) [-394.202] (-394.562) (-396.004) * (-396.735) [-394.734] (-395.754) (-394.681) -- 0:00:35

      Average standard deviation of split frequencies: 0.008103

      410500 -- [-394.907] (-394.574) (-394.581) (-395.039) * (-394.998) (-400.082) [-396.777] (-396.240) -- 0:00:35
      411000 -- (-395.700) (-399.152) (-398.231) [-396.284] * (-395.417) [-397.258] (-394.429) (-397.140) -- 0:00:35
      411500 -- (-395.870) (-400.364) (-395.331) [-395.064] * (-399.197) (-396.635) (-395.243) [-396.955] -- 0:00:35
      412000 -- (-397.442) (-396.584) [-395.757] (-399.183) * [-398.980] (-395.291) (-396.218) (-395.814) -- 0:00:35
      412500 -- (-398.143) [-394.933] (-397.362) (-396.801) * (-397.343) (-395.484) (-396.622) [-395.976] -- 0:00:35
      413000 -- (-395.718) [-395.625] (-398.438) (-396.034) * (-400.555) (-396.443) [-395.634] (-395.524) -- 0:00:35
      413500 -- (-398.226) (-397.070) (-396.950) [-395.812] * (-396.693) (-395.012) [-395.135] (-395.526) -- 0:00:35
      414000 -- (-395.649) (-394.823) [-396.357] (-395.015) * (-395.963) [-395.561] (-401.039) (-396.826) -- 0:00:35
      414500 -- [-395.578] (-394.945) (-396.095) (-394.735) * (-396.775) (-399.164) [-396.560] (-396.239) -- 0:00:35
      415000 -- (-394.865) (-395.742) [-396.255] (-395.939) * (-395.073) (-395.537) [-396.796] (-400.916) -- 0:00:35

      Average standard deviation of split frequencies: 0.007932

      415500 -- (-395.270) (-398.015) (-401.583) [-395.436] * (-398.858) (-394.855) [-397.189] (-402.399) -- 0:00:35
      416000 -- (-398.155) (-396.822) (-394.790) [-395.440] * (-398.100) (-396.835) [-395.515] (-397.033) -- 0:00:35
      416500 -- [-395.965] (-400.925) (-397.792) (-395.878) * (-396.161) (-395.233) [-396.505] (-395.446) -- 0:00:35
      417000 -- (-395.159) (-397.466) (-397.374) [-395.662] * (-395.005) [-399.758] (-401.538) (-395.227) -- 0:00:36
      417500 -- [-397.535] (-401.521) (-398.780) (-397.502) * (-396.390) [-394.975] (-396.748) (-396.590) -- 0:00:36
      418000 -- (-394.600) [-398.539] (-396.486) (-397.634) * [-398.036] (-397.001) (-399.345) (-396.955) -- 0:00:36
      418500 -- (-395.559) [-396.098] (-396.197) (-395.507) * [-396.613] (-401.278) (-397.244) (-396.943) -- 0:00:36
      419000 -- (-396.765) (-396.056) [-397.218] (-396.101) * (-398.820) [-396.982] (-401.602) (-396.445) -- 0:00:36
      419500 -- (-399.997) (-399.996) [-395.518] (-395.058) * (-394.489) [-396.101] (-400.277) (-397.503) -- 0:00:35
      420000 -- (-398.008) [-394.532] (-396.146) (-397.903) * [-398.103] (-395.595) (-398.777) (-395.398) -- 0:00:35

      Average standard deviation of split frequencies: 0.008265

      420500 -- (-397.307) [-395.752] (-396.433) (-396.325) * (-394.928) (-395.022) [-398.831] (-397.844) -- 0:00:35
      421000 -- (-395.351) (-396.755) [-398.835] (-394.888) * (-394.338) (-395.127) [-397.327] (-396.049) -- 0:00:35
      421500 -- [-395.925] (-395.791) (-395.387) (-395.137) * (-396.458) (-399.876) (-396.741) [-394.550] -- 0:00:35
      422000 -- (-395.769) (-395.012) [-400.818] (-393.999) * [-396.687] (-396.917) (-397.869) (-394.872) -- 0:00:35
      422500 -- (-395.366) [-395.606] (-395.478) (-394.575) * [-396.160] (-396.047) (-399.838) (-396.021) -- 0:00:35
      423000 -- (-398.033) (-397.374) (-400.521) [-394.774] * (-396.324) (-395.686) [-395.818] (-399.859) -- 0:00:35
      423500 -- (-396.491) [-396.620] (-400.038) (-397.640) * (-396.245) [-394.977] (-397.383) (-394.850) -- 0:00:35
      424000 -- [-396.885] (-394.440) (-397.004) (-398.123) * (-394.320) (-399.919) (-395.099) [-395.663] -- 0:00:35
      424500 -- (-401.476) (-397.430) (-395.216) [-400.519] * (-395.472) (-398.112) (-398.627) [-396.402] -- 0:00:35
      425000 -- (-395.419) (-401.136) (-396.572) [-395.437] * (-395.865) [-396.934] (-399.781) (-395.239) -- 0:00:35

      Average standard deviation of split frequencies: 0.008657

      425500 -- [-396.263] (-395.833) (-394.392) (-397.440) * (-398.997) (-396.235) (-397.239) [-397.944] -- 0:00:35
      426000 -- (-396.763) (-397.303) [-398.847] (-395.421) * (-397.304) (-397.165) [-396.762] (-396.139) -- 0:00:35
      426500 -- (-395.956) (-394.229) (-395.284) [-395.404] * (-398.767) [-396.524] (-394.204) (-394.557) -- 0:00:34
      427000 -- (-397.053) (-395.201) [-398.794] (-395.442) * [-398.459] (-397.277) (-395.334) (-397.073) -- 0:00:34
      427500 -- (-396.985) (-395.541) [-395.656] (-397.404) * (-395.731) (-396.312) [-394.414] (-396.705) -- 0:00:34
      428000 -- (-395.989) (-398.754) (-398.665) [-395.780] * (-395.084) (-398.625) [-395.716] (-401.058) -- 0:00:34
      428500 -- [-396.050] (-398.963) (-396.153) (-397.688) * (-397.506) (-398.983) [-396.054] (-395.408) -- 0:00:34
      429000 -- (-395.983) (-397.706) [-395.771] (-395.310) * [-400.515] (-395.610) (-394.563) (-396.966) -- 0:00:34
      429500 -- (-398.989) (-395.937) [-395.942] (-395.481) * (-395.924) (-394.389) [-398.830] (-396.234) -- 0:00:34
      430000 -- (-397.131) (-396.772) [-396.295] (-404.738) * (-395.034) [-398.622] (-399.691) (-396.551) -- 0:00:34

      Average standard deviation of split frequencies: 0.008692

      430500 -- (-395.703) [-396.235] (-396.074) (-400.318) * (-394.990) (-397.516) (-398.525) [-399.274] -- 0:00:34
      431000 -- [-395.991] (-395.809) (-395.454) (-394.993) * (-396.807) [-399.368] (-396.263) (-397.683) -- 0:00:34
      431500 -- (-396.691) (-394.794) [-396.924] (-396.520) * (-395.788) (-394.956) (-394.847) [-396.360] -- 0:00:34
      432000 -- (-394.676) (-395.806) [-395.064] (-400.577) * (-399.638) (-395.177) [-398.359] (-400.371) -- 0:00:34
      432500 -- (-395.129) (-395.679) (-395.383) [-397.769] * (-398.766) (-396.980) [-396.770] (-399.850) -- 0:00:34
      433000 -- (-396.585) (-394.920) (-395.090) [-396.003] * [-396.401] (-396.773) (-397.648) (-398.327) -- 0:00:34
      433500 -- (-405.219) (-394.521) [-394.082] (-395.781) * (-397.035) [-395.845] (-397.799) (-396.969) -- 0:00:33
      434000 -- [-398.846] (-394.705) (-399.659) (-394.760) * (-395.246) (-394.125) [-396.546] (-394.846) -- 0:00:35
      434500 -- (-395.998) (-398.045) [-396.003] (-397.131) * [-400.241] (-394.706) (-396.592) (-396.304) -- 0:00:35
      435000 -- (-395.465) (-400.954) [-397.592] (-396.695) * (-396.051) (-407.772) (-397.162) [-395.795] -- 0:00:35

      Average standard deviation of split frequencies: 0.008204

      435500 -- [-394.855] (-395.234) (-397.026) (-398.744) * (-395.924) [-400.087] (-395.371) (-395.106) -- 0:00:34
      436000 -- (-394.423) [-397.713] (-396.115) (-396.560) * (-396.216) (-395.326) (-397.789) [-394.969] -- 0:00:34
      436500 -- (-394.780) [-398.638] (-395.234) (-396.708) * (-396.209) (-395.654) [-397.512] (-394.483) -- 0:00:34
      437000 -- (-395.030) (-398.432) [-398.731] (-395.589) * (-397.272) (-396.865) (-395.146) [-395.609] -- 0:00:34
      437500 -- (-395.084) [-395.706] (-399.387) (-406.705) * (-397.938) (-397.339) (-396.326) [-394.309] -- 0:00:34
      438000 -- (-396.615) [-395.648] (-401.102) (-397.420) * (-394.963) (-395.706) [-394.992] (-395.756) -- 0:00:34
      438500 -- (-397.767) (-395.167) (-395.585) [-396.039] * (-398.226) [-397.575] (-396.694) (-394.705) -- 0:00:34
      439000 -- (-396.198) (-395.603) (-400.005) [-397.984] * [-397.521] (-396.555) (-396.896) (-400.408) -- 0:00:34
      439500 -- (-396.662) (-398.475) [-395.272] (-396.151) * (-395.201) (-396.042) (-396.938) [-396.492] -- 0:00:34
      440000 -- (-394.762) (-397.170) (-395.137) [-394.977] * [-399.895] (-398.825) (-394.692) (-395.748) -- 0:00:34

      Average standard deviation of split frequencies: 0.007889

      440500 -- [-395.171] (-394.730) (-398.036) (-397.769) * (-399.203) (-394.916) (-395.317) [-395.663] -- 0:00:34
      441000 -- (-394.450) [-395.384] (-394.617) (-401.739) * (-396.154) (-396.566) (-394.506) [-394.759] -- 0:00:34
      441500 -- (-397.482) [-396.511] (-394.980) (-395.112) * [-394.912] (-397.362) (-397.920) (-398.165) -- 0:00:34
      442000 -- (-396.288) [-394.196] (-397.311) (-396.780) * (-395.445) (-395.469) [-395.607] (-396.077) -- 0:00:34
      442500 -- (-396.870) [-395.008] (-397.324) (-396.062) * (-395.926) [-398.298] (-394.855) (-397.260) -- 0:00:34
      443000 -- (-395.152) (-396.988) [-396.906] (-396.168) * (-395.464) (-397.932) (-394.790) [-395.609] -- 0:00:33
      443500 -- [-395.190] (-398.866) (-395.258) (-394.099) * (-397.481) (-396.328) [-396.140] (-395.576) -- 0:00:33
      444000 -- [-394.746] (-396.254) (-397.463) (-395.851) * (-396.996) (-396.245) [-398.173] (-396.320) -- 0:00:33
      444500 -- (-397.357) (-397.276) [-394.810] (-395.476) * (-395.831) [-396.163] (-397.405) (-395.573) -- 0:00:33
      445000 -- (-397.135) (-394.485) [-395.078] (-396.787) * (-396.492) [-398.371] (-399.693) (-398.393) -- 0:00:33

      Average standard deviation of split frequencies: 0.008258

      445500 -- (-396.728) (-396.833) (-395.357) [-397.356] * [-395.054] (-396.692) (-398.085) (-394.833) -- 0:00:33
      446000 -- (-395.198) (-397.094) (-396.192) [-395.452] * (-394.730) (-398.292) [-395.388] (-395.590) -- 0:00:33
      446500 -- [-394.664] (-395.989) (-395.268) (-394.204) * [-399.891] (-396.576) (-398.016) (-396.379) -- 0:00:33
      447000 -- (-395.636) (-395.513) [-395.336] (-398.075) * (-397.362) [-397.556] (-394.404) (-396.538) -- 0:00:33
      447500 -- (-394.573) (-396.932) [-396.329] (-395.312) * (-394.296) [-396.754] (-396.939) (-400.208) -- 0:00:33
      448000 -- (-396.217) (-395.575) [-395.098] (-396.270) * (-400.211) (-396.641) (-395.269) [-396.552] -- 0:00:33
      448500 -- (-399.591) [-395.144] (-394.221) (-395.526) * (-399.383) (-397.309) [-396.845] (-394.816) -- 0:00:33
      449000 -- (-395.164) (-399.515) (-396.058) [-398.258] * (-396.308) (-395.225) (-394.331) [-394.725] -- 0:00:33
      449500 -- (-397.190) (-400.150) (-399.902) [-396.433] * (-395.568) [-396.540] (-395.264) (-397.345) -- 0:00:33
      450000 -- [-394.514] (-395.964) (-396.521) (-394.663) * (-395.400) [-395.948] (-395.651) (-395.424) -- 0:00:33

      Average standard deviation of split frequencies: 0.008957

      450500 -- (-394.509) (-394.925) (-396.871) [-395.002] * (-397.967) (-396.810) [-396.928] (-396.962) -- 0:00:34
      451000 -- [-394.538] (-400.862) (-395.202) (-395.352) * (-394.955) (-396.675) [-395.626] (-395.444) -- 0:00:34
      451500 -- (-396.556) [-395.811] (-394.665) (-396.143) * (-396.473) [-394.442] (-394.923) (-395.191) -- 0:00:34
      452000 -- (-394.867) (-396.153) (-396.766) [-396.063] * (-396.389) (-396.992) (-394.203) [-397.632] -- 0:00:33
      452500 -- (-396.651) (-395.619) (-397.290) [-396.224] * [-397.648] (-397.428) (-396.826) (-394.444) -- 0:00:33
      453000 -- (-395.507) (-397.669) [-398.890] (-402.560) * [-398.429] (-394.911) (-395.093) (-394.295) -- 0:00:33
      453500 -- (-394.293) (-396.196) (-396.496) [-400.625] * (-394.873) [-396.451] (-396.820) (-398.615) -- 0:00:33
      454000 -- (-398.230) (-394.350) [-398.016] (-396.225) * [-395.356] (-394.609) (-396.820) (-396.351) -- 0:00:33
      454500 -- [-396.487] (-394.752) (-394.277) (-394.885) * (-396.359) [-395.430] (-399.521) (-398.124) -- 0:00:33
      455000 -- [-396.502] (-395.584) (-395.332) (-394.466) * (-395.996) (-394.501) (-395.797) [-396.990] -- 0:00:33

      Average standard deviation of split frequencies: 0.008529

      455500 -- [-396.573] (-396.436) (-397.600) (-394.045) * (-394.287) (-394.497) [-395.148] (-394.447) -- 0:00:33
      456000 -- (-395.132) (-396.222) [-400.181] (-394.075) * [-394.974] (-394.137) (-396.761) (-396.136) -- 0:00:33
      456500 -- [-400.703] (-396.601) (-400.283) (-394.161) * (-394.450) [-394.640] (-395.953) (-397.533) -- 0:00:33
      457000 -- (-398.462) [-394.489] (-398.635) (-396.178) * (-395.640) (-397.084) [-397.285] (-399.030) -- 0:00:33
      457500 -- (-397.580) (-396.053) [-397.050] (-394.765) * (-396.005) (-398.332) [-398.824] (-397.005) -- 0:00:33
      458000 -- (-395.248) (-403.265) [-395.346] (-394.675) * (-398.886) (-401.304) [-395.366] (-398.288) -- 0:00:33
      458500 -- [-395.737] (-395.977) (-400.508) (-395.876) * (-398.269) [-398.350] (-398.101) (-395.247) -- 0:00:33
      459000 -- (-396.740) (-395.986) (-397.352) [-397.234] * (-395.966) [-395.282] (-396.821) (-397.682) -- 0:00:33
      459500 -- (-394.913) [-401.464] (-395.919) (-395.030) * [-398.598] (-399.407) (-398.312) (-397.833) -- 0:00:32
      460000 -- (-395.105) [-396.196] (-394.697) (-398.692) * [-395.572] (-399.062) (-396.870) (-396.385) -- 0:00:32

      Average standard deviation of split frequencies: 0.008570

      460500 -- (-396.931) [-395.967] (-397.856) (-397.683) * (-395.558) [-398.312] (-394.165) (-396.534) -- 0:00:32
      461000 -- (-397.817) (-399.938) [-395.644] (-396.717) * (-396.953) (-396.579) [-395.563] (-400.200) -- 0:00:32
      461500 -- (-400.105) (-396.778) (-396.361) [-394.491] * (-398.301) [-396.955] (-396.278) (-394.180) -- 0:00:32
      462000 -- [-394.906] (-395.085) (-394.830) (-395.566) * (-396.339) [-399.058] (-393.967) (-395.085) -- 0:00:32
      462500 -- (-402.281) (-399.348) (-396.502) [-394.508] * (-399.356) (-399.423) (-397.505) [-394.789] -- 0:00:32
      463000 -- (-397.391) (-399.624) (-397.190) [-394.754] * (-396.929) (-399.085) (-395.145) [-395.358] -- 0:00:32
      463500 -- (-396.173) (-399.738) (-395.128) [-397.067] * (-398.278) (-394.534) (-398.948) [-396.720] -- 0:00:32
      464000 -- [-396.619] (-397.738) (-396.149) (-397.625) * (-398.079) [-396.116] (-394.964) (-396.235) -- 0:00:32
      464500 -- (-397.420) (-395.838) [-398.089] (-396.255) * [-396.876] (-398.225) (-400.457) (-395.202) -- 0:00:32
      465000 -- (-394.703) (-397.777) [-396.333] (-395.431) * [-396.976] (-398.864) (-401.052) (-395.441) -- 0:00:32

      Average standard deviation of split frequencies: 0.008472

      465500 -- (-395.116) (-396.294) [-399.836] (-403.517) * [-398.189] (-400.573) (-398.595) (-395.159) -- 0:00:32
      466000 -- (-394.713) (-396.118) (-400.989) [-398.336] * [-399.436] (-395.270) (-396.906) (-397.144) -- 0:00:32
      466500 -- (-395.436) (-397.604) [-396.938] (-394.960) * [-396.404] (-395.391) (-396.396) (-397.594) -- 0:00:32
      467000 -- (-396.106) (-397.914) [-395.803] (-394.791) * (-398.351) [-397.202] (-398.312) (-399.172) -- 0:00:33
      467500 -- (-396.021) [-395.242] (-395.982) (-398.366) * [-395.956] (-395.652) (-395.022) (-395.057) -- 0:00:33
      468000 -- (-395.593) [-395.201] (-395.663) (-394.655) * [-394.414] (-395.989) (-397.612) (-396.489) -- 0:00:32
      468500 -- (-397.930) [-394.884] (-397.886) (-398.016) * (-397.251) (-394.820) (-395.362) [-397.241] -- 0:00:32
      469000 -- (-397.624) (-395.056) (-396.333) [-395.706] * (-400.275) (-397.555) [-395.703] (-395.259) -- 0:00:32
      469500 -- (-396.966) (-395.380) [-395.730] (-398.389) * (-395.388) [-396.452] (-395.034) (-394.351) -- 0:00:32
      470000 -- (-397.282) [-395.975] (-395.207) (-395.202) * (-397.463) [-399.644] (-398.138) (-396.090) -- 0:00:32

      Average standard deviation of split frequencies: 0.008889

      470500 -- (-395.940) [-395.131] (-396.274) (-396.536) * [-395.636] (-395.308) (-397.296) (-400.186) -- 0:00:32
      471000 -- (-396.775) [-394.596] (-396.859) (-395.405) * (-395.902) [-395.501] (-396.360) (-398.403) -- 0:00:32
      471500 -- (-401.483) (-397.414) [-396.637] (-394.337) * (-398.377) (-397.964) (-396.817) [-394.228] -- 0:00:32
      472000 -- [-397.619] (-395.925) (-395.565) (-396.698) * [-395.488] (-400.115) (-395.903) (-396.874) -- 0:00:32
      472500 -- (-397.516) (-394.797) (-395.511) [-397.165] * (-396.026) (-398.082) (-395.538) [-394.530] -- 0:00:32
      473000 -- (-396.697) (-397.444) (-398.186) [-396.937] * (-403.963) (-397.563) (-398.700) [-395.183] -- 0:00:32
      473500 -- (-395.558) (-395.279) [-399.152] (-396.300) * (-402.092) (-397.368) [-397.661] (-394.790) -- 0:00:32
      474000 -- (-394.441) (-395.133) [-399.475] (-394.648) * (-398.050) (-401.136) (-397.471) [-395.270] -- 0:00:32
      474500 -- [-394.885] (-394.717) (-398.286) (-395.749) * (-394.591) (-397.574) [-395.790] (-396.188) -- 0:00:32
      475000 -- (-400.762) [-394.474] (-394.754) (-394.823) * [-396.124] (-400.099) (-398.812) (-395.716) -- 0:00:32

      Average standard deviation of split frequencies: 0.008975

      475500 -- (-396.456) [-397.209] (-395.757) (-394.842) * (-396.419) [-396.048] (-398.596) (-397.542) -- 0:00:31
      476000 -- (-395.561) (-395.915) (-400.253) [-397.316] * (-395.221) (-396.113) (-398.842) [-395.456] -- 0:00:31
      476500 -- (-395.036) (-396.109) (-394.851) [-400.501] * (-396.217) (-394.634) (-398.640) [-396.510] -- 0:00:31
      477000 -- (-394.361) (-398.365) (-395.521) [-396.008] * (-399.439) (-397.783) [-395.764] (-395.108) -- 0:00:31
      477500 -- [-396.006] (-394.732) (-402.510) (-395.186) * (-395.012) [-398.056] (-395.308) (-394.535) -- 0:00:31
      478000 -- (-395.290) (-395.617) [-395.243] (-395.180) * (-397.259) [-396.621] (-394.197) (-395.040) -- 0:00:31
      478500 -- (-396.480) (-395.429) [-397.332] (-396.112) * (-395.595) (-395.343) [-398.537] (-395.697) -- 0:00:31
      479000 -- (-395.676) [-397.534] (-394.726) (-395.396) * (-399.043) (-398.402) (-398.566) [-397.547] -- 0:00:31
      479500 -- [-395.053] (-395.981) (-396.224) (-394.816) * (-395.774) (-398.498) [-396.016] (-396.951) -- 0:00:31
      480000 -- (-395.562) (-394.994) [-397.535] (-394.769) * (-395.945) [-395.768] (-398.695) (-397.705) -- 0:00:31

      Average standard deviation of split frequencies: 0.010052

      480500 -- (-395.317) [-396.364] (-397.172) (-396.060) * (-394.971) (-398.247) [-394.678] (-401.483) -- 0:00:31
      481000 -- [-396.004] (-395.842) (-399.436) (-399.439) * (-394.962) (-397.496) [-394.843] (-394.577) -- 0:00:31
      481500 -- (-395.746) [-394.744] (-395.243) (-397.464) * (-400.096) (-396.812) (-394.264) [-396.781] -- 0:00:31
      482000 -- [-396.004] (-396.448) (-394.539) (-397.648) * [-397.543] (-397.483) (-398.605) (-394.877) -- 0:00:31
      482500 -- (-401.806) (-395.866) (-396.174) [-397.920] * (-398.768) [-395.693] (-399.787) (-397.217) -- 0:00:31
      483000 -- [-397.090] (-403.987) (-394.121) (-394.775) * [-394.681] (-396.366) (-400.559) (-395.602) -- 0:00:31
      483500 -- (-395.241) (-400.730) [-399.756] (-397.339) * (-396.742) (-395.862) [-397.996] (-400.401) -- 0:00:32
      484000 -- [-398.437] (-397.493) (-396.295) (-399.263) * (-399.026) (-394.929) [-394.789] (-395.720) -- 0:00:31
      484500 -- [-396.478] (-397.029) (-395.287) (-395.974) * [-396.674] (-394.781) (-400.117) (-398.447) -- 0:00:31
      485000 -- [-398.068] (-397.961) (-397.536) (-399.531) * (-401.050) [-397.962] (-395.971) (-394.596) -- 0:00:31

      Average standard deviation of split frequencies: 0.009578

      485500 -- [-394.736] (-395.019) (-398.743) (-395.988) * (-399.334) (-397.292) (-396.317) [-395.627] -- 0:00:31
      486000 -- (-396.722) (-396.721) [-396.495] (-395.511) * (-399.477) (-397.561) [-395.730] (-397.869) -- 0:00:31
      486500 -- (-394.030) [-395.749] (-398.791) (-398.022) * [-400.462] (-398.803) (-396.059) (-397.178) -- 0:00:31
      487000 -- (-396.571) (-401.073) [-397.902] (-398.410) * (-396.034) (-397.495) [-396.467] (-397.717) -- 0:00:31
      487500 -- [-396.043] (-397.626) (-400.804) (-403.250) * (-398.500) (-395.934) (-395.374) [-397.325] -- 0:00:31
      488000 -- [-396.945] (-396.998) (-396.982) (-395.760) * (-396.526) [-396.366] (-394.977) (-396.360) -- 0:00:31
      488500 -- (-396.367) [-397.539] (-395.054) (-395.678) * (-395.629) (-396.432) (-396.909) [-395.721] -- 0:00:31
      489000 -- [-399.582] (-395.383) (-396.429) (-395.741) * (-394.918) (-395.322) (-397.042) [-396.407] -- 0:00:31
      489500 -- (-401.612) (-395.386) [-396.046] (-395.644) * (-395.515) (-397.229) [-398.693] (-398.699) -- 0:00:31
      490000 -- (-397.464) (-394.982) (-397.241) [-395.584] * (-396.268) (-399.136) (-399.700) [-395.953] -- 0:00:31

      Average standard deviation of split frequencies: 0.009287

      490500 -- [-398.829] (-397.327) (-395.754) (-394.870) * (-396.207) (-401.544) (-397.153) [-394.832] -- 0:00:31
      491000 -- (-400.252) [-399.878] (-395.921) (-400.414) * (-402.753) (-397.642) (-396.386) [-395.422] -- 0:00:31
      491500 -- (-397.327) (-397.847) (-397.662) [-395.061] * (-397.954) (-399.671) [-395.191] (-399.079) -- 0:00:31
      492000 -- (-396.125) (-395.495) [-402.381] (-394.636) * (-399.447) (-396.959) [-394.586] (-397.696) -- 0:00:30
      492500 -- (-395.068) (-396.496) (-396.004) [-395.761] * (-395.373) [-397.961] (-394.967) (-399.212) -- 0:00:30
      493000 -- (-394.716) [-395.944] (-396.984) (-394.701) * (-398.628) (-397.790) [-400.136] (-397.782) -- 0:00:30
      493500 -- (-396.261) [-394.919] (-397.581) (-394.913) * (-397.611) (-399.552) (-398.088) [-395.499] -- 0:00:30
      494000 -- [-397.634] (-400.110) (-396.007) (-395.714) * (-398.459) [-396.740] (-397.934) (-396.115) -- 0:00:30
      494500 -- [-396.495] (-397.794) (-397.586) (-398.680) * (-397.539) [-394.779] (-396.910) (-398.643) -- 0:00:30
      495000 -- (-398.505) (-397.290) [-399.624] (-398.617) * (-395.722) (-395.806) [-398.302] (-395.637) -- 0:00:30

      Average standard deviation of split frequencies: 0.008300

      495500 -- (-398.400) [-395.754] (-397.133) (-397.280) * (-394.837) [-396.164] (-397.708) (-396.700) -- 0:00:30
      496000 -- (-399.018) [-395.312] (-395.970) (-396.176) * (-396.430) [-394.878] (-394.764) (-397.166) -- 0:00:30
      496500 -- (-398.963) (-397.630) [-401.176] (-395.141) * (-397.556) (-400.972) [-399.572] (-396.879) -- 0:00:30
      497000 -- [-394.657] (-398.628) (-397.701) (-397.603) * (-400.537) [-395.821] (-394.793) (-397.306) -- 0:00:30
      497500 -- [-396.374] (-398.705) (-395.485) (-395.763) * (-395.401) (-396.245) (-395.567) [-396.000] -- 0:00:30
      498000 -- [-395.179] (-395.356) (-395.620) (-396.784) * (-397.903) (-398.092) [-399.993] (-395.334) -- 0:00:30
      498500 -- (-396.409) (-396.259) [-395.128] (-395.678) * (-396.712) (-396.976) [-395.217] (-396.367) -- 0:00:30
      499000 -- (-396.363) (-398.681) (-395.407) [-394.064] * [-398.623] (-397.450) (-395.317) (-396.377) -- 0:00:30
      499500 -- (-394.930) (-398.860) (-396.039) [-395.901] * (-399.246) (-401.310) [-394.028] (-395.114) -- 0:00:30
      500000 -- [-396.284] (-395.146) (-394.775) (-395.870) * (-396.750) (-396.130) [-394.169] (-395.397) -- 0:00:30

      Average standard deviation of split frequencies: 0.008160

      500500 -- (-398.856) [-395.651] (-396.479) (-395.017) * (-396.697) (-396.161) [-395.896] (-395.190) -- 0:00:30
      501000 -- [-398.455] (-396.603) (-395.760) (-396.957) * (-394.864) [-395.183] (-397.830) (-395.264) -- 0:00:30
      501500 -- (-394.985) (-396.143) [-396.570] (-395.426) * (-394.625) [-395.496] (-395.002) (-399.256) -- 0:00:30
      502000 -- (-394.904) (-400.017) [-395.473] (-400.334) * (-394.656) (-396.417) (-396.926) [-401.174] -- 0:00:30
      502500 -- (-398.683) (-402.417) (-395.657) [-399.632] * [-394.844] (-394.486) (-398.119) (-397.267) -- 0:00:30
      503000 -- (-401.916) (-401.354) (-395.307) [-394.867] * [-395.065] (-398.903) (-395.349) (-398.681) -- 0:00:30
      503500 -- (-397.985) (-398.834) [-397.566] (-396.579) * (-394.695) (-400.858) [-394.221] (-400.721) -- 0:00:30
      504000 -- (-399.573) (-401.497) [-397.010] (-396.825) * [-396.331] (-396.668) (-394.922) (-397.267) -- 0:00:30
      504500 -- (-398.039) (-398.316) [-395.302] (-399.676) * (-399.250) [-395.524] (-395.472) (-396.504) -- 0:00:30
      505000 -- (-398.114) [-399.407] (-396.464) (-396.758) * (-396.630) (-395.766) (-397.297) [-394.828] -- 0:00:30

      Average standard deviation of split frequencies: 0.008136

      505500 -- [-396.318] (-397.641) (-402.153) (-394.787) * (-395.386) (-397.270) (-397.631) [-395.775] -- 0:00:30
      506000 -- [-396.593] (-396.065) (-399.948) (-394.905) * (-395.931) (-394.791) (-396.450) [-400.052] -- 0:00:30
      506500 -- (-394.420) (-394.647) (-401.577) [-395.629] * (-399.561) [-397.991] (-397.671) (-395.909) -- 0:00:30
      507000 -- (-401.065) (-394.544) (-395.633) [-398.012] * (-397.825) (-396.183) (-396.714) [-396.995] -- 0:00:30
      507500 -- (-395.864) (-397.886) [-395.433] (-398.266) * (-400.379) (-396.081) [-394.985] (-398.751) -- 0:00:30
      508000 -- [-397.067] (-396.156) (-394.950) (-398.322) * (-394.296) [-394.863] (-396.982) (-395.452) -- 0:00:30
      508500 -- [-395.022] (-394.388) (-396.092) (-396.196) * [-395.883] (-397.834) (-395.136) (-396.781) -- 0:00:29
      509000 -- (-395.440) [-396.143] (-398.202) (-398.827) * (-396.737) [-395.917] (-394.948) (-395.149) -- 0:00:29
      509500 -- [-398.801] (-394.499) (-396.098) (-400.359) * [-395.949] (-396.292) (-396.683) (-398.299) -- 0:00:29
      510000 -- (-394.564) (-395.098) [-399.056] (-400.152) * (-399.229) [-396.637] (-397.113) (-399.301) -- 0:00:29

      Average standard deviation of split frequencies: 0.008000

      510500 -- [-395.151] (-395.237) (-394.560) (-402.676) * [-396.804] (-398.450) (-396.303) (-396.325) -- 0:00:29
      511000 -- (-396.579) [-399.751] (-398.325) (-396.860) * (-396.558) (-395.426) [-395.948] (-398.664) -- 0:00:29
      511500 -- (-397.143) (-397.215) (-399.025) [-398.630] * (-396.307) [-395.021] (-395.417) (-397.739) -- 0:00:29
      512000 -- [-396.041] (-397.629) (-395.354) (-395.595) * (-396.882) (-396.464) (-397.438) [-394.008] -- 0:00:29
      512500 -- (-399.095) (-395.956) [-395.171] (-400.016) * [-396.221] (-399.689) (-396.628) (-396.100) -- 0:00:29
      513000 -- (-400.079) [-395.857] (-396.749) (-398.131) * (-399.350) (-395.874) (-396.522) [-400.169] -- 0:00:29
      513500 -- [-399.381] (-398.088) (-396.455) (-397.069) * (-400.984) [-394.814] (-397.564) (-398.317) -- 0:00:29
      514000 -- (-397.532) (-395.728) [-395.575] (-397.537) * (-396.306) (-394.630) [-395.120] (-395.375) -- 0:00:29
      514500 -- (-394.646) (-395.330) [-395.384] (-396.213) * (-398.650) [-394.645] (-398.162) (-394.923) -- 0:00:29
      515000 -- (-395.487) [-396.908] (-397.376) (-394.142) * (-398.950) (-395.884) (-399.540) [-398.188] -- 0:00:29

      Average standard deviation of split frequencies: 0.008283

      515500 -- (-396.682) (-397.449) (-394.706) [-394.506] * (-397.181) (-395.908) (-395.351) [-395.488] -- 0:00:29
      516000 -- (-396.523) (-404.316) (-396.205) [-395.346] * [-395.130] (-396.799) (-398.210) (-394.891) -- 0:00:29
      516500 -- (-397.761) [-396.698] (-398.731) (-397.122) * (-398.970) (-395.607) [-396.940] (-396.780) -- 0:00:29
      517000 -- (-394.413) (-397.233) [-395.126] (-397.973) * (-395.397) (-396.668) (-395.303) [-396.123] -- 0:00:29
      517500 -- (-396.611) (-397.190) (-395.138) [-396.535] * (-396.782) [-396.673] (-400.471) (-396.591) -- 0:00:29
      518000 -- (-398.581) (-395.419) (-396.698) [-396.196] * (-396.608) (-395.880) (-395.652) [-396.272] -- 0:00:29
      518500 -- (-396.097) (-396.337) (-395.902) [-401.536] * (-396.271) (-399.909) [-395.055] (-396.037) -- 0:00:29
      519000 -- (-397.693) (-399.646) [-396.464] (-398.704) * (-395.049) (-397.311) (-396.374) [-394.853] -- 0:00:29
      519500 -- (-399.833) (-395.182) (-396.585) [-397.920] * (-400.720) [-395.014] (-396.891) (-398.347) -- 0:00:29
      520000 -- [-399.195] (-395.658) (-398.718) (-395.707) * (-395.016) [-398.857] (-397.463) (-399.423) -- 0:00:29

      Average standard deviation of split frequencies: 0.008511

      520500 -- [-399.314] (-396.123) (-395.358) (-396.258) * (-397.367) (-396.452) [-396.733] (-397.823) -- 0:00:29
      521000 -- (-396.075) [-396.493] (-396.522) (-398.463) * (-394.362) (-396.350) [-396.020] (-396.190) -- 0:00:29
      521500 -- (-396.599) (-397.738) (-395.457) [-397.772] * (-397.179) (-396.356) [-397.368] (-395.274) -- 0:00:29
      522000 -- [-394.648] (-397.226) (-397.495) (-399.472) * (-395.219) [-396.321] (-396.129) (-396.833) -- 0:00:29
      522500 -- (-396.255) (-396.881) [-397.345] (-396.566) * (-396.376) (-395.132) (-394.618) [-398.504] -- 0:00:29
      523000 -- (-396.847) (-395.407) [-397.636] (-394.722) * (-394.663) (-396.061) (-396.176) [-395.632] -- 0:00:29
      523500 -- (-395.345) (-398.757) (-394.616) [-394.712] * (-395.714) [-394.649] (-397.771) (-397.474) -- 0:00:29
      524000 -- (-396.992) (-399.666) [-397.782] (-396.808) * (-395.413) (-397.071) (-398.057) [-396.202] -- 0:00:29
      524500 -- [-395.960] (-398.873) (-406.587) (-397.298) * (-396.542) [-397.439] (-399.749) (-396.778) -- 0:00:29
      525000 -- (-395.087) (-394.844) [-395.567] (-402.724) * [-396.539] (-394.511) (-396.447) (-399.206) -- 0:00:28

      Average standard deviation of split frequencies: 0.009022

      525500 -- [-394.965] (-394.531) (-395.742) (-394.817) * (-400.005) (-395.755) (-395.580) [-395.913] -- 0:00:28
      526000 -- (-394.572) (-395.254) [-397.607] (-398.837) * (-399.266) (-397.562) [-398.700] (-397.033) -- 0:00:28
      526500 -- (-394.403) (-397.034) [-394.985] (-395.402) * [-397.646] (-395.811) (-397.971) (-396.313) -- 0:00:28
      527000 -- (-395.647) [-399.948] (-400.468) (-396.091) * (-397.966) (-396.045) [-395.623] (-397.166) -- 0:00:28
      527500 -- [-396.499] (-398.636) (-397.328) (-396.989) * (-396.930) [-396.050] (-395.042) (-397.613) -- 0:00:28
      528000 -- [-399.308] (-398.261) (-396.818) (-396.972) * [-396.564] (-394.657) (-394.471) (-396.573) -- 0:00:28
      528500 -- (-397.457) [-394.925] (-398.244) (-397.620) * (-397.875) [-394.994] (-394.739) (-394.598) -- 0:00:28
      529000 -- (-396.945) (-396.991) [-398.377] (-397.121) * (-400.515) [-397.186] (-395.108) (-395.411) -- 0:00:28
      529500 -- (-398.667) [-397.268] (-397.701) (-394.850) * (-395.237) [-396.079] (-394.549) (-395.664) -- 0:00:28
      530000 -- (-399.651) (-396.943) [-395.720] (-394.899) * (-396.190) (-395.096) (-396.027) [-400.794] -- 0:00:28

      Average standard deviation of split frequencies: 0.008706

      530500 -- [-395.424] (-395.718) (-396.153) (-395.323) * (-396.723) [-396.457] (-396.202) (-395.631) -- 0:00:28
      531000 -- (-395.670) [-396.900] (-394.553) (-398.857) * (-395.066) (-394.540) (-395.810) [-396.298] -- 0:00:28
      531500 -- (-399.507) (-395.347) [-395.588] (-396.617) * (-395.119) (-397.314) (-394.864) [-394.943] -- 0:00:28
      532000 -- (-397.443) (-397.156) (-394.262) [-397.561] * (-394.577) (-399.121) (-406.533) [-396.523] -- 0:00:28
      532500 -- (-398.018) [-396.104] (-394.079) (-395.061) * [-397.714] (-396.671) (-395.606) (-395.871) -- 0:00:28
      533000 -- (-399.680) (-394.902) [-395.162] (-395.226) * (-397.849) (-394.464) [-396.850] (-396.266) -- 0:00:28
      533500 -- (-394.568) (-394.804) [-395.816] (-397.015) * (-395.814) [-395.445] (-395.045) (-396.576) -- 0:00:27
      534000 -- (-394.737) (-395.231) [-395.197] (-395.767) * [-394.825] (-400.756) (-397.211) (-396.682) -- 0:00:28
      534500 -- [-395.026] (-395.103) (-396.469) (-396.320) * [-395.226] (-395.517) (-396.972) (-398.304) -- 0:00:28
      535000 -- [-396.817] (-397.635) (-396.895) (-395.885) * [-396.397] (-396.045) (-395.904) (-396.112) -- 0:00:28

      Average standard deviation of split frequencies: 0.008384

      535500 -- [-395.126] (-395.369) (-397.468) (-394.648) * (-395.075) (-398.123) (-395.542) [-395.571] -- 0:00:28
      536000 -- (-395.767) (-395.497) [-394.668] (-399.719) * (-396.148) (-396.853) [-395.413] (-397.391) -- 0:00:28
      536500 -- (-394.982) (-394.451) [-394.909] (-399.501) * (-396.155) (-395.752) [-395.743] (-395.669) -- 0:00:28
      537000 -- (-395.401) [-395.177] (-397.468) (-399.187) * (-396.816) (-398.176) (-401.361) [-396.724] -- 0:00:28
      537500 -- (-396.517) (-397.342) [-399.785] (-396.777) * (-396.562) (-396.857) [-394.922] (-398.379) -- 0:00:28
      538000 -- (-395.541) [-398.336] (-396.025) (-399.092) * (-394.920) (-394.619) [-395.665] (-399.623) -- 0:00:28
      538500 -- [-399.012] (-395.441) (-396.022) (-396.810) * (-394.689) [-395.432] (-395.623) (-399.389) -- 0:00:28
      539000 -- [-397.274] (-397.519) (-398.186) (-395.521) * (-396.317) (-394.802) (-395.111) [-396.532] -- 0:00:28
      539500 -- (-395.593) (-399.339) [-396.358] (-395.585) * (-398.447) (-395.202) [-397.166] (-397.998) -- 0:00:28
      540000 -- (-396.248) (-398.675) (-395.005) [-400.399] * (-395.820) (-396.256) [-397.289] (-398.105) -- 0:00:28

      Average standard deviation of split frequencies: 0.008661

      540500 -- (-394.546) (-399.433) (-396.007) [-400.324] * [-394.683] (-400.107) (-395.899) (-395.348) -- 0:00:28
      541000 -- [-394.717] (-396.737) (-395.397) (-399.013) * (-399.460) (-395.644) (-398.999) [-397.184] -- 0:00:27
      541500 -- (-400.196) [-397.993] (-398.695) (-396.122) * (-402.698) (-396.728) (-396.869) [-397.420] -- 0:00:27
      542000 -- (-402.939) [-397.498] (-404.020) (-396.744) * (-402.222) (-398.563) [-394.437] (-396.353) -- 0:00:27
      542500 -- [-396.703] (-396.733) (-396.906) (-399.208) * (-400.227) (-395.686) (-397.745) [-398.988] -- 0:00:27
      543000 -- [-397.618] (-399.878) (-396.348) (-396.449) * [-399.053] (-396.510) (-397.031) (-397.553) -- 0:00:27
      543500 -- (-395.911) [-396.423] (-396.960) (-395.337) * (-396.526) (-394.485) (-396.984) [-397.136] -- 0:00:27
      544000 -- (-395.124) (-395.820) (-395.264) [-394.663] * (-397.239) (-395.192) [-395.292] (-396.458) -- 0:00:27
      544500 -- [-395.714] (-394.927) (-398.978) (-399.340) * [-394.777] (-394.556) (-397.941) (-397.334) -- 0:00:27
      545000 -- (-398.070) [-398.826] (-395.009) (-395.238) * (-397.075) (-395.596) [-395.329] (-396.788) -- 0:00:27

      Average standard deviation of split frequencies: 0.007828

      545500 -- [-398.759] (-396.845) (-394.733) (-397.108) * [-395.038] (-394.909) (-395.037) (-397.139) -- 0:00:27
      546000 -- (-395.574) [-398.439] (-395.399) (-398.524) * (-395.905) (-396.114) [-395.751] (-397.178) -- 0:00:27
      546500 -- (-396.779) [-396.667] (-402.289) (-396.524) * (-394.641) [-396.527] (-399.228) (-398.366) -- 0:00:27
      547000 -- (-398.184) (-397.332) (-397.006) [-396.409] * (-395.229) (-398.962) [-394.998] (-395.264) -- 0:00:27
      547500 -- (-395.802) (-398.307) [-396.252] (-396.307) * (-394.410) (-394.682) (-395.506) [-394.567] -- 0:00:27
      548000 -- (-399.516) (-396.407) [-394.645] (-397.073) * (-394.953) [-396.174] (-395.675) (-394.653) -- 0:00:27
      548500 -- [-396.892] (-394.913) (-395.381) (-398.142) * (-395.768) (-400.570) [-394.607] (-395.674) -- 0:00:27
      549000 -- (-398.980) [-399.383] (-395.247) (-395.645) * [-395.413] (-397.625) (-394.669) (-396.599) -- 0:00:27
      549500 -- [-394.887] (-398.143) (-398.112) (-394.951) * (-394.894) (-401.182) (-394.475) [-395.028] -- 0:00:27
      550000 -- (-394.416) [-396.307] (-395.436) (-398.130) * (-399.344) (-398.198) [-395.029] (-395.709) -- 0:00:27

      Average standard deviation of split frequencies: 0.007990

      550500 -- (-394.840) [-396.375] (-395.244) (-398.429) * [-400.402] (-394.397) (-397.235) (-396.629) -- 0:00:27
      551000 -- [-396.027] (-397.375) (-397.744) (-397.615) * (-397.673) [-398.943] (-396.071) (-395.679) -- 0:00:27
      551500 -- (-396.501) (-394.720) [-397.871] (-395.817) * (-394.895) [-397.672] (-395.672) (-397.560) -- 0:00:27
      552000 -- [-398.711] (-400.402) (-395.178) (-399.493) * (-397.941) (-398.279) [-397.144] (-394.886) -- 0:00:27
      552500 -- (-396.046) (-396.171) (-397.978) [-396.026] * [-396.963] (-395.157) (-398.401) (-397.739) -- 0:00:27
      553000 -- (-394.624) [-394.842] (-394.962) (-395.894) * [-398.860] (-398.313) (-396.108) (-397.013) -- 0:00:27
      553500 -- (-396.101) (-395.705) [-394.644] (-395.715) * [-396.825] (-398.210) (-397.153) (-394.972) -- 0:00:27
      554000 -- (-394.510) (-395.658) [-397.230] (-396.907) * (-395.879) (-396.187) (-399.697) [-398.511] -- 0:00:27
      554500 -- [-395.038] (-394.816) (-397.503) (-401.052) * [-394.846] (-397.889) (-396.321) (-397.783) -- 0:00:27
      555000 -- (-397.624) (-394.660) (-396.273) [-397.394] * [-395.236] (-399.170) (-398.002) (-398.762) -- 0:00:27

      Average standard deviation of split frequencies: 0.007687

      555500 -- (-397.919) (-395.239) [-394.954] (-394.029) * (-397.092) (-396.873) (-395.302) [-399.112] -- 0:00:27
      556000 -- (-395.833) (-395.713) (-397.443) [-395.766] * (-394.893) [-399.652] (-395.747) (-397.026) -- 0:00:27
      556500 -- (-396.386) (-398.107) (-400.062) [-396.821] * (-395.257) (-400.347) (-396.307) [-395.063] -- 0:00:27
      557000 -- (-397.919) (-396.686) [-397.705] (-397.700) * (-395.751) (-396.367) (-396.108) [-395.062] -- 0:00:27
      557500 -- (-396.744) [-398.300] (-397.843) (-396.507) * (-397.473) (-398.719) (-398.467) [-396.802] -- 0:00:26
      558000 -- (-395.012) (-395.494) [-397.440] (-396.842) * (-398.651) [-394.302] (-398.498) (-398.973) -- 0:00:26
      558500 -- [-394.666] (-399.312) (-402.951) (-397.836) * [-395.415] (-396.973) (-397.229) (-398.799) -- 0:00:26
      559000 -- (-396.229) (-397.231) [-397.760] (-396.431) * [-397.213] (-394.562) (-395.899) (-398.106) -- 0:00:26
      559500 -- (-398.277) [-395.027] (-397.334) (-397.236) * (-397.808) [-394.797] (-395.678) (-395.785) -- 0:00:26
      560000 -- (-395.658) (-395.114) [-397.639] (-397.123) * (-396.114) (-394.509) [-395.896] (-396.366) -- 0:00:26

      Average standard deviation of split frequencies: 0.007287

      560500 -- (-394.784) (-400.483) (-395.431) [-395.421] * (-395.380) (-395.268) (-396.887) [-395.268] -- 0:00:26
      561000 -- (-395.541) [-396.449] (-398.031) (-400.092) * (-394.353) (-396.377) (-395.105) [-395.871] -- 0:00:26
      561500 -- (-398.695) [-396.638] (-396.483) (-396.770) * [-395.769] (-397.692) (-394.756) (-396.139) -- 0:00:26
      562000 -- (-400.070) [-394.851] (-395.097) (-395.833) * [-395.548] (-396.403) (-395.363) (-395.124) -- 0:00:26
      562500 -- (-402.455) (-397.201) [-398.014] (-396.094) * (-396.381) (-396.429) [-397.197] (-399.748) -- 0:00:26
      563000 -- (-398.887) (-395.747) (-399.307) [-395.396] * (-395.231) (-396.945) (-399.023) [-397.710] -- 0:00:26
      563500 -- (-396.729) (-395.041) [-399.560] (-396.638) * (-395.630) [-394.913] (-396.097) (-399.969) -- 0:00:26
      564000 -- [-399.039] (-395.375) (-401.014) (-395.614) * (-396.276) [-395.967] (-396.253) (-394.882) -- 0:00:26
      564500 -- (-397.142) [-397.600] (-395.476) (-395.395) * (-394.617) (-398.145) (-397.077) [-394.990] -- 0:00:26
      565000 -- (-394.110) (-398.045) [-394.940] (-399.911) * (-396.087) (-394.857) [-396.031] (-398.209) -- 0:00:26

      Average standard deviation of split frequencies: 0.007052

      565500 -- (-399.990) (-398.739) [-399.567] (-398.318) * [-395.648] (-395.152) (-394.762) (-396.701) -- 0:00:26
      566000 -- (-396.426) [-395.597] (-398.381) (-394.978) * [-395.121] (-396.830) (-395.486) (-394.819) -- 0:00:26
      566500 -- [-398.483] (-396.287) (-396.366) (-395.178) * (-395.969) (-396.751) [-397.303] (-396.684) -- 0:00:26
      567000 -- (-399.412) (-397.074) [-395.008] (-396.450) * (-396.315) (-396.065) (-398.579) [-398.756] -- 0:00:25
      567500 -- (-396.745) [-396.439] (-396.643) (-399.482) * [-397.198] (-398.422) (-395.963) (-394.892) -- 0:00:26
      568000 -- (-396.631) (-396.507) (-396.294) [-397.253] * (-400.350) (-396.843) (-400.800) [-394.811] -- 0:00:26
      568500 -- (-398.395) (-397.774) (-399.686) [-395.694] * (-400.802) (-396.846) (-395.815) [-394.378] -- 0:00:26
      569000 -- [-396.807] (-399.313) (-401.363) (-395.079) * [-395.550] (-397.096) (-396.136) (-396.524) -- 0:00:26
      569500 -- (-397.827) (-397.045) [-396.124] (-396.929) * [-396.238] (-394.359) (-395.906) (-397.880) -- 0:00:26
      570000 -- [-395.502] (-394.649) (-396.627) (-397.501) * (-396.329) (-395.174) [-396.139] (-397.048) -- 0:00:26

      Average standard deviation of split frequencies: 0.007269

      570500 -- [-396.275] (-395.029) (-395.618) (-395.684) * [-396.670] (-397.794) (-399.829) (-395.551) -- 0:00:26
      571000 -- (-396.338) (-396.885) (-395.352) [-396.327] * (-397.573) (-398.470) [-398.177] (-396.947) -- 0:00:26
      571500 -- [-395.827] (-396.006) (-397.577) (-396.178) * [-396.424] (-397.608) (-398.990) (-397.514) -- 0:00:26
      572000 -- [-396.202] (-395.949) (-400.480) (-395.880) * (-395.463) (-397.877) (-396.140) [-395.359] -- 0:00:26
      572500 -- (-395.111) [-395.187] (-398.553) (-395.355) * [-396.762] (-400.533) (-395.981) (-398.622) -- 0:00:26
      573000 -- (-394.648) [-395.143] (-396.262) (-397.321) * [-398.758] (-397.254) (-394.264) (-398.063) -- 0:00:26
      573500 -- (-394.482) (-394.797) (-397.043) [-397.769] * (-398.065) (-396.653) (-394.362) [-396.956] -- 0:00:26
      574000 -- (-395.346) [-395.231] (-396.889) (-399.287) * (-395.819) (-397.040) [-396.310] (-396.971) -- 0:00:25
      574500 -- (-399.736) (-398.735) [-396.156] (-397.468) * [-397.665] (-396.392) (-394.016) (-394.562) -- 0:00:25
      575000 -- (-394.369) [-395.395] (-394.085) (-398.374) * (-401.918) [-394.017] (-398.228) (-396.225) -- 0:00:25

      Average standard deviation of split frequencies: 0.007202

      575500 -- [-395.829] (-395.320) (-396.679) (-399.311) * (-397.056) (-395.516) [-396.989] (-395.703) -- 0:00:25
      576000 -- (-397.692) (-397.497) [-399.768] (-398.334) * (-397.324) (-402.619) [-394.952] (-394.872) -- 0:00:25
      576500 -- [-396.161] (-399.820) (-395.888) (-398.782) * (-396.660) [-396.153] (-396.671) (-394.922) -- 0:00:25
      577000 -- (-394.828) (-399.211) [-395.149] (-395.719) * (-395.888) [-396.169] (-399.046) (-395.578) -- 0:00:25
      577500 -- (-398.529) [-397.294] (-394.132) (-394.304) * (-397.867) (-395.944) [-396.614] (-397.336) -- 0:00:25
      578000 -- (-397.961) (-394.500) (-395.808) [-394.681] * (-395.386) [-398.825] (-394.912) (-398.450) -- 0:00:25
      578500 -- (-394.777) (-396.637) (-400.484) [-396.298] * (-394.543) (-399.818) [-395.374] (-396.074) -- 0:00:25
      579000 -- (-394.843) (-395.501) [-397.820] (-395.715) * (-397.067) (-399.160) (-396.491) [-396.213] -- 0:00:25
      579500 -- (-395.509) (-397.236) [-395.060] (-394.779) * (-397.208) [-394.149] (-397.907) (-397.281) -- 0:00:25
      580000 -- [-395.653] (-395.630) (-396.740) (-397.087) * (-398.930) [-395.061] (-398.470) (-397.151) -- 0:00:25

      Average standard deviation of split frequencies: 0.007002

      580500 -- (-394.504) (-395.941) (-401.058) [-395.207] * (-395.511) [-395.829] (-397.359) (-395.264) -- 0:00:25
      581000 -- (-394.557) (-394.364) [-396.359] (-397.828) * (-395.150) (-401.322) (-399.053) [-395.327] -- 0:00:25
      581500 -- (-397.596) (-396.571) [-395.072] (-398.192) * [-395.208] (-396.165) (-398.194) (-401.567) -- 0:00:25
      582000 -- (-402.987) [-395.261] (-395.143) (-394.776) * [-397.490] (-395.401) (-395.435) (-397.042) -- 0:00:25
      582500 -- (-394.668) (-397.115) [-397.046] (-394.042) * [-394.555] (-397.116) (-396.758) (-398.997) -- 0:00:25
      583000 -- [-395.584] (-395.285) (-399.214) (-395.800) * (-398.119) (-398.052) (-397.576) [-397.255] -- 0:00:25
      583500 -- [-395.559] (-395.206) (-398.047) (-399.218) * (-398.185) (-395.174) [-394.501] (-399.075) -- 0:00:24
      584000 -- (-394.878) [-394.954] (-395.903) (-397.288) * (-395.275) (-396.524) [-396.635] (-397.375) -- 0:00:24
      584500 -- (-396.961) (-395.756) (-395.923) [-396.124] * [-394.709] (-396.158) (-398.456) (-396.506) -- 0:00:25
      585000 -- (-400.230) (-394.821) (-396.819) [-394.973] * [-396.714] (-398.143) (-396.093) (-400.413) -- 0:00:25

      Average standard deviation of split frequencies: 0.007089

      585500 -- (-397.593) (-395.334) (-395.334) [-395.768] * (-395.902) [-400.689] (-398.176) (-398.726) -- 0:00:25
      586000 -- (-396.661) (-396.971) [-395.853] (-397.299) * [-397.746] (-395.685) (-395.791) (-395.105) -- 0:00:25
      586500 -- [-394.995] (-395.703) (-394.615) (-396.989) * (-394.311) (-397.506) (-397.389) [-396.308] -- 0:00:25
      587000 -- (-396.398) (-396.493) [-397.472] (-394.692) * (-398.512) (-396.535) (-399.348) [-395.110] -- 0:00:25
      587500 -- (-396.149) (-397.371) (-395.519) [-397.357] * (-397.429) (-395.685) [-398.605] (-397.255) -- 0:00:25
      588000 -- [-396.722] (-396.493) (-396.217) (-396.902) * (-395.938) (-395.744) (-398.476) [-395.862] -- 0:00:25
      588500 -- (-396.143) [-395.298] (-395.133) (-394.248) * (-394.842) (-398.179) [-400.672] (-394.713) -- 0:00:25
      589000 -- (-396.723) (-396.150) (-397.676) [-400.496] * [-394.989] (-394.879) (-396.504) (-400.198) -- 0:00:25
      589500 -- [-397.592] (-398.379) (-394.832) (-399.062) * (-397.790) (-394.785) [-395.790] (-394.798) -- 0:00:25
      590000 -- (-397.537) [-396.037] (-395.983) (-400.204) * (-396.235) (-395.532) (-395.271) [-394.271] -- 0:00:25

      Average standard deviation of split frequencies: 0.006884

      590500 -- (-397.470) (-394.639) [-395.825] (-395.588) * [-395.167] (-395.779) (-397.715) (-395.645) -- 0:00:24
      591000 -- (-395.610) (-400.272) [-399.082] (-403.957) * [-395.274] (-396.357) (-396.287) (-394.143) -- 0:00:24
      591500 -- (-399.147) (-400.984) [-397.542] (-395.327) * (-397.386) [-398.741] (-397.101) (-402.311) -- 0:00:24
      592000 -- (-394.857) (-397.514) (-397.594) [-397.588] * [-398.512] (-397.020) (-396.248) (-402.407) -- 0:00:24
      592500 -- (-394.551) (-395.730) [-397.535] (-395.222) * [-397.733] (-394.777) (-394.423) (-396.753) -- 0:00:24
      593000 -- (-397.489) (-395.283) (-394.600) [-396.192] * (-397.524) (-396.333) (-395.281) [-396.738] -- 0:00:24
      593500 -- [-398.843] (-396.907) (-402.434) (-401.785) * (-394.690) (-398.561) [-396.775] (-398.841) -- 0:00:24
      594000 -- (-397.084) (-396.218) (-395.041) [-397.612] * [-395.490] (-396.985) (-395.141) (-397.155) -- 0:00:24
      594500 -- (-395.089) [-394.934] (-398.343) (-397.547) * (-397.519) (-395.154) [-395.458] (-398.144) -- 0:00:24
      595000 -- (-395.668) (-394.576) (-394.718) [-398.410] * (-397.269) (-394.920) (-397.137) [-398.055] -- 0:00:24

      Average standard deviation of split frequencies: 0.006674

      595500 -- (-394.692) (-395.495) [-397.512] (-395.928) * [-395.702] (-396.278) (-397.983) (-396.288) -- 0:00:24
      596000 -- [-394.949] (-395.640) (-397.376) (-395.382) * [-394.483] (-396.566) (-395.115) (-395.794) -- 0:00:24
      596500 -- (-395.786) [-395.938] (-394.992) (-396.374) * (-399.833) [-394.764] (-396.545) (-397.952) -- 0:00:24
      597000 -- (-397.937) [-397.996] (-400.331) (-396.078) * (-396.121) (-394.957) [-394.405] (-394.596) -- 0:00:24
      597500 -- (-401.553) (-396.798) [-395.681] (-395.636) * (-396.311) (-396.006) [-399.107] (-395.466) -- 0:00:24
      598000 -- (-398.251) (-399.472) [-395.854] (-400.629) * (-397.417) (-398.810) (-398.714) [-397.215] -- 0:00:24
      598500 -- (-396.867) [-394.838] (-394.479) (-397.651) * (-398.401) (-395.008) [-400.785] (-397.621) -- 0:00:24
      599000 -- [-398.743] (-399.610) (-396.532) (-395.045) * (-395.554) [-395.019] (-396.515) (-395.126) -- 0:00:24
      599500 -- (-395.339) (-396.695) [-399.345] (-396.957) * (-395.632) (-396.544) (-395.789) [-398.659] -- 0:00:24
      600000 -- [-394.204] (-397.933) (-399.620) (-397.171) * (-396.492) (-396.999) [-395.345] (-396.682) -- 0:00:24

      Average standard deviation of split frequencies: 0.006622

      600500 -- (-396.349) (-397.555) (-395.419) [-394.521] * (-396.177) [-394.071] (-395.356) (-396.184) -- 0:00:23
      601000 -- (-395.933) (-397.213) [-395.369] (-395.800) * (-394.812) [-394.984] (-395.983) (-397.507) -- 0:00:24
      601500 -- (-399.469) (-395.801) [-395.097] (-395.579) * (-396.699) (-394.873) [-397.714] (-397.061) -- 0:00:24
      602000 -- (-395.653) (-398.052) [-395.966] (-397.316) * [-394.361] (-395.941) (-400.232) (-395.381) -- 0:00:24
      602500 -- (-396.804) (-397.428) (-396.990) [-395.371] * (-400.256) [-395.995] (-397.196) (-396.245) -- 0:00:24
      603000 -- (-406.878) (-396.090) [-394.776] (-395.817) * (-394.363) (-394.948) [-398.989] (-395.104) -- 0:00:24
      603500 -- (-398.220) (-399.628) (-396.620) [-396.769] * (-394.694) (-394.934) (-396.218) [-395.183] -- 0:00:24
      604000 -- (-399.506) (-398.040) (-395.175) [-397.561] * (-395.554) [-397.897] (-395.920) (-397.711) -- 0:00:24
      604500 -- (-394.462) [-394.665] (-395.897) (-396.061) * (-394.333) (-399.169) [-395.414] (-396.876) -- 0:00:24
      605000 -- (-395.947) (-396.230) (-394.229) [-395.451] * (-397.029) (-398.999) [-394.300] (-396.533) -- 0:00:24

      Average standard deviation of split frequencies: 0.006855

      605500 -- [-399.908] (-396.217) (-397.213) (-395.397) * [-396.689] (-397.530) (-396.757) (-396.645) -- 0:00:24
      606000 -- (-397.334) [-401.338] (-396.344) (-397.867) * [-396.274] (-397.383) (-398.130) (-397.785) -- 0:00:24
      606500 -- (-396.403) (-405.851) (-395.845) [-396.358] * (-405.807) (-396.592) (-396.919) [-396.414] -- 0:00:24
      607000 -- (-395.076) (-398.096) [-396.811] (-398.722) * (-397.718) [-397.206] (-397.547) (-396.935) -- 0:00:23
      607500 -- (-396.047) (-402.180) (-398.029) [-395.696] * (-398.417) [-395.919] (-395.827) (-396.597) -- 0:00:23
      608000 -- (-397.093) (-397.685) (-398.385) [-397.549] * (-395.997) (-395.659) (-399.106) [-399.415] -- 0:00:23
      608500 -- (-398.217) [-395.617] (-396.570) (-394.814) * (-395.783) [-396.438] (-399.463) (-397.662) -- 0:00:23
      609000 -- (-396.912) (-397.378) [-398.100] (-394.992) * (-394.922) [-394.222] (-396.691) (-395.904) -- 0:00:23
      609500 -- (-397.387) (-399.467) [-397.242] (-396.387) * (-395.598) (-394.188) [-395.383] (-396.285) -- 0:00:23
      610000 -- (-397.399) (-397.435) [-394.494] (-397.654) * (-395.515) (-399.148) [-395.961] (-398.590) -- 0:00:23

      Average standard deviation of split frequencies: 0.007141

      610500 -- (-394.332) (-394.908) [-396.500] (-396.691) * (-394.699) (-398.143) (-396.602) [-395.845] -- 0:00:23
      611000 -- (-394.522) [-397.910] (-398.873) (-395.568) * [-394.516] (-397.958) (-394.639) (-397.028) -- 0:00:23
      611500 -- (-395.490) (-394.740) [-395.583] (-394.098) * (-396.667) (-399.406) [-397.125] (-400.006) -- 0:00:23
      612000 -- (-396.247) [-394.268] (-396.354) (-395.244) * [-395.454] (-398.596) (-395.480) (-395.953) -- 0:00:23
      612500 -- (-396.379) (-396.840) (-395.404) [-396.107] * (-398.971) (-394.848) [-394.590] (-399.483) -- 0:00:23
      613000 -- (-394.541) (-396.728) (-395.667) [-397.370] * (-395.317) (-398.037) [-394.879] (-395.951) -- 0:00:23
      613500 -- (-395.049) (-397.042) [-397.113] (-394.823) * [-394.316] (-394.428) (-397.057) (-395.592) -- 0:00:23
      614000 -- (-394.815) [-396.663] (-395.530) (-396.191) * (-395.125) [-396.207] (-394.696) (-394.377) -- 0:00:23
      614500 -- [-394.985] (-395.948) (-396.674) (-396.348) * (-396.357) (-395.211) (-396.926) [-397.072] -- 0:00:23
      615000 -- (-394.825) [-396.439] (-395.416) (-395.355) * [-396.967] (-399.407) (-394.913) (-398.408) -- 0:00:23

      Average standard deviation of split frequencies: 0.007461

      615500 -- [-395.585] (-395.183) (-394.578) (-398.928) * (-395.872) (-395.621) [-395.398] (-397.102) -- 0:00:23
      616000 -- (-395.580) (-398.806) (-398.595) [-396.605] * (-398.588) (-398.248) [-398.624] (-397.751) -- 0:00:23
      616500 -- (-395.454) [-394.578] (-395.836) (-394.775) * (-399.027) (-400.637) (-396.215) [-395.008] -- 0:00:23
      617000 -- (-395.848) (-396.360) (-398.333) [-394.695] * (-397.003) [-395.575] (-396.445) (-397.859) -- 0:00:22
      617500 -- (-396.237) (-396.437) (-398.666) [-394.859] * [-399.168] (-396.008) (-397.628) (-397.340) -- 0:00:23
      618000 -- (-394.920) [-397.145] (-399.752) (-395.762) * (-399.144) (-394.785) [-397.394] (-401.629) -- 0:00:23
      618500 -- (-398.321) (-395.792) [-397.216] (-396.149) * (-403.035) [-396.745] (-395.511) (-402.499) -- 0:00:23
      619000 -- [-395.823] (-395.432) (-400.498) (-396.474) * [-400.395] (-398.895) (-397.034) (-400.781) -- 0:00:23
      619500 -- (-398.181) (-396.644) [-400.939] (-395.984) * (-396.951) (-394.378) [-395.625] (-397.565) -- 0:00:23
      620000 -- (-399.151) [-396.928] (-400.190) (-397.833) * (-398.253) [-394.473] (-396.141) (-398.955) -- 0:00:23

      Average standard deviation of split frequencies: 0.007738

      620500 -- (-396.726) [-394.679] (-398.805) (-397.543) * (-399.354) (-398.175) (-394.781) [-394.411] -- 0:00:23
      621000 -- (-399.501) [-394.921] (-400.697) (-400.816) * [-396.912] (-397.717) (-396.022) (-394.793) -- 0:00:23
      621500 -- (-402.421) [-395.486] (-399.147) (-396.622) * (-395.145) [-396.329] (-396.259) (-395.048) -- 0:00:23
      622000 -- (-397.541) (-397.650) (-395.070) [-397.545] * (-395.679) [-396.120] (-397.984) (-396.168) -- 0:00:23
      622500 -- [-397.048] (-398.107) (-395.157) (-398.149) * (-395.038) [-394.899] (-398.173) (-396.467) -- 0:00:23
      623000 -- [-395.695] (-396.026) (-394.624) (-394.667) * (-395.268) (-395.151) (-399.562) [-397.808] -- 0:00:22
      623500 -- (-394.824) [-394.891] (-396.580) (-395.327) * (-404.767) [-399.944] (-396.140) (-397.584) -- 0:00:22
      624000 -- (-395.013) (-398.357) [-397.289] (-396.144) * (-398.917) (-396.369) (-396.864) [-397.401] -- 0:00:22
      624500 -- [-395.326] (-398.507) (-397.741) (-395.994) * (-396.644) [-394.344] (-398.460) (-397.638) -- 0:00:22
      625000 -- [-395.944] (-396.225) (-396.834) (-395.535) * (-396.926) (-396.495) (-400.575) [-396.013] -- 0:00:22

      Average standard deviation of split frequencies: 0.008001

      625500 -- (-398.453) (-397.187) [-399.801] (-398.865) * (-400.336) (-394.382) (-399.913) [-396.097] -- 0:00:22
      626000 -- (-394.372) [-394.706] (-401.500) (-397.352) * (-395.579) (-395.306) (-398.656) [-396.325] -- 0:00:22
      626500 -- (-396.360) [-397.159] (-395.251) (-401.920) * [-399.108] (-396.579) (-396.383) (-398.471) -- 0:00:22
      627000 -- (-397.158) (-396.181) (-396.440) [-395.288] * (-395.021) (-400.293) (-396.976) [-396.906] -- 0:00:22
      627500 -- (-396.117) [-397.949] (-396.277) (-398.041) * (-396.116) [-397.840] (-397.395) (-397.419) -- 0:00:22
      628000 -- (-395.075) [-394.743] (-396.952) (-395.375) * [-398.009] (-395.913) (-397.769) (-398.613) -- 0:00:22
      628500 -- (-396.535) (-399.072) (-397.492) [-394.597] * (-395.359) (-398.352) [-395.220] (-395.262) -- 0:00:22
      629000 -- (-397.987) (-397.538) [-397.316] (-394.120) * (-397.804) [-395.390] (-394.984) (-395.900) -- 0:00:22
      629500 -- (-399.425) (-396.936) (-394.141) [-394.074] * (-394.411) (-396.703) [-395.365] (-399.050) -- 0:00:22
      630000 -- (-394.979) [-396.725] (-395.657) (-396.242) * (-394.439) [-396.526] (-396.811) (-400.336) -- 0:00:22

      Average standard deviation of split frequencies: 0.008175

      630500 -- [-395.321] (-396.313) (-395.973) (-396.573) * (-394.290) (-397.463) (-395.405) [-394.395] -- 0:00:22
      631000 -- [-394.704] (-396.671) (-395.028) (-395.680) * (-395.410) (-396.947) [-395.411] (-394.397) -- 0:00:22
      631500 -- (-396.601) (-395.356) (-396.261) [-394.509] * [-399.412] (-394.935) (-401.286) (-394.370) -- 0:00:22
      632000 -- (-397.311) (-397.974) (-395.260) [-394.566] * (-396.983) (-394.896) (-400.467) [-397.533] -- 0:00:22
      632500 -- (-395.899) (-396.891) [-398.581] (-394.979) * (-394.797) (-397.274) [-396.952] (-395.045) -- 0:00:22
      633000 -- (-397.486) (-394.085) [-396.074] (-395.305) * (-394.715) (-396.800) [-397.035] (-395.610) -- 0:00:22
      633500 -- [-397.203] (-395.188) (-397.892) (-394.495) * (-396.809) [-400.789] (-395.660) (-395.524) -- 0:00:21
      634000 -- [-397.042] (-396.406) (-395.790) (-394.789) * (-398.547) (-398.374) (-398.904) [-395.361] -- 0:00:21
      634500 -- (-395.815) (-396.809) [-399.138] (-396.033) * [-396.198] (-398.119) (-400.418) (-397.129) -- 0:00:22
      635000 -- (-396.486) (-403.450) [-395.569] (-396.374) * (-395.216) [-394.539] (-395.820) (-398.680) -- 0:00:22

      Average standard deviation of split frequencies: 0.008616

      635500 -- [-395.714] (-397.817) (-396.478) (-399.031) * (-395.077) [-395.298] (-399.825) (-397.411) -- 0:00:22
      636000 -- [-396.928] (-397.454) (-396.016) (-397.846) * (-396.319) [-394.739] (-398.670) (-394.659) -- 0:00:22
      636500 -- (-399.855) (-394.485) [-396.129] (-399.524) * [-396.438] (-395.869) (-398.826) (-395.261) -- 0:00:22
      637000 -- (-398.807) (-395.472) [-395.060] (-395.139) * (-400.671) (-394.942) (-394.483) [-394.592] -- 0:00:22
      637500 -- (-404.256) (-394.486) (-394.484) [-399.687] * (-398.412) [-395.200] (-394.182) (-398.401) -- 0:00:22
      638000 -- [-394.581] (-398.548) (-400.394) (-394.048) * (-395.088) [-395.216] (-394.004) (-395.194) -- 0:00:22
      638500 -- (-396.356) [-399.776] (-402.056) (-396.233) * (-394.238) (-396.804) (-396.446) [-397.360] -- 0:00:22
      639000 -- (-396.601) (-397.206) [-395.712] (-397.776) * [-394.340] (-398.120) (-400.110) (-397.461) -- 0:00:22
      639500 -- (-397.722) (-399.842) [-396.170] (-400.641) * (-397.912) (-395.775) [-397.140] (-398.140) -- 0:00:21
      640000 -- (-398.114) (-394.609) (-396.163) [-395.793] * (-405.370) (-407.454) [-395.296] (-396.630) -- 0:00:21

      Average standard deviation of split frequencies: 0.008646

      640500 -- (-397.030) (-399.478) (-397.774) [-398.730] * (-397.930) (-402.913) (-399.608) [-395.587] -- 0:00:21
      641000 -- (-396.435) (-396.042) (-396.590) [-394.756] * (-396.216) [-400.921] (-397.706) (-395.869) -- 0:00:21
      641500 -- (-401.508) (-394.986) (-396.744) [-394.322] * (-397.324) (-395.070) [-398.429] (-398.113) -- 0:00:21
      642000 -- (-399.395) (-396.181) [-398.393] (-398.245) * (-394.516) (-398.489) (-397.722) [-396.061] -- 0:00:21
      642500 -- (-397.134) [-395.392] (-396.712) (-395.313) * [-396.152] (-395.181) (-399.700) (-394.292) -- 0:00:21
      643000 -- [-397.750] (-400.796) (-396.969) (-397.170) * (-399.276) (-395.348) (-402.132) [-396.853] -- 0:00:21
      643500 -- (-397.181) (-397.136) (-394.959) [-396.995] * [-401.089] (-398.330) (-398.087) (-396.319) -- 0:00:21
      644000 -- [-395.249] (-395.659) (-395.140) (-394.452) * [-396.558] (-396.658) (-396.639) (-396.521) -- 0:00:21
      644500 -- (-396.068) (-399.753) (-395.051) [-395.120] * (-398.563) (-398.204) [-396.027] (-395.074) -- 0:00:21
      645000 -- (-395.391) (-398.102) [-395.370] (-396.039) * (-396.675) (-399.131) (-398.038) [-397.469] -- 0:00:21

      Average standard deviation of split frequencies: 0.008346

      645500 -- (-396.949) (-397.747) [-397.019] (-395.465) * (-396.524) [-397.200] (-395.889) (-398.338) -- 0:00:21
      646000 -- (-399.500) (-398.624) (-396.481) [-396.002] * (-394.960) (-395.724) [-394.920] (-395.184) -- 0:00:21
      646500 -- (-395.014) [-400.318] (-400.821) (-394.866) * [-395.315] (-395.972) (-399.924) (-400.923) -- 0:00:21
      647000 -- [-396.298] (-399.963) (-396.578) (-397.707) * [-394.931] (-396.607) (-394.783) (-395.060) -- 0:00:21
      647500 -- (-395.860) [-397.494] (-397.295) (-395.653) * (-398.099) (-398.958) (-397.674) [-395.445] -- 0:00:21
      648000 -- (-396.742) (-396.908) (-398.003) [-396.746] * [-397.904] (-395.570) (-394.261) (-395.487) -- 0:00:21
      648500 -- (-397.027) (-395.892) (-396.162) [-395.219] * (-397.208) [-400.517] (-395.315) (-396.402) -- 0:00:21
      649000 -- (-399.979) (-394.912) [-394.579] (-398.512) * (-394.561) [-398.548] (-395.260) (-402.350) -- 0:00:21
      649500 -- (-401.365) (-397.011) (-394.887) [-398.439] * (-396.908) [-398.745] (-398.492) (-399.119) -- 0:00:21
      650000 -- (-396.674) [-397.101] (-394.770) (-398.192) * (-395.463) [-395.098] (-395.264) (-397.356) -- 0:00:21

      Average standard deviation of split frequencies: 0.008784

      650500 -- (-394.903) (-398.372) [-395.550] (-400.871) * [-394.480] (-395.188) (-395.150) (-396.111) -- 0:00:20
      651000 -- (-395.231) (-400.828) (-399.644) [-395.109] * (-397.968) (-396.994) [-394.443] (-398.354) -- 0:00:20
      651500 -- [-394.777] (-394.616) (-399.263) (-394.874) * [-394.402] (-397.620) (-395.103) (-399.697) -- 0:00:21
      652000 -- [-394.311] (-395.817) (-397.622) (-396.001) * (-395.846) (-397.591) [-395.825] (-401.160) -- 0:00:21
      652500 -- (-395.074) [-396.894] (-397.352) (-395.862) * (-395.339) [-397.393] (-396.291) (-398.410) -- 0:00:21
      653000 -- (-400.249) (-395.627) [-394.619] (-394.365) * (-396.956) [-402.273] (-396.366) (-397.141) -- 0:00:21
      653500 -- (-395.129) [-395.137] (-394.780) (-396.437) * (-400.555) [-396.170] (-395.230) (-396.756) -- 0:00:21
      654000 -- (-395.463) [-395.663] (-394.809) (-395.723) * (-396.746) (-397.506) [-397.199] (-395.299) -- 0:00:21
      654500 -- (-395.722) [-396.819] (-394.694) (-395.808) * [-396.796] (-399.869) (-394.587) (-398.490) -- 0:00:21
      655000 -- [-394.440] (-396.754) (-394.766) (-396.476) * (-396.449) (-395.461) (-397.051) [-397.046] -- 0:00:21

      Average standard deviation of split frequencies: 0.008219

      655500 -- (-394.526) (-395.671) [-394.022] (-397.010) * [-395.689] (-394.965) (-399.031) (-396.006) -- 0:00:21
      656000 -- (-395.800) [-394.405] (-394.731) (-395.513) * (-396.244) (-396.461) [-395.168] (-395.552) -- 0:00:20
      656500 -- [-395.570] (-396.301) (-395.309) (-398.559) * [-395.769] (-394.439) (-397.492) (-395.541) -- 0:00:20
      657000 -- [-394.393] (-399.199) (-394.491) (-397.123) * [-394.427] (-399.484) (-401.429) (-396.885) -- 0:00:20
      657500 -- [-395.409] (-396.046) (-395.176) (-396.396) * (-394.554) (-396.668) [-396.892] (-396.241) -- 0:00:20
      658000 -- (-396.370) (-397.000) (-396.893) [-395.054] * [-396.392] (-395.969) (-397.660) (-395.595) -- 0:00:20
      658500 -- (-396.558) (-399.273) (-395.992) [-397.095] * [-402.208] (-395.078) (-397.893) (-394.887) -- 0:00:20
      659000 -- [-396.144] (-396.803) (-396.383) (-396.721) * [-394.938] (-395.111) (-395.789) (-395.070) -- 0:00:20
      659500 -- (-395.454) (-395.293) (-397.360) [-396.766] * (-395.358) (-394.203) (-394.665) [-394.462] -- 0:00:20
      660000 -- (-398.678) (-396.214) [-395.643] (-394.403) * (-396.693) (-394.341) [-394.940] (-395.846) -- 0:00:20

      Average standard deviation of split frequencies: 0.008072

      660500 -- (-395.932) [-397.276] (-397.897) (-395.413) * [-397.213] (-397.735) (-398.196) (-396.441) -- 0:00:20
      661000 -- (-395.960) (-398.838) [-395.477] (-398.437) * [-401.563] (-403.458) (-394.870) (-398.401) -- 0:00:20
      661500 -- (-399.501) (-399.050) [-395.542] (-401.519) * (-395.051) [-394.922] (-394.879) (-398.124) -- 0:00:20
      662000 -- (-398.924) [-397.637] (-395.216) (-397.109) * (-393.996) [-394.896] (-395.125) (-399.163) -- 0:00:20
      662500 -- [-395.954] (-396.186) (-397.724) (-396.566) * (-393.996) [-395.594] (-395.586) (-396.176) -- 0:00:20
      663000 -- [-394.946] (-399.175) (-397.496) (-400.366) * (-394.189) (-397.269) [-395.886] (-395.420) -- 0:00:20
      663500 -- (-395.586) [-395.938] (-399.799) (-399.038) * (-400.393) (-401.884) [-395.779] (-394.901) -- 0:00:20
      664000 -- (-395.869) (-397.526) (-398.284) [-395.540] * [-396.687] (-397.064) (-397.554) (-395.768) -- 0:00:20
      664500 -- [-395.456] (-397.273) (-395.816) (-399.192) * [-397.096] (-394.529) (-395.974) (-395.487) -- 0:00:20
      665000 -- (-399.489) (-395.312) (-395.348) [-398.130] * [-396.531] (-396.142) (-395.752) (-394.108) -- 0:00:20

      Average standard deviation of split frequencies: 0.007742

      665500 -- (-398.704) (-397.311) [-397.395] (-394.536) * [-397.131] (-396.315) (-397.727) (-396.591) -- 0:00:20
      666000 -- (-397.669) (-396.328) [-396.966] (-398.383) * [-394.522] (-398.004) (-395.168) (-395.755) -- 0:00:20
      666500 -- [-396.761] (-395.115) (-398.649) (-396.376) * [-395.002] (-395.665) (-397.181) (-394.262) -- 0:00:20
      667000 -- (-396.060) (-395.156) [-397.108] (-395.132) * (-396.173) [-395.545] (-394.507) (-395.193) -- 0:00:19
      667500 -- (-396.783) [-394.745] (-395.716) (-395.724) * (-395.650) (-394.592) (-398.621) [-397.469] -- 0:00:19
      668000 -- (-397.426) (-394.599) [-397.990] (-396.398) * (-395.468) (-400.013) (-399.023) [-400.068] -- 0:00:20
      668500 -- (-397.827) (-394.653) [-397.255] (-396.982) * [-395.124] (-396.261) (-396.669) (-398.403) -- 0:00:20
      669000 -- [-396.247] (-395.984) (-395.573) (-396.398) * (-394.624) [-394.888] (-396.374) (-395.515) -- 0:00:20
      669500 -- (-395.613) (-398.230) [-395.496] (-394.283) * (-396.613) (-394.771) [-394.500] (-396.638) -- 0:00:20
      670000 -- (-394.939) (-395.621) [-396.061] (-397.769) * (-395.881) [-394.274] (-397.451) (-395.018) -- 0:00:20

      Average standard deviation of split frequencies: 0.007556

      670500 -- [-395.026] (-398.121) (-398.392) (-398.476) * (-396.867) (-396.282) [-396.573] (-394.831) -- 0:00:20
      671000 -- (-397.190) (-397.063) (-395.223) [-395.410] * (-397.262) [-394.958] (-396.237) (-394.611) -- 0:00:20
      671500 -- (-394.699) [-401.472] (-396.498) (-396.147) * [-395.988] (-394.947) (-397.685) (-396.859) -- 0:00:20
      672000 -- [-396.730] (-397.481) (-394.648) (-396.390) * (-394.123) (-397.985) [-395.088] (-397.550) -- 0:00:20
      672500 -- (-396.132) (-395.150) (-395.542) [-398.041] * (-394.950) (-395.228) [-395.494] (-396.525) -- 0:00:19
      673000 -- (-397.004) (-394.866) [-396.648] (-397.279) * (-398.757) (-396.592) (-394.131) [-397.913] -- 0:00:19
      673500 -- (-398.570) (-399.855) (-398.533) [-395.259] * (-402.344) (-396.409) [-394.813] (-399.639) -- 0:00:19
      674000 -- [-394.754] (-397.742) (-397.598) (-395.794) * (-399.577) (-397.167) (-395.485) [-395.091] -- 0:00:19
      674500 -- [-396.890] (-397.309) (-395.524) (-394.556) * (-397.607) (-394.739) [-395.547] (-394.934) -- 0:00:19
      675000 -- (-399.597) (-395.769) [-394.757] (-395.175) * (-396.293) (-395.912) [-395.171] (-395.107) -- 0:00:19

      Average standard deviation of split frequencies: 0.007017

      675500 -- (-398.230) (-400.654) (-394.432) [-394.223] * (-395.712) (-398.332) [-396.156] (-395.113) -- 0:00:19
      676000 -- (-398.287) (-397.547) (-396.853) [-394.213] * (-397.176) (-396.236) (-399.450) [-399.530] -- 0:00:19
      676500 -- (-397.193) [-394.886] (-398.032) (-394.213) * [-395.878] (-395.627) (-399.126) (-396.804) -- 0:00:19
      677000 -- (-401.372) [-399.990] (-395.708) (-395.940) * (-401.817) (-395.691) (-397.365) [-395.000] -- 0:00:19
      677500 -- [-395.696] (-396.999) (-396.333) (-396.243) * [-396.717] (-396.144) (-398.049) (-398.349) -- 0:00:19
      678000 -- [-396.748] (-396.084) (-397.625) (-398.662) * (-394.085) (-399.204) (-394.394) [-396.562] -- 0:00:19
      678500 -- (-395.483) (-394.291) (-395.092) [-398.524] * (-398.954) [-397.514] (-401.059) (-397.221) -- 0:00:19
      679000 -- (-397.575) (-394.412) (-394.640) [-396.443] * (-397.467) (-395.916) (-401.999) [-401.379] -- 0:00:19
      679500 -- (-397.219) (-398.980) [-394.559] (-395.021) * (-395.936) [-395.536] (-401.511) (-398.968) -- 0:00:19
      680000 -- (-396.912) (-397.100) [-398.398] (-396.703) * (-396.510) [-396.461] (-396.581) (-397.531) -- 0:00:19

      Average standard deviation of split frequencies: 0.006882

      680500 -- (-397.784) [-397.599] (-397.195) (-396.200) * (-395.811) (-395.845) (-397.863) [-394.940] -- 0:00:19
      681000 -- (-395.466) [-398.788] (-395.559) (-396.045) * (-395.960) [-394.135] (-397.505) (-394.720) -- 0:00:19
      681500 -- (-395.243) (-396.747) (-396.549) [-397.142] * (-396.766) (-395.576) [-397.038] (-394.683) -- 0:00:19
      682000 -- [-396.162] (-396.711) (-394.535) (-396.054) * (-396.747) [-396.215] (-394.824) (-396.449) -- 0:00:19
      682500 -- [-395.641] (-402.870) (-395.535) (-395.499) * [-396.469] (-398.613) (-394.514) (-397.962) -- 0:00:19
      683000 -- (-396.000) [-395.550] (-396.888) (-395.981) * (-398.144) (-399.376) (-395.496) [-395.741] -- 0:00:19
      683500 -- [-395.799] (-398.586) (-397.919) (-396.791) * [-398.342] (-396.199) (-398.471) (-402.046) -- 0:00:18
      684000 -- [-397.157] (-398.452) (-397.360) (-395.059) * (-395.674) (-400.653) (-395.525) [-401.202] -- 0:00:19
      684500 -- (-397.607) (-395.255) (-397.724) [-395.682] * [-394.776] (-400.853) (-395.149) (-404.686) -- 0:00:19
      685000 -- (-398.750) [-394.834] (-397.032) (-395.409) * [-395.795] (-401.846) (-394.471) (-400.016) -- 0:00:19

      Average standard deviation of split frequencies: 0.006786

      685500 -- [-395.824] (-398.705) (-396.272) (-395.022) * [-396.621] (-394.949) (-394.889) (-397.045) -- 0:00:19
      686000 -- (-396.483) [-397.006] (-395.483) (-397.410) * (-396.657) (-394.546) (-395.355) [-396.399] -- 0:00:19
      686500 -- (-394.739) (-395.175) [-397.118] (-395.882) * (-395.034) (-396.855) [-395.223] (-397.106) -- 0:00:19
      687000 -- (-394.816) (-396.383) [-396.329] (-396.857) * (-394.813) (-395.906) [-396.045] (-398.671) -- 0:00:19
      687500 -- (-394.626) (-395.177) [-396.511] (-395.605) * (-395.121) [-399.047] (-400.287) (-404.564) -- 0:00:19
      688000 -- (-397.626) (-394.630) (-397.814) [-396.981] * (-394.453) (-397.534) (-395.109) [-397.340] -- 0:00:19
      688500 -- (-398.128) [-397.514] (-397.844) (-396.172) * (-399.857) (-396.252) (-397.991) [-395.347] -- 0:00:19
      689000 -- [-398.578] (-398.067) (-397.300) (-396.680) * (-394.981) (-396.315) (-395.756) [-397.461] -- 0:00:18
      689500 -- [-396.709] (-395.896) (-398.504) (-395.155) * (-394.981) (-396.853) (-394.066) [-396.738] -- 0:00:18
      690000 -- (-396.071) [-396.555] (-399.858) (-395.587) * (-395.251) [-395.533] (-393.971) (-396.038) -- 0:00:18

      Average standard deviation of split frequencies: 0.006740

      690500 -- (-395.266) (-394.313) [-398.220] (-399.255) * (-395.869) (-395.074) [-395.997] (-395.534) -- 0:00:18
      691000 -- [-398.283] (-395.180) (-395.600) (-396.750) * [-395.100] (-395.127) (-395.635) (-395.876) -- 0:00:18
      691500 -- (-399.567) [-397.916] (-396.350) (-394.874) * (-398.407) (-395.636) [-394.865] (-398.362) -- 0:00:18
      692000 -- (-395.121) [-395.604] (-396.611) (-394.419) * (-397.346) [-396.234] (-396.105) (-399.561) -- 0:00:18
      692500 -- [-395.795] (-395.151) (-395.134) (-395.546) * (-396.170) [-395.050] (-396.696) (-397.363) -- 0:00:18
      693000 -- [-395.718] (-400.370) (-397.938) (-396.566) * [-394.185] (-399.078) (-395.764) (-398.583) -- 0:00:18
      693500 -- (-395.278) (-395.225) [-394.729] (-397.713) * (-394.152) (-396.121) [-394.859] (-394.436) -- 0:00:18
      694000 -- (-394.695) [-395.231] (-395.282) (-397.830) * (-396.743) (-401.136) (-395.525) [-394.859] -- 0:00:18
      694500 -- [-394.065] (-396.465) (-398.201) (-400.941) * (-395.231) (-396.993) (-397.371) [-396.442] -- 0:00:18
      695000 -- [-394.428] (-396.980) (-396.325) (-401.687) * [-395.919] (-398.580) (-397.883) (-396.737) -- 0:00:18

      Average standard deviation of split frequencies: 0.006813

      695500 -- (-394.398) (-395.709) (-394.897) [-394.811] * (-400.891) (-395.706) (-395.796) [-395.598] -- 0:00:18
      696000 -- (-396.991) (-394.897) (-395.108) [-398.473] * (-396.072) (-398.326) [-395.703] (-394.969) -- 0:00:18
      696500 -- (-396.377) (-396.394) (-394.587) [-396.010] * (-394.480) [-395.558] (-394.554) (-398.423) -- 0:00:18
      697000 -- (-397.268) (-401.815) [-396.495] (-395.631) * (-396.037) (-396.653) [-395.028] (-397.438) -- 0:00:18
      697500 -- (-398.596) (-403.974) [-399.440] (-395.617) * (-395.432) (-395.712) (-399.362) [-399.041] -- 0:00:18
      698000 -- (-395.882) (-397.938) [-395.240] (-396.885) * (-397.102) (-396.064) (-395.206) [-397.608] -- 0:00:18
      698500 -- [-396.876] (-396.042) (-397.993) (-395.794) * (-395.556) [-397.263] (-398.827) (-399.189) -- 0:00:18
      699000 -- [-399.221] (-396.256) (-394.695) (-396.055) * [-396.337] (-395.705) (-397.780) (-395.635) -- 0:00:18
      699500 -- (-395.498) (-401.981) (-395.581) [-395.683] * (-400.251) [-399.573] (-395.438) (-395.426) -- 0:00:18
      700000 -- [-399.022] (-394.529) (-398.642) (-395.802) * (-399.529) [-398.587] (-399.189) (-394.424) -- 0:00:18

      Average standard deviation of split frequencies: 0.006807

      700500 -- (-399.371) (-395.377) [-395.039] (-394.172) * (-395.830) (-396.147) (-395.429) [-396.454] -- 0:00:18
      701000 -- (-394.338) (-396.236) (-397.069) [-394.191] * [-395.965] (-395.929) (-398.062) (-398.653) -- 0:00:18
      701500 -- (-396.623) (-396.626) (-394.713) [-397.844] * (-396.101) (-402.330) [-395.742] (-395.947) -- 0:00:18
      702000 -- [-396.089] (-395.253) (-396.468) (-395.226) * (-395.217) (-398.285) (-396.778) [-397.157] -- 0:00:18
      702500 -- (-397.551) (-396.234) [-395.266] (-395.204) * (-395.977) (-397.479) (-396.316) [-396.574] -- 0:00:18
      703000 -- [-397.021] (-396.359) (-396.024) (-397.432) * (-399.143) (-398.546) (-395.652) [-395.249] -- 0:00:18
      703500 -- (-396.512) (-395.059) (-395.043) [-397.015] * [-396.770] (-398.911) (-397.669) (-395.240) -- 0:00:18
      704000 -- (-394.928) (-396.149) [-394.716] (-397.761) * [-395.702] (-397.689) (-398.329) (-394.742) -- 0:00:18
      704500 -- (-396.114) (-395.738) (-394.192) [-395.099] * [-395.812] (-395.531) (-395.241) (-399.884) -- 0:00:18
      705000 -- (-397.162) (-395.544) (-394.794) [-398.175] * (-396.775) (-395.886) (-395.903) [-396.379] -- 0:00:17

      Average standard deviation of split frequencies: 0.006874

      705500 -- (-396.689) (-397.798) (-395.031) [-396.624] * [-394.646] (-397.186) (-397.817) (-398.332) -- 0:00:17
      706000 -- (-395.760) (-394.684) [-396.143] (-399.938) * [-396.841] (-399.068) (-396.062) (-396.288) -- 0:00:17
      706500 -- (-396.512) [-395.371] (-394.639) (-397.674) * (-398.092) [-394.486] (-396.849) (-395.908) -- 0:00:17
      707000 -- (-399.518) (-395.641) [-394.999] (-396.645) * (-397.603) [-395.924] (-395.521) (-396.907) -- 0:00:17
      707500 -- [-396.641] (-396.055) (-396.077) (-396.261) * (-395.468) (-395.700) [-396.401] (-395.769) -- 0:00:17
      708000 -- (-398.817) (-395.233) [-394.348] (-397.433) * [-394.951] (-398.744) (-395.004) (-398.213) -- 0:00:17
      708500 -- (-395.905) [-395.084] (-394.555) (-397.658) * (-396.036) [-395.511] (-395.652) (-396.496) -- 0:00:17
      709000 -- [-396.076] (-398.192) (-397.709) (-396.160) * (-395.449) (-395.490) (-397.689) [-397.349] -- 0:00:17
      709500 -- (-396.594) (-397.905) (-395.060) [-395.394] * [-395.491] (-399.480) (-400.660) (-397.482) -- 0:00:17
      710000 -- (-401.584) [-397.112] (-396.241) (-394.495) * (-395.085) (-397.328) [-395.119] (-398.957) -- 0:00:17

      Average standard deviation of split frequencies: 0.007062

      710500 -- (-396.555) (-396.673) [-401.101] (-394.730) * (-395.090) [-394.975] (-396.362) (-397.924) -- 0:00:17
      711000 -- (-402.917) (-394.387) [-397.758] (-397.043) * (-397.145) (-399.386) (-395.436) [-395.562] -- 0:00:17
      711500 -- (-400.370) (-394.975) (-395.434) [-395.267] * [-396.965] (-400.190) (-395.071) (-398.005) -- 0:00:17
      712000 -- (-394.532) [-397.724] (-395.523) (-399.604) * (-395.782) (-395.793) [-395.152] (-398.884) -- 0:00:17
      712500 -- (-398.427) [-396.380] (-399.212) (-396.225) * [-394.847] (-395.339) (-396.373) (-395.974) -- 0:00:17
      713000 -- (-396.334) (-396.013) (-396.337) [-399.286] * (-394.893) (-396.024) (-394.900) [-396.053] -- 0:00:17
      713500 -- (-396.884) (-396.608) [-398.198] (-398.292) * (-398.205) (-395.069) [-397.786] (-398.728) -- 0:00:17
      714000 -- (-396.350) (-396.975) [-395.696] (-396.014) * (-396.759) (-397.143) [-395.917] (-395.847) -- 0:00:17
      714500 -- (-396.819) (-394.104) (-396.243) [-396.882] * (-398.155) [-396.266] (-396.974) (-394.468) -- 0:00:17
      715000 -- [-398.267] (-398.531) (-395.291) (-398.242) * (-401.895) [-397.182] (-395.945) (-398.812) -- 0:00:17

      Average standard deviation of split frequencies: 0.006995

      715500 -- (-397.224) (-395.447) [-394.783] (-396.874) * (-395.728) (-396.268) (-395.115) [-396.681] -- 0:00:17
      716000 -- (-402.889) (-396.435) [-396.430] (-395.800) * (-394.053) [-395.554] (-394.334) (-397.128) -- 0:00:17
      716500 -- [-397.977] (-397.806) (-396.303) (-396.144) * [-397.070] (-394.808) (-395.867) (-397.464) -- 0:00:17
      717000 -- (-397.453) (-397.651) (-400.413) [-395.318] * (-395.850) (-395.528) [-396.608] (-397.644) -- 0:00:16
      717500 -- (-402.139) (-397.992) (-396.938) [-395.040] * (-400.883) (-394.374) (-396.908) [-395.378] -- 0:00:17
      718000 -- (-396.041) (-397.091) (-397.831) [-395.764] * (-399.546) (-399.783) [-394.658] (-394.868) -- 0:00:17
      718500 -- (-396.049) (-395.559) (-396.442) [-394.964] * (-397.574) (-398.421) (-395.602) [-399.719] -- 0:00:17
      719000 -- (-394.740) [-397.656] (-396.908) (-396.774) * (-395.506) (-397.317) (-396.692) [-395.327] -- 0:00:17
      719500 -- [-395.483] (-397.490) (-397.929) (-398.794) * (-396.028) (-395.363) (-396.545) [-399.489] -- 0:00:17
      720000 -- (-397.834) (-396.072) [-395.025] (-395.932) * (-397.452) (-395.128) [-395.659] (-396.106) -- 0:00:17

      Average standard deviation of split frequencies: 0.007154

      720500 -- (-402.739) (-395.971) [-397.749] (-397.786) * (-395.334) [-395.112] (-394.933) (-394.755) -- 0:00:17
      721000 -- (-398.155) [-396.455] (-395.761) (-397.296) * (-400.207) (-394.822) [-396.240] (-395.704) -- 0:00:17
      721500 -- (-395.746) (-396.359) [-395.632] (-398.009) * (-397.075) (-396.285) (-396.136) [-395.823] -- 0:00:16
      722000 -- (-399.019) [-394.644] (-397.327) (-397.940) * (-395.464) (-398.323) [-395.923] (-398.570) -- 0:00:16
      722500 -- (-396.501) [-398.059] (-394.567) (-395.876) * (-395.134) [-397.547] (-395.869) (-394.561) -- 0:00:16
      723000 -- [-397.455] (-394.219) (-394.099) (-395.071) * (-394.786) (-396.249) [-395.467] (-397.445) -- 0:00:16
      723500 -- (-397.748) (-393.960) [-394.311] (-395.205) * (-396.203) (-398.546) [-397.445] (-395.772) -- 0:00:16
      724000 -- (-396.683) [-396.001] (-397.834) (-397.551) * (-397.764) (-397.688) [-396.628] (-396.736) -- 0:00:16
      724500 -- (-398.941) (-400.088) [-394.106] (-399.227) * (-396.112) [-396.430] (-396.555) (-395.744) -- 0:00:16
      725000 -- (-399.339) (-399.842) [-397.505] (-395.734) * (-396.547) (-395.980) (-395.102) [-396.105] -- 0:00:16

      Average standard deviation of split frequencies: 0.007061

      725500 -- [-397.492] (-396.706) (-396.133) (-394.915) * [-395.874] (-395.749) (-395.218) (-397.385) -- 0:00:16
      726000 -- (-396.578) (-398.800) (-396.266) [-395.411] * (-398.178) [-399.064] (-397.513) (-397.617) -- 0:00:16
      726500 -- (-395.886) (-397.057) [-394.297] (-394.025) * (-397.092) (-400.316) (-395.201) [-397.997] -- 0:00:16
      727000 -- (-398.976) [-395.263] (-395.190) (-395.694) * (-396.579) (-397.651) [-395.876] (-398.055) -- 0:00:16
      727500 -- (-399.842) [-396.893] (-398.260) (-396.375) * (-394.928) (-395.691) [-394.755] (-396.210) -- 0:00:16
      728000 -- (-405.211) [-399.161] (-398.077) (-400.669) * [-395.341] (-396.035) (-394.130) (-394.845) -- 0:00:16
      728500 -- (-403.486) (-395.005) (-400.371) [-395.643] * (-396.086) (-396.060) [-395.588] (-396.678) -- 0:00:16
      729000 -- (-395.504) (-395.294) [-402.290] (-394.618) * [-397.883] (-397.145) (-397.491) (-398.182) -- 0:00:16
      729500 -- (-398.520) (-394.633) (-398.101) [-396.590] * [-398.694] (-394.900) (-396.569) (-398.524) -- 0:00:16
      730000 -- (-400.992) (-394.936) [-395.102] (-396.873) * (-396.573) (-395.257) (-400.319) [-398.865] -- 0:00:16

      Average standard deviation of split frequencies: 0.007419

      730500 -- (-396.223) (-396.897) [-397.722] (-399.682) * (-397.543) [-395.953] (-397.108) (-399.752) -- 0:00:16
      731000 -- (-397.059) (-399.653) [-395.128] (-396.989) * (-397.190) (-394.846) (-395.852) [-395.420] -- 0:00:16
      731500 -- (-394.842) (-396.592) [-394.314] (-398.297) * (-396.442) (-396.143) (-395.270) [-396.065] -- 0:00:16
      732000 -- (-403.640) [-395.115] (-394.426) (-399.169) * (-396.468) (-397.977) (-394.715) [-396.330] -- 0:00:16
      732500 -- (-402.551) (-396.341) [-397.663] (-397.159) * (-395.975) (-396.384) [-395.970] (-394.753) -- 0:00:16
      733000 -- (-403.118) (-396.136) (-398.863) [-397.945] * (-394.832) (-398.983) [-395.996] (-395.476) -- 0:00:16
      733500 -- (-403.802) [-395.892] (-396.598) (-396.289) * (-395.643) [-395.904] (-394.772) (-395.394) -- 0:00:16
      734000 -- (-399.696) (-394.934) (-396.227) [-395.906] * (-395.146) [-396.061] (-397.404) (-395.396) -- 0:00:16
      734500 -- (-397.155) (-394.086) (-395.185) [-396.019] * (-396.273) (-398.128) [-395.918] (-398.994) -- 0:00:16
      735000 -- (-397.999) (-395.733) (-396.524) [-394.540] * (-394.948) [-396.724] (-395.398) (-395.219) -- 0:00:16

      Average standard deviation of split frequencies: 0.007326

      735500 -- (-399.950) (-399.424) (-397.447) [-395.838] * (-395.497) (-400.571) (-402.331) [-400.346] -- 0:00:16
      736000 -- (-394.924) [-395.020] (-396.981) (-398.582) * (-394.204) (-397.281) (-405.751) [-394.541] -- 0:00:16
      736500 -- (-397.404) [-395.015] (-395.873) (-394.866) * [-394.789] (-394.502) (-409.130) (-395.092) -- 0:00:16
      737000 -- (-398.182) [-396.852] (-395.304) (-395.333) * [-395.359] (-396.435) (-398.053) (-403.954) -- 0:00:16
      737500 -- [-396.841] (-395.903) (-395.328) (-395.200) * (-399.339) (-396.499) (-395.625) [-399.326] -- 0:00:16
      738000 -- [-395.814] (-396.885) (-398.049) (-394.294) * [-400.483] (-394.730) (-395.306) (-397.553) -- 0:00:15
      738500 -- (-396.571) (-395.459) (-397.436) [-396.010] * (-396.153) (-396.908) [-394.846] (-400.340) -- 0:00:15
      739000 -- (-394.932) [-396.565] (-397.187) (-394.460) * [-394.344] (-400.398) (-395.104) (-395.326) -- 0:00:15
      739500 -- (-396.398) (-395.413) [-395.872] (-394.225) * (-394.851) (-398.221) [-396.779] (-399.191) -- 0:00:15
      740000 -- (-400.048) (-395.438) [-396.362] (-395.656) * (-396.269) (-399.829) (-394.587) [-397.808] -- 0:00:15

      Average standard deviation of split frequencies: 0.006921

      740500 -- (-397.487) [-395.800] (-399.573) (-395.059) * (-396.301) [-394.454] (-398.240) (-397.144) -- 0:00:15
      741000 -- (-395.788) (-396.502) (-402.769) [-395.108] * (-396.259) [-394.933] (-394.648) (-396.163) -- 0:00:15
      741500 -- (-395.217) (-396.789) (-394.791) [-394.329] * (-399.689) [-398.203] (-398.386) (-395.523) -- 0:00:15
      742000 -- (-395.745) [-397.023] (-396.300) (-394.106) * (-396.517) [-397.687] (-397.471) (-395.266) -- 0:00:15
      742500 -- [-397.913] (-398.345) (-400.985) (-394.419) * (-402.018) [-394.731] (-397.440) (-395.263) -- 0:00:15
      743000 -- (-397.465) (-395.059) [-397.559] (-394.603) * (-396.675) (-395.875) (-398.322) [-395.267] -- 0:00:15
      743500 -- (-398.946) [-396.532] (-398.239) (-394.603) * (-396.294) [-398.980] (-394.726) (-395.636) -- 0:00:15
      744000 -- (-394.458) (-394.673) [-397.678] (-395.544) * (-397.819) (-394.876) [-396.025] (-395.277) -- 0:00:15
      744500 -- [-394.729] (-395.007) (-396.250) (-395.912) * (-401.792) (-397.023) (-395.520) [-396.358] -- 0:00:15
      745000 -- (-397.326) (-395.823) (-395.123) [-397.922] * (-396.727) (-397.781) [-394.426] (-396.910) -- 0:00:15

      Average standard deviation of split frequencies: 0.006912

      745500 -- (-396.345) [-395.729] (-395.430) (-395.566) * (-397.642) (-397.881) (-394.947) [-397.237] -- 0:00:15
      746000 -- (-397.015) [-400.344] (-398.086) (-396.887) * (-397.740) [-395.987] (-394.995) (-397.736) -- 0:00:15
      746500 -- (-397.589) (-396.733) [-395.956] (-397.529) * [-397.525] (-399.006) (-395.363) (-394.773) -- 0:00:15
      747000 -- (-395.494) [-394.506] (-395.959) (-395.109) * [-395.015] (-396.785) (-395.181) (-395.649) -- 0:00:15
      747500 -- [-395.664] (-395.954) (-399.276) (-396.671) * [-394.535] (-400.028) (-397.846) (-398.060) -- 0:00:15
      748000 -- (-395.932) (-394.483) (-396.306) [-396.904] * (-394.563) [-395.451] (-398.164) (-398.342) -- 0:00:15
      748500 -- (-398.011) [-394.149] (-395.029) (-398.176) * [-394.198] (-394.865) (-398.786) (-395.689) -- 0:00:15
      749000 -- (-395.985) (-397.364) (-394.576) [-400.736] * (-394.270) (-394.689) [-398.420] (-394.644) -- 0:00:15
      749500 -- [-396.861] (-395.653) (-395.464) (-398.902) * [-395.812] (-395.078) (-395.511) (-397.351) -- 0:00:15
      750000 -- (-398.496) (-396.189) (-397.457) [-395.376] * (-394.719) (-395.137) [-396.687] (-397.666) -- 0:00:15

      Average standard deviation of split frequencies: 0.006790

      750500 -- (-398.151) (-398.153) [-397.253] (-396.876) * (-396.136) (-396.246) [-395.220] (-396.726) -- 0:00:15
      751000 -- (-397.442) (-396.553) [-394.953] (-394.479) * (-398.825) (-399.496) (-397.509) [-396.239] -- 0:00:15
      751500 -- (-397.210) (-395.962) (-395.237) [-395.558] * (-397.574) (-397.210) (-399.928) [-396.137] -- 0:00:15
      752000 -- (-395.184) (-395.214) (-398.915) [-397.660] * (-397.792) (-396.283) (-408.632) [-395.537] -- 0:00:15
      752500 -- (-398.639) (-396.788) (-396.474) [-396.690] * (-394.585) (-398.226) (-396.002) [-394.469] -- 0:00:15
      753000 -- (-397.647) [-394.001] (-397.811) (-395.823) * [-395.228] (-397.409) (-396.588) (-395.422) -- 0:00:15
      753500 -- (-397.839) [-395.283] (-396.865) (-396.164) * (-397.658) (-396.381) (-396.135) [-395.715] -- 0:00:15
      754000 -- [-398.454] (-397.379) (-398.067) (-394.206) * [-397.658] (-394.980) (-394.352) (-394.810) -- 0:00:15
      754500 -- (-398.676) (-394.314) (-396.118) [-394.759] * (-397.674) (-394.372) [-394.970] (-396.415) -- 0:00:14
      755000 -- [-394.826] (-396.876) (-398.939) (-394.678) * (-398.233) (-396.669) (-396.952) [-396.249] -- 0:00:14

      Average standard deviation of split frequencies: 0.006526

      755500 -- (-395.993) [-396.625] (-396.668) (-398.541) * (-399.493) (-398.870) (-396.646) [-394.918] -- 0:00:14
      756000 -- (-395.033) [-395.051] (-397.149) (-396.427) * (-394.921) [-398.613] (-398.306) (-394.865) -- 0:00:14
      756500 -- (-394.997) [-395.519] (-395.528) (-395.495) * (-396.444) [-394.632] (-396.348) (-400.086) -- 0:00:14
      757000 -- (-395.428) (-396.341) (-395.269) [-394.030] * (-397.147) (-397.081) [-397.506] (-396.652) -- 0:00:14
      757500 -- (-395.539) (-394.735) (-394.598) [-394.113] * (-396.189) (-395.345) (-399.741) [-395.360] -- 0:00:14
      758000 -- (-395.555) (-394.891) [-394.695] (-394.886) * (-395.230) [-394.717] (-399.795) (-397.179) -- 0:00:14
      758500 -- (-396.124) (-395.894) (-400.271) [-394.219] * (-398.725) (-397.096) (-398.538) [-394.575] -- 0:00:14
      759000 -- (-399.754) (-396.225) (-395.027) [-394.216] * (-402.775) [-394.881] (-400.304) (-394.740) -- 0:00:14
      759500 -- [-399.681] (-395.813) (-394.609) (-395.411) * (-396.632) [-394.690] (-401.576) (-396.182) -- 0:00:14
      760000 -- (-397.488) (-395.315) (-396.104) [-397.281] * (-400.355) (-395.509) (-397.357) [-396.718] -- 0:00:14

      Average standard deviation of split frequencies: 0.006858

      760500 -- (-398.268) [-396.089] (-398.065) (-399.382) * (-399.276) (-395.235) (-396.165) [-395.631] -- 0:00:14
      761000 -- (-397.168) (-394.590) (-399.479) [-395.798] * [-399.584] (-398.011) (-398.905) (-395.587) -- 0:00:14
      761500 -- (-395.418) (-397.760) [-402.228] (-394.979) * (-394.811) [-396.613] (-395.797) (-396.783) -- 0:00:14
      762000 -- (-394.883) (-394.374) [-394.929] (-396.424) * (-398.412) (-395.793) [-399.569] (-397.307) -- 0:00:14
      762500 -- (-396.456) (-394.685) (-397.068) [-398.197] * [-395.384] (-397.115) (-395.299) (-401.803) -- 0:00:14
      763000 -- [-396.053] (-395.900) (-396.657) (-395.691) * (-397.588) (-401.416) (-396.160) [-396.064] -- 0:00:14
      763500 -- (-397.354) [-394.720] (-395.903) (-397.127) * (-394.093) [-402.771] (-398.182) (-398.266) -- 0:00:14
      764000 -- (-395.487) (-397.417) [-394.687] (-398.566) * (-395.542) (-397.551) (-399.850) [-395.831] -- 0:00:14
      764500 -- [-394.533] (-396.785) (-397.139) (-397.570) * (-394.780) (-395.606) [-398.654] (-395.251) -- 0:00:14
      765000 -- [-396.862] (-395.422) (-396.143) (-398.472) * [-396.498] (-395.587) (-397.099) (-395.135) -- 0:00:14

      Average standard deviation of split frequencies: 0.007508

      765500 -- (-398.188) (-394.387) (-400.405) [-395.170] * (-395.669) [-398.405] (-394.324) (-396.474) -- 0:00:14
      766000 -- (-402.437) (-396.145) [-402.929] (-396.804) * (-398.079) [-396.354] (-395.308) (-396.166) -- 0:00:14
      766500 -- [-398.613] (-395.985) (-401.477) (-396.427) * (-400.466) [-396.192] (-395.463) (-396.668) -- 0:00:14
      767000 -- (-396.316) (-394.992) (-398.320) [-394.609] * [-395.258] (-395.796) (-395.579) (-394.592) -- 0:00:14
      767500 -- (-396.110) [-396.481] (-395.487) (-394.933) * (-395.887) (-395.873) (-396.415) [-395.625] -- 0:00:14
      768000 -- [-395.699] (-395.621) (-396.878) (-395.059) * (-398.367) (-395.603) (-396.413) [-396.419] -- 0:00:14
      768500 -- [-395.027] (-396.026) (-396.925) (-394.210) * (-399.055) (-395.948) (-396.448) [-395.331] -- 0:00:14
      769000 -- (-397.831) (-395.559) (-403.371) [-400.083] * (-396.891) (-397.701) (-395.520) [-397.575] -- 0:00:14
      769500 -- (-395.094) (-394.528) (-397.063) [-396.358] * [-397.136] (-395.729) (-401.013) (-396.713) -- 0:00:14
      770000 -- (-395.617) (-401.165) (-394.599) [-396.104] * (-395.682) (-397.636) (-396.751) [-394.853] -- 0:00:14

      Average standard deviation of split frequencies: 0.006810

      770500 -- (-395.241) [-396.110] (-397.898) (-398.447) * (-399.196) (-398.140) [-397.519] (-394.419) -- 0:00:13
      771000 -- [-395.255] (-395.055) (-399.667) (-397.266) * (-395.225) [-394.289] (-395.901) (-397.358) -- 0:00:13
      771500 -- (-400.018) (-397.298) [-402.176] (-395.871) * [-395.561] (-394.318) (-394.833) (-396.487) -- 0:00:13
      772000 -- (-395.643) [-396.297] (-398.330) (-395.089) * [-396.832] (-395.118) (-395.287) (-397.365) -- 0:00:13
      772500 -- (-394.742) [-395.513] (-396.759) (-395.623) * [-394.978] (-394.948) (-396.318) (-400.099) -- 0:00:13
      773000 -- (-397.702) [-395.436] (-395.855) (-394.406) * [-395.066] (-395.168) (-396.688) (-397.128) -- 0:00:13
      773500 -- [-396.689] (-400.694) (-394.392) (-394.863) * [-396.806] (-401.077) (-397.770) (-399.964) -- 0:00:13
      774000 -- (-397.469) [-397.521] (-396.439) (-398.898) * (-396.917) (-397.076) [-396.989] (-404.484) -- 0:00:13
      774500 -- (-400.082) [-395.959] (-397.253) (-396.247) * [-398.368] (-399.492) (-399.623) (-399.645) -- 0:00:13
      775000 -- (-398.839) (-396.683) (-396.909) [-396.367] * (-396.714) [-396.201] (-396.215) (-395.350) -- 0:00:13

      Average standard deviation of split frequencies: 0.006601

      775500 -- [-396.952] (-394.227) (-396.739) (-396.678) * (-400.350) (-395.865) [-395.881] (-397.472) -- 0:00:13
      776000 -- (-399.533) (-397.012) [-395.833] (-403.032) * (-401.526) (-395.620) [-394.627] (-395.671) -- 0:00:13
      776500 -- (-395.244) (-399.198) (-396.597) [-397.622] * (-395.622) [-397.513] (-396.191) (-395.300) -- 0:00:13
      777000 -- [-400.528] (-397.458) (-396.673) (-395.773) * (-396.403) (-395.185) [-395.075] (-395.091) -- 0:00:13
      777500 -- [-396.780] (-394.700) (-402.422) (-397.146) * (-396.688) (-399.922) (-395.177) [-394.314] -- 0:00:13
      778000 -- (-394.998) (-394.831) (-400.943) [-397.233] * (-397.069) (-395.175) (-397.530) [-395.367] -- 0:00:13
      778500 -- [-394.438] (-396.703) (-397.602) (-396.661) * (-397.260) (-397.285) [-394.884] (-396.104) -- 0:00:13
      779000 -- (-398.445) (-399.383) [-396.397] (-397.880) * (-398.658) (-397.509) [-394.559] (-401.768) -- 0:00:13
      779500 -- (-394.987) (-400.859) (-396.378) [-395.861] * (-395.751) (-395.572) [-395.557] (-396.509) -- 0:00:13
      780000 -- [-395.534] (-394.496) (-397.429) (-397.147) * (-398.680) [-401.638] (-395.525) (-397.755) -- 0:00:13

      Average standard deviation of split frequencies: 0.006441

      780500 -- [-394.611] (-395.113) (-395.762) (-395.899) * (-395.615) [-395.196] (-398.519) (-396.857) -- 0:00:13
      781000 -- [-395.650] (-397.277) (-394.728) (-396.982) * (-397.492) [-395.473] (-394.990) (-397.227) -- 0:00:13
      781500 -- (-394.855) (-397.779) [-397.989] (-395.758) * [-396.266] (-396.637) (-395.153) (-398.296) -- 0:00:13
      782000 -- (-394.886) (-395.649) [-396.354] (-397.151) * [-396.884] (-394.505) (-394.961) (-397.228) -- 0:00:13
      782500 -- (-395.802) [-397.435] (-394.538) (-396.659) * (-395.164) (-397.043) (-394.834) [-394.435] -- 0:00:13
      783000 -- (-396.022) (-397.065) (-395.784) [-400.796] * (-394.803) (-395.086) [-396.240] (-394.686) -- 0:00:13
      783500 -- (-394.824) [-395.858] (-395.939) (-395.339) * (-394.282) [-394.787] (-395.896) (-395.470) -- 0:00:13
      784000 -- (-400.247) [-394.666] (-395.454) (-396.125) * (-394.765) (-398.043) [-394.734] (-395.345) -- 0:00:13
      784500 -- (-394.144) [-397.250] (-395.896) (-395.970) * (-395.724) (-396.866) [-396.495] (-396.107) -- 0:00:13
      785000 -- (-396.812) [-396.411] (-395.999) (-401.251) * (-394.948) [-396.618] (-399.019) (-399.221) -- 0:00:13

      Average standard deviation of split frequencies: 0.006437

      785500 -- (-395.399) (-395.952) (-397.328) [-397.567] * (-403.364) (-394.858) [-395.789] (-396.089) -- 0:00:13
      786000 -- [-395.039] (-395.310) (-395.164) (-395.287) * (-395.030) (-397.911) [-396.273] (-398.887) -- 0:00:13
      786500 -- (-398.422) (-395.556) (-398.563) [-401.217] * (-400.133) (-399.154) [-396.659] (-396.154) -- 0:00:13
      787000 -- (-397.669) [-398.088] (-396.124) (-397.817) * (-395.955) (-396.159) [-395.969] (-398.535) -- 0:00:12
      787500 -- (-396.916) (-398.091) [-397.800] (-394.830) * (-398.612) [-396.609] (-397.213) (-397.610) -- 0:00:12
      788000 -- [-397.383] (-395.096) (-403.379) (-398.759) * (-395.947) (-398.936) (-397.559) [-395.742] -- 0:00:12
      788500 -- (-399.458) [-394.298] (-398.748) (-396.403) * (-395.420) (-395.894) [-399.430] (-395.027) -- 0:00:12
      789000 -- [-397.271] (-396.302) (-396.214) (-397.460) * [-395.608] (-396.419) (-397.738) (-395.659) -- 0:00:12
      789500 -- (-394.988) [-395.943] (-397.307) (-398.277) * [-395.490] (-396.906) (-400.655) (-395.514) -- 0:00:12
      790000 -- (-396.513) [-397.441] (-396.018) (-397.173) * [-396.262] (-396.046) (-395.837) (-395.117) -- 0:00:12

      Average standard deviation of split frequencies: 0.006876

      790500 -- (-397.018) [-395.282] (-395.994) (-398.544) * (-394.887) (-396.842) [-396.934] (-395.733) -- 0:00:12
      791000 -- (-396.233) (-398.967) [-395.832] (-395.485) * [-394.511] (-396.134) (-394.861) (-401.427) -- 0:00:12
      791500 -- (-398.190) (-396.854) [-396.655] (-394.532) * [-394.916] (-395.712) (-395.308) (-408.653) -- 0:00:12
      792000 -- (-397.713) [-395.812] (-397.916) (-396.266) * [-396.947] (-395.320) (-396.072) (-398.729) -- 0:00:12
      792500 -- (-396.444) [-398.836] (-395.769) (-397.041) * [-397.137] (-395.214) (-401.216) (-395.390) -- 0:00:12
      793000 -- (-403.159) (-396.511) [-395.139] (-398.120) * (-402.477) (-398.661) [-394.965] (-394.387) -- 0:00:12
      793500 -- (-396.969) (-396.349) [-397.871] (-396.755) * (-399.319) [-396.623] (-395.105) (-397.587) -- 0:00:12
      794000 -- (-395.328) (-396.980) [-396.582] (-398.960) * (-396.616) (-397.580) (-395.580) [-396.325] -- 0:00:12
      794500 -- (-396.691) (-399.467) [-396.532] (-395.692) * (-396.474) (-397.675) [-397.141] (-398.313) -- 0:00:12
      795000 -- (-402.616) (-397.461) [-395.953] (-395.147) * [-397.314] (-394.403) (-399.845) (-400.359) -- 0:00:12

      Average standard deviation of split frequencies: 0.007146

      795500 -- (-396.927) (-398.931) [-396.102] (-397.595) * [-395.880] (-394.949) (-397.366) (-395.650) -- 0:00:12
      796000 -- (-400.009) (-395.885) [-396.572] (-398.567) * (-394.705) (-397.133) (-397.193) [-395.356] -- 0:00:12
      796500 -- [-400.305] (-395.996) (-399.311) (-398.073) * [-394.682] (-398.275) (-397.153) (-397.341) -- 0:00:12
      797000 -- (-396.398) (-395.670) [-397.957] (-396.553) * (-395.726) (-396.601) (-396.503) [-396.405] -- 0:00:12
      797500 -- (-394.492) (-397.520) (-395.190) [-395.273] * (-396.971) (-400.626) (-394.680) [-397.802] -- 0:00:12
      798000 -- (-394.486) (-397.758) (-396.794) [-394.802] * (-399.185) (-397.013) [-394.332] (-400.364) -- 0:00:12
      798500 -- (-396.131) (-397.982) [-395.883] (-395.093) * (-395.330) [-395.109] (-394.665) (-394.283) -- 0:00:12
      799000 -- [-395.845] (-395.370) (-395.225) (-395.129) * (-395.217) [-396.866] (-396.724) (-394.430) -- 0:00:12
      799500 -- (-399.273) (-396.732) [-395.765] (-396.637) * [-395.220] (-395.709) (-402.061) (-394.579) -- 0:00:12
      800000 -- [-397.164] (-395.413) (-395.595) (-397.563) * (-397.732) [-396.352] (-397.090) (-394.630) -- 0:00:12

      Average standard deviation of split frequencies: 0.007497

      800500 -- (-395.688) (-400.217) (-400.796) [-395.880] * [-396.630] (-397.547) (-396.505) (-395.179) -- 0:00:12
      801000 -- [-397.633] (-396.970) (-395.793) (-394.987) * [-395.872] (-396.164) (-399.369) (-398.630) -- 0:00:12
      801500 -- [-397.591] (-396.462) (-396.892) (-395.348) * [-397.666] (-401.562) (-398.610) (-395.506) -- 0:00:12
      802000 -- (-396.652) (-398.496) (-397.711) [-395.057] * (-397.811) [-394.989] (-398.567) (-394.984) -- 0:00:12
      802500 -- (-394.809) [-398.712] (-395.629) (-397.812) * [-397.101] (-396.376) (-400.251) (-395.079) -- 0:00:12
      803000 -- (-395.475) (-397.122) (-395.797) [-399.267] * (-397.539) (-397.391) (-395.921) [-398.965] -- 0:00:12
      803500 -- (-394.487) [-395.385] (-395.653) (-396.321) * (-396.704) (-396.581) [-394.969] (-395.335) -- 0:00:11
      804000 -- (-395.068) (-400.277) [-394.490] (-394.173) * (-397.451) (-394.322) [-395.587] (-398.389) -- 0:00:11
      804500 -- (-395.334) [-396.631] (-395.209) (-395.801) * [-397.000] (-398.272) (-395.474) (-395.287) -- 0:00:11
      805000 -- (-395.857) (-394.537) (-396.684) [-394.713] * [-396.672] (-394.796) (-397.249) (-396.692) -- 0:00:11

      Average standard deviation of split frequencies: 0.007057

      805500 -- (-394.265) [-397.186] (-397.384) (-399.038) * [-398.402] (-396.811) (-396.312) (-398.952) -- 0:00:11
      806000 -- [-396.312] (-397.097) (-396.611) (-400.093) * (-398.236) [-396.555] (-395.469) (-397.773) -- 0:00:11
      806500 -- (-395.227) [-396.542] (-399.176) (-394.639) * (-397.278) (-395.258) (-395.896) [-395.155] -- 0:00:11
      807000 -- (-398.512) (-395.864) [-395.075] (-394.432) * [-394.754] (-394.829) (-396.065) (-394.427) -- 0:00:11
      807500 -- (-396.046) (-398.931) [-397.065] (-395.368) * (-394.891) (-398.896) [-396.022] (-395.391) -- 0:00:11
      808000 -- (-394.365) (-396.615) [-395.339] (-396.766) * (-400.523) (-396.192) (-396.755) [-395.312] -- 0:00:11
      808500 -- (-398.636) (-395.775) (-396.683) [-394.910] * (-396.950) (-394.606) [-400.510] (-396.201) -- 0:00:11
      809000 -- (-396.936) (-395.910) (-397.232) [-394.671] * (-395.998) [-397.455] (-398.984) (-395.295) -- 0:00:11
      809500 -- (-396.238) [-397.384] (-395.751) (-396.586) * (-395.673) (-397.848) (-401.041) [-396.049] -- 0:00:11
      810000 -- (-396.378) (-400.999) [-401.152] (-395.623) * (-398.570) (-395.241) (-397.176) [-395.762] -- 0:00:11

      Average standard deviation of split frequencies: 0.007133

      810500 -- (-394.347) (-396.915) [-396.636] (-399.269) * (-398.236) [-394.836] (-399.915) (-397.498) -- 0:00:11
      811000 -- [-394.733] (-399.402) (-395.449) (-398.740) * (-395.513) (-395.199) [-396.549] (-394.856) -- 0:00:11
      811500 -- (-397.567) [-394.661] (-397.746) (-400.669) * [-396.517] (-396.766) (-395.224) (-399.198) -- 0:00:11
      812000 -- (-395.913) (-398.441) [-401.540] (-394.440) * (-398.890) (-397.339) [-395.297] (-397.528) -- 0:00:11
      812500 -- (-398.318) (-398.989) (-396.088) [-394.471] * (-394.461) (-396.628) [-396.651] (-398.437) -- 0:00:11
      813000 -- (-399.180) (-400.261) (-397.832) [-394.866] * (-394.771) (-396.955) [-400.815] (-398.607) -- 0:00:11
      813500 -- (-395.527) (-400.004) (-395.046) [-395.703] * (-397.881) (-398.155) (-395.844) [-394.964] -- 0:00:11
      814000 -- (-398.241) (-395.361) [-394.499] (-397.746) * (-396.941) [-394.662] (-396.493) (-397.037) -- 0:00:11
      814500 -- (-399.270) [-397.718] (-395.235) (-394.290) * (-395.687) [-397.700] (-395.441) (-394.729) -- 0:00:11
      815000 -- (-401.144) (-398.252) (-397.575) [-394.689] * (-398.407) [-396.142] (-395.618) (-395.034) -- 0:00:11

      Average standard deviation of split frequencies: 0.007356

      815500 -- (-396.842) [-397.109] (-400.197) (-395.162) * (-396.288) [-397.960] (-396.984) (-396.365) -- 0:00:11
      816000 -- [-395.710] (-397.832) (-399.827) (-394.735) * (-399.232) [-395.885] (-396.541) (-396.224) -- 0:00:11
      816500 -- (-397.040) (-396.019) [-396.348] (-394.590) * (-400.026) (-397.932) [-396.703] (-396.011) -- 0:00:11
      817000 -- [-396.262] (-397.582) (-396.025) (-394.734) * [-395.814] (-400.654) (-396.964) (-396.606) -- 0:00:11
      817500 -- [-398.747] (-400.586) (-397.094) (-395.347) * (-396.648) [-396.041] (-396.872) (-397.100) -- 0:00:11
      818000 -- [-396.369] (-396.899) (-399.784) (-396.486) * (-398.787) (-395.164) (-395.808) [-394.686] -- 0:00:11
      818500 -- (-394.835) [-396.277] (-394.631) (-396.261) * [-394.530] (-400.857) (-396.616) (-393.974) -- 0:00:11
      819000 -- (-395.970) (-401.630) (-401.859) [-396.170] * (-395.062) (-397.463) (-399.498) [-395.875] -- 0:00:11
      819500 -- (-395.431) (-396.569) (-397.121) [-399.652] * (-394.605) (-397.281) [-395.123] (-400.058) -- 0:00:11
      820000 -- [-396.341] (-398.597) (-399.023) (-399.701) * (-395.966) (-394.308) (-396.155) [-394.070] -- 0:00:10

      Average standard deviation of split frequencies: 0.007735

      820500 -- [-396.992] (-399.269) (-397.791) (-398.411) * (-395.651) (-394.141) (-394.311) [-396.288] -- 0:00:10
      821000 -- [-401.164] (-396.231) (-397.603) (-397.093) * (-395.546) [-394.481] (-397.189) (-396.890) -- 0:00:10
      821500 -- (-398.426) (-403.028) (-395.032) [-398.465] * (-395.430) [-394.648] (-394.723) (-395.943) -- 0:00:10
      822000 -- (-395.294) [-395.760] (-396.949) (-395.555) * [-396.001] (-396.318) (-400.887) (-397.768) -- 0:00:10
      822500 -- (-399.178) (-395.044) [-397.524] (-395.112) * [-394.798] (-396.930) (-399.874) (-396.794) -- 0:00:10
      823000 -- (-397.175) (-396.834) (-395.999) [-395.403] * (-394.747) [-396.489] (-399.366) (-396.979) -- 0:00:10
      823500 -- [-395.801] (-396.301) (-396.116) (-394.837) * (-396.685) (-396.504) [-396.399] (-396.419) -- 0:00:10
      824000 -- (-396.218) [-394.648] (-396.598) (-394.286) * [-394.254] (-396.284) (-398.241) (-395.347) -- 0:00:10
      824500 -- (-396.540) (-397.960) (-396.657) [-395.473] * [-394.487] (-397.324) (-395.188) (-395.284) -- 0:00:10
      825000 -- (-397.273) [-395.274] (-396.097) (-398.695) * (-396.446) (-394.179) (-396.259) [-395.515] -- 0:00:10

      Average standard deviation of split frequencies: 0.007305

      825500 -- (-395.468) (-397.631) (-396.352) [-399.107] * [-396.615] (-395.888) (-396.538) (-395.482) -- 0:00:10
      826000 -- (-397.666) [-395.849] (-395.128) (-398.200) * [-396.262] (-397.638) (-395.483) (-394.237) -- 0:00:10
      826500 -- (-399.068) (-394.933) [-397.093] (-395.891) * (-395.379) (-397.438) [-394.693] (-394.529) -- 0:00:10
      827000 -- (-394.930) (-396.978) [-394.455] (-398.172) * (-400.279) (-399.026) (-395.751) [-397.156] -- 0:00:10
      827500 -- [-398.245] (-394.585) (-399.520) (-402.372) * [-396.133] (-398.218) (-398.201) (-396.858) -- 0:00:10
      828000 -- (-394.706) (-395.544) (-397.561) [-399.352] * (-395.330) (-396.437) [-396.970] (-395.044) -- 0:00:10
      828500 -- (-394.985) (-396.984) [-398.349] (-400.482) * (-395.435) (-398.336) [-395.504] (-394.689) -- 0:00:10
      829000 -- (-394.635) [-396.079] (-398.332) (-395.647) * (-395.431) (-397.785) [-396.192] (-399.608) -- 0:00:10
      829500 -- (-395.084) (-396.026) [-396.286] (-397.154) * [-394.484] (-397.543) (-394.955) (-397.804) -- 0:00:10
      830000 -- (-393.919) (-394.516) [-395.284] (-395.158) * (-396.658) (-397.279) (-398.305) [-397.302] -- 0:00:10

      Average standard deviation of split frequencies: 0.007151

      830500 -- (-397.282) (-396.106) [-394.894] (-397.124) * [-394.058] (-401.017) (-396.416) (-397.329) -- 0:00:10
      831000 -- (-396.053) (-396.086) [-396.310] (-394.558) * (-394.322) [-396.348] (-399.638) (-394.014) -- 0:00:10
      831500 -- (-395.465) [-395.103] (-399.001) (-394.874) * [-400.282] (-396.750) (-398.815) (-395.669) -- 0:00:10
      832000 -- (-395.741) (-398.749) [-395.785] (-397.684) * (-397.506) [-394.778] (-399.825) (-397.860) -- 0:00:10
      832500 -- (-394.864) (-395.197) [-395.789] (-396.522) * (-395.345) (-397.095) (-396.299) [-397.552] -- 0:00:10
      833000 -- (-394.946) (-396.219) [-394.880] (-395.978) * (-398.128) [-396.135] (-395.779) (-398.656) -- 0:00:10
      833500 -- (-397.118) [-394.347] (-397.001) (-397.820) * (-398.736) (-396.513) (-395.719) [-394.390] -- 0:00:10
      834000 -- [-395.456] (-397.129) (-398.863) (-399.642) * (-398.269) (-397.419) (-395.064) [-394.894] -- 0:00:10
      834500 -- [-395.408] (-396.309) (-394.920) (-400.014) * (-400.666) (-395.333) [-395.124] (-397.518) -- 0:00:10
      835000 -- (-398.992) (-397.381) [-395.320] (-394.633) * (-397.495) (-395.347) (-395.242) [-395.337] -- 0:00:10

      Average standard deviation of split frequencies: 0.006804

      835500 -- (-400.881) (-395.117) (-394.080) [-395.808] * (-397.243) [-395.748] (-395.287) (-396.957) -- 0:00:10
      836000 -- [-396.659] (-396.651) (-394.194) (-395.446) * (-395.847) (-397.363) [-396.790] (-395.560) -- 0:00:10
      836500 -- (-397.524) (-396.105) (-395.675) [-394.182] * (-397.319) (-396.565) (-397.063) [-396.505] -- 0:00:09
      837000 -- (-396.833) (-396.577) [-397.384] (-394.395) * [-398.349] (-400.921) (-397.981) (-401.807) -- 0:00:09
      837500 -- [-395.077] (-398.479) (-400.417) (-394.900) * (-397.649) (-401.686) (-395.138) [-397.073] -- 0:00:09
      838000 -- (-396.126) [-394.173] (-396.782) (-395.294) * [-398.552] (-395.405) (-400.485) (-400.234) -- 0:00:09
      838500 -- (-398.085) (-401.155) [-395.996] (-394.916) * (-396.105) (-396.811) [-396.379] (-398.439) -- 0:00:09
      839000 -- [-395.395] (-402.725) (-394.933) (-396.227) * (-398.125) [-395.031] (-400.783) (-395.800) -- 0:00:09
      839500 -- (-394.321) (-398.686) (-395.609) [-402.502] * (-394.493) [-396.375] (-395.608) (-400.629) -- 0:00:09
      840000 -- (-397.562) (-398.494) [-396.249] (-395.771) * (-394.990) (-395.143) (-397.900) [-399.411] -- 0:00:09

      Average standard deviation of split frequencies: 0.006654

      840500 -- [-397.264] (-394.194) (-399.318) (-396.178) * (-394.504) (-395.133) [-395.594] (-396.501) -- 0:00:09
      841000 -- [-394.665] (-394.417) (-397.300) (-394.628) * (-396.180) (-396.951) [-394.284] (-399.080) -- 0:00:09
      841500 -- (-396.913) (-395.090) [-398.462] (-396.450) * (-397.058) (-396.531) (-395.911) [-397.167] -- 0:00:09
      842000 -- (-401.182) (-398.281) (-395.595) [-398.819] * (-400.593) (-401.742) (-395.679) [-394.101] -- 0:00:09
      842500 -- (-397.861) (-396.012) (-403.072) [-403.117] * (-395.567) (-397.859) (-395.262) [-395.339] -- 0:00:09
      843000 -- [-395.435] (-395.202) (-398.398) (-399.380) * (-396.422) [-399.722] (-396.066) (-398.650) -- 0:00:09
      843500 -- (-399.381) [-396.663] (-395.579) (-395.375) * (-395.109) (-400.085) (-399.304) [-397.228] -- 0:00:09
      844000 -- (-397.564) (-394.701) (-397.126) [-397.805] * [-395.726] (-398.159) (-397.710) (-395.048) -- 0:00:09
      844500 -- (-398.495) [-394.602] (-396.597) (-398.771) * [-397.808] (-395.890) (-396.487) (-396.306) -- 0:00:09
      845000 -- (-398.208) (-397.574) [-398.367] (-397.772) * (-397.887) (-394.368) [-394.684] (-395.447) -- 0:00:09

      Average standard deviation of split frequencies: 0.006761

      845500 -- (-399.938) (-395.868) (-399.988) [-394.464] * [-394.431] (-398.532) (-399.111) (-394.784) -- 0:00:09
      846000 -- (-399.317) [-395.488] (-396.830) (-394.516) * (-396.882) (-394.727) [-397.686] (-394.159) -- 0:00:09
      846500 -- (-395.939) [-395.675] (-398.321) (-395.786) * (-397.373) (-395.851) [-399.147] (-395.991) -- 0:00:09
      847000 -- (-394.522) (-395.663) (-400.612) [-395.774] * [-395.981] (-395.795) (-401.406) (-396.976) -- 0:00:09
      847500 -- (-397.619) (-396.318) (-398.600) [-397.319] * (-395.963) [-395.349] (-395.446) (-396.699) -- 0:00:09
      848000 -- [-394.198] (-397.684) (-396.511) (-395.382) * (-396.311) [-394.922] (-397.383) (-396.565) -- 0:00:09
      848500 -- [-394.792] (-396.537) (-396.840) (-394.879) * (-394.684) [-397.382] (-395.453) (-395.089) -- 0:00:09
      849000 -- (-395.228) (-396.180) [-397.434] (-399.968) * (-397.352) [-394.661] (-401.178) (-395.290) -- 0:00:09
      849500 -- (-394.853) [-397.142] (-398.983) (-394.425) * (-396.921) [-396.927] (-399.475) (-397.043) -- 0:00:09
      850000 -- (-396.521) [-395.729] (-398.042) (-395.598) * [-395.791] (-394.706) (-396.345) (-394.882) -- 0:00:09

      Average standard deviation of split frequencies: 0.007093

      850500 -- (-395.526) [-395.791] (-396.483) (-397.186) * (-395.591) (-395.175) (-395.415) [-398.245] -- 0:00:09
      851000 -- (-395.067) [-395.444] (-397.968) (-397.240) * [-396.108] (-395.445) (-396.767) (-396.192) -- 0:00:09
      851500 -- (-394.384) (-395.597) (-395.717) [-397.037] * (-399.397) [-395.584] (-395.373) (-394.353) -- 0:00:09
      852000 -- (-398.043) (-396.134) [-396.202] (-395.868) * (-398.692) (-395.370) [-394.537] (-394.776) -- 0:00:09
      852500 -- (-396.219) (-395.922) (-395.463) [-394.738] * (-395.642) (-398.519) (-400.960) [-395.796] -- 0:00:08
      853000 -- (-398.667) [-395.672] (-396.785) (-399.078) * (-395.957) (-396.152) [-395.494] (-395.579) -- 0:00:08
      853500 -- [-399.683] (-395.955) (-398.256) (-397.228) * (-395.622) [-396.691] (-399.755) (-397.851) -- 0:00:08
      854000 -- [-395.034] (-394.618) (-395.023) (-398.041) * (-396.779) (-394.947) (-397.095) [-398.660] -- 0:00:08
      854500 -- [-395.229] (-396.617) (-398.852) (-402.193) * (-395.126) (-397.215) (-394.575) [-398.327] -- 0:00:08
      855000 -- (-394.848) (-395.654) (-397.343) [-398.029] * (-396.876) (-397.518) (-398.231) [-395.047] -- 0:00:08

      Average standard deviation of split frequencies: 0.006865

      855500 -- [-396.848] (-395.649) (-398.824) (-397.629) * (-395.509) [-396.252] (-400.676) (-397.993) -- 0:00:08
      856000 -- (-396.957) (-395.916) [-399.136] (-396.104) * (-395.424) [-396.190] (-402.316) (-403.341) -- 0:00:08
      856500 -- (-399.417) [-394.518] (-395.892) (-399.613) * (-395.553) (-395.147) (-398.761) [-396.319] -- 0:00:08
      857000 -- (-397.614) (-396.491) (-398.225) [-395.813] * (-396.504) [-395.646] (-395.609) (-395.657) -- 0:00:08
      857500 -- (-395.498) (-395.626) (-394.930) [-396.443] * (-396.298) (-397.546) [-399.329] (-397.638) -- 0:00:08
      858000 -- (-394.385) [-395.016] (-396.586) (-396.153) * (-394.619) [-396.562] (-399.492) (-402.537) -- 0:00:08
      858500 -- (-397.544) (-395.130) [-395.513] (-395.273) * (-396.318) (-399.055) (-395.834) [-394.847] -- 0:00:08
      859000 -- [-395.475] (-397.321) (-398.623) (-398.938) * (-395.412) (-398.093) (-396.382) [-397.318] -- 0:00:08
      859500 -- [-395.140] (-395.492) (-395.075) (-400.072) * (-397.933) [-399.257] (-398.246) (-398.909) -- 0:00:08
      860000 -- (-397.342) (-395.001) [-395.122] (-397.515) * (-395.544) (-400.764) [-395.234] (-395.286) -- 0:00:08

      Average standard deviation of split frequencies: 0.006682

      860500 -- (-397.698) (-396.534) [-396.289] (-396.924) * (-394.935) (-397.150) [-394.714] (-395.991) -- 0:00:08
      861000 -- (-396.317) [-396.803] (-394.692) (-395.387) * (-396.760) (-396.393) (-396.314) [-396.449] -- 0:00:08
      861500 -- (-397.057) [-396.929] (-396.583) (-394.257) * (-401.639) [-395.479] (-394.879) (-398.665) -- 0:00:08
      862000 -- (-396.131) [-395.552] (-399.310) (-395.610) * (-396.087) (-398.250) [-396.418] (-396.151) -- 0:00:08
      862500 -- [-395.195] (-395.462) (-395.180) (-397.661) * [-400.566] (-397.922) (-398.169) (-396.229) -- 0:00:08
      863000 -- (-395.022) (-398.521) (-397.980) [-394.794] * [-397.517] (-397.159) (-398.288) (-395.713) -- 0:00:08
      863500 -- (-394.951) (-398.897) [-398.998] (-396.468) * [-395.053] (-396.084) (-395.977) (-395.417) -- 0:00:08
      864000 -- (-394.912) (-395.078) (-396.066) [-394.693] * (-395.407) [-398.557] (-398.031) (-398.152) -- 0:00:08
      864500 -- (-394.843) (-396.145) (-398.644) [-396.250] * [-396.621] (-396.328) (-398.972) (-396.740) -- 0:00:08
      865000 -- (-395.800) (-394.525) (-396.872) [-394.115] * (-397.084) (-394.846) [-397.333] (-395.522) -- 0:00:08

      Average standard deviation of split frequencies: 0.006351

      865500 -- (-396.456) (-394.457) [-397.709] (-394.198) * [-397.058] (-395.258) (-394.405) (-396.475) -- 0:00:08
      866000 -- (-394.532) (-398.444) (-401.125) [-395.235] * [-396.648] (-395.616) (-398.196) (-395.633) -- 0:00:08
      866500 -- (-395.519) (-396.671) [-397.403] (-395.658) * [-396.136] (-394.606) (-400.194) (-396.936) -- 0:00:08
      867000 -- (-402.281) [-397.188] (-394.398) (-399.923) * (-395.850) (-396.951) (-394.891) [-397.037] -- 0:00:08
      867500 -- (-397.350) (-394.803) [-395.392] (-398.242) * (-398.148) (-394.725) [-395.397] (-395.363) -- 0:00:08
      868000 -- (-395.552) (-398.252) [-395.159] (-395.959) * [-395.010] (-396.332) (-396.659) (-398.026) -- 0:00:08
      868500 -- [-394.760] (-395.667) (-395.339) (-398.310) * (-397.025) (-395.065) [-396.665] (-396.503) -- 0:00:08
      869000 -- [-396.725] (-394.476) (-395.596) (-396.164) * (-394.347) (-396.369) [-396.700] (-395.763) -- 0:00:07
      869500 -- (-395.937) (-395.170) [-396.585] (-396.069) * (-398.479) (-398.899) (-397.717) [-396.802] -- 0:00:07
      870000 -- [-396.327] (-396.038) (-396.150) (-394.195) * [-394.526] (-399.293) (-396.752) (-395.156) -- 0:00:07

      Average standard deviation of split frequencies: 0.006425

      870500 -- (-394.992) [-396.006] (-395.853) (-394.298) * [-396.292] (-397.287) (-395.799) (-396.016) -- 0:00:07
      871000 -- (-396.971) [-395.770] (-398.506) (-395.327) * (-396.124) (-396.166) (-397.815) [-396.172] -- 0:00:07
      871500 -- [-395.797] (-395.818) (-394.152) (-401.583) * (-398.084) (-394.946) [-397.303] (-397.698) -- 0:00:07
      872000 -- (-398.150) [-398.441] (-394.513) (-396.375) * (-399.521) [-395.186] (-395.044) (-398.372) -- 0:00:07
      872500 -- [-397.170] (-397.312) (-394.085) (-398.623) * (-398.546) (-396.007) (-395.552) [-399.467] -- 0:00:07
      873000 -- (-399.521) (-400.156) [-395.820] (-398.939) * (-396.164) (-404.466) [-395.922] (-400.888) -- 0:00:07
      873500 -- (-395.094) (-397.897) (-395.559) [-395.757] * (-395.133) (-399.071) [-397.285] (-401.277) -- 0:00:07
      874000 -- (-394.870) (-397.565) [-396.269] (-399.988) * [-394.580] (-398.988) (-395.362) (-403.113) -- 0:00:07
      874500 -- (-398.424) (-394.773) (-400.238) [-397.182] * (-395.576) (-397.624) (-396.735) [-394.537] -- 0:00:07
      875000 -- (-395.675) [-397.892] (-395.923) (-397.914) * (-396.620) (-399.264) (-396.908) [-395.316] -- 0:00:07

      Average standard deviation of split frequencies: 0.006673

      875500 -- [-396.116] (-395.727) (-400.142) (-397.691) * [-396.885] (-397.895) (-396.598) (-400.940) -- 0:00:07
      876000 -- [-395.775] (-400.834) (-396.296) (-396.449) * (-396.233) (-397.700) (-395.667) [-397.201] -- 0:00:07
      876500 -- [-399.996] (-394.835) (-395.477) (-396.578) * (-395.260) [-395.840] (-394.862) (-395.358) -- 0:00:07
      877000 -- (-398.255) (-395.751) [-396.212] (-395.308) * (-395.559) [-394.805] (-394.629) (-394.139) -- 0:00:07
      877500 -- (-398.350) (-399.968) [-397.518] (-396.298) * (-399.011) (-394.879) (-397.661) [-395.660] -- 0:00:07
      878000 -- [-394.950] (-394.977) (-394.854) (-395.419) * (-396.915) [-395.758] (-400.252) (-396.474) -- 0:00:07
      878500 -- (-402.507) [-394.310] (-394.419) (-396.736) * (-396.486) (-396.074) [-395.704] (-397.586) -- 0:00:07
      879000 -- (-395.654) (-403.884) [-394.203] (-396.093) * [-397.228] (-397.974) (-400.064) (-395.908) -- 0:00:07
      879500 -- (-396.218) [-399.289] (-395.196) (-394.764) * (-394.979) (-397.489) (-397.434) [-394.656] -- 0:00:07
      880000 -- (-394.191) (-400.982) [-397.562] (-395.814) * (-396.188) [-396.830] (-397.095) (-396.685) -- 0:00:07

      Average standard deviation of split frequencies: 0.006816

      880500 -- [-394.192] (-395.711) (-396.027) (-397.890) * (-398.517) (-396.853) [-395.288] (-397.260) -- 0:00:07
      881000 -- (-396.134) [-399.496] (-394.657) (-396.567) * (-396.156) (-399.262) (-396.655) [-396.168] -- 0:00:07
      881500 -- (-394.157) (-396.792) (-396.758) [-397.699] * (-396.373) (-397.992) (-398.401) [-398.970] -- 0:00:07
      882000 -- (-394.238) (-394.960) [-394.936] (-396.661) * [-396.823] (-397.559) (-398.330) (-395.415) -- 0:00:07
      882500 -- (-394.214) [-395.914] (-399.748) (-399.888) * (-395.429) (-397.607) [-395.359] (-394.907) -- 0:00:07
      883000 -- (-401.299) (-394.495) (-395.195) [-394.943] * (-396.580) (-395.263) (-395.133) [-394.888] -- 0:00:07
      883500 -- (-402.406) [-397.198] (-395.167) (-396.824) * [-396.849] (-395.609) (-396.991) (-398.471) -- 0:00:07
      884000 -- (-400.564) (-398.809) [-395.282] (-399.140) * (-395.816) (-395.453) (-399.150) [-395.288] -- 0:00:07
      884500 -- (-398.485) (-398.776) [-395.613] (-395.606) * (-395.948) (-395.573) (-398.419) [-395.473] -- 0:00:07
      885000 -- (-397.641) (-400.382) [-399.657] (-398.041) * (-396.501) (-399.219) (-397.928) [-396.023] -- 0:00:07

      Average standard deviation of split frequencies: 0.006704

      885500 -- (-397.864) (-398.343) [-396.912] (-394.433) * (-400.455) (-397.934) (-397.190) [-397.302] -- 0:00:06
      886000 -- (-397.909) [-394.589] (-394.927) (-398.281) * (-400.560) (-398.489) (-394.942) [-397.536] -- 0:00:06
      886500 -- [-395.666] (-395.482) (-395.790) (-398.561) * (-398.535) (-396.389) [-395.703] (-395.586) -- 0:00:06
      887000 -- (-395.738) (-397.507) (-395.286) [-397.014] * (-396.735) (-398.022) [-395.634] (-394.992) -- 0:00:06
      887500 -- (-395.851) [-396.326] (-397.030) (-405.393) * (-399.630) (-405.533) [-395.744] (-397.836) -- 0:00:06
      888000 -- (-397.553) [-395.109] (-395.038) (-396.514) * (-399.671) [-400.620] (-395.411) (-394.815) -- 0:00:06
      888500 -- [-394.808] (-396.008) (-396.844) (-399.796) * (-401.725) [-399.668] (-395.862) (-398.302) -- 0:00:06
      889000 -- (-397.402) (-396.637) [-394.868] (-397.922) * [-394.798] (-397.859) (-402.240) (-397.463) -- 0:00:06
      889500 -- (-398.930) (-396.955) (-397.685) [-395.138] * (-396.021) [-400.469] (-399.736) (-394.361) -- 0:00:06
      890000 -- (-395.652) (-396.247) (-395.493) [-398.772] * (-394.791) (-398.039) (-395.163) [-396.366] -- 0:00:06

      Average standard deviation of split frequencies: 0.006739

      890500 -- [-398.302] (-396.720) (-395.683) (-401.086) * (-395.535) (-400.353) (-397.531) [-394.928] -- 0:00:06
      891000 -- [-395.722] (-400.551) (-394.882) (-395.137) * (-397.713) (-396.911) [-397.426] (-400.746) -- 0:00:06
      891500 -- [-395.782] (-397.097) (-396.854) (-395.416) * [-395.340] (-395.370) (-397.045) (-396.642) -- 0:00:06
      892000 -- (-399.621) [-396.077] (-399.485) (-397.342) * [-399.072] (-396.836) (-400.191) (-394.336) -- 0:00:06
      892500 -- (-401.664) (-395.400) (-397.528) [-398.537] * (-398.410) (-397.738) (-395.913) [-397.402] -- 0:00:06
      893000 -- (-399.950) (-397.045) (-400.034) [-397.908] * (-396.936) (-397.828) [-394.491] (-395.557) -- 0:00:06
      893500 -- [-395.978] (-396.951) (-394.755) (-396.972) * (-394.717) (-395.906) (-395.542) [-396.097] -- 0:00:06
      894000 -- [-396.068] (-396.799) (-401.821) (-396.069) * (-399.152) (-398.402) (-399.002) [-398.021] -- 0:00:06
      894500 -- (-394.375) (-396.982) [-397.964] (-395.237) * (-395.704) (-399.521) [-396.422] (-398.624) -- 0:00:06
      895000 -- [-396.252] (-397.953) (-394.390) (-397.098) * (-395.389) (-396.676) [-398.357] (-398.869) -- 0:00:06

      Average standard deviation of split frequencies: 0.006840

      895500 -- (-398.583) [-396.014] (-395.871) (-397.504) * [-397.523] (-394.611) (-396.084) (-396.551) -- 0:00:06
      896000 -- (-395.408) (-396.415) (-400.165) [-400.705] * (-394.789) (-394.459) [-396.745] (-394.853) -- 0:00:06
      896500 -- (-396.343) (-395.930) [-396.631] (-400.930) * [-394.557] (-395.683) (-396.238) (-396.804) -- 0:00:06
      897000 -- [-396.577] (-398.848) (-396.852) (-397.775) * (-397.569) [-399.982] (-395.558) (-397.780) -- 0:00:06
      897500 -- [-396.312] (-395.267) (-394.982) (-396.626) * [-395.407] (-394.571) (-400.056) (-397.394) -- 0:00:06
      898000 -- (-395.998) [-394.761] (-395.541) (-398.316) * [-396.417] (-394.514) (-397.011) (-395.372) -- 0:00:06
      898500 -- [-395.493] (-395.668) (-397.708) (-394.632) * (-395.163) (-396.346) [-398.212] (-395.701) -- 0:00:06
      899000 -- (-395.854) [-394.846] (-397.685) (-396.021) * (-394.613) (-399.480) [-399.029] (-398.765) -- 0:00:06
      899500 -- (-394.517) (-396.393) [-396.509] (-396.944) * [-395.565] (-395.748) (-397.623) (-400.251) -- 0:00:06
      900000 -- [-395.490] (-398.847) (-396.847) (-394.126) * (-398.237) (-396.647) (-400.280) [-397.687] -- 0:00:06

      Average standard deviation of split frequencies: 0.006525

      900500 -- [-397.319] (-398.373) (-397.524) (-395.246) * (-397.861) (-394.956) (-398.063) [-394.474] -- 0:00:06
      901000 -- [-396.311] (-396.822) (-394.994) (-396.010) * (-398.952) [-395.559] (-395.449) (-395.375) -- 0:00:06
      901500 -- (-398.052) [-395.214] (-396.981) (-397.740) * [-395.531] (-398.228) (-397.303) (-397.794) -- 0:00:06
      902000 -- (-402.064) [-395.202] (-395.060) (-397.619) * (-396.805) (-396.136) (-396.112) [-398.595] -- 0:00:05
      902500 -- (-401.578) (-399.351) (-394.673) [-395.777] * (-396.965) [-396.542] (-395.929) (-398.153) -- 0:00:05
      903000 -- (-396.373) [-398.478] (-395.697) (-397.291) * (-395.846) (-398.374) (-396.501) [-396.757] -- 0:00:05
      903500 -- (-397.569) [-397.967] (-394.843) (-401.704) * (-395.092) [-396.585] (-396.691) (-396.760) -- 0:00:05
      904000 -- [-395.442] (-394.445) (-395.289) (-395.328) * (-396.457) (-395.056) (-394.443) [-396.301] -- 0:00:05
      904500 -- (-397.576) (-396.293) [-395.678] (-394.667) * (-397.824) (-397.475) (-397.521) [-395.904] -- 0:00:05
      905000 -- (-394.655) (-396.864) (-394.836) [-397.127] * [-397.472] (-397.618) (-397.893) (-397.110) -- 0:00:05

      Average standard deviation of split frequencies: 0.006001

      905500 -- [-396.895] (-397.543) (-396.336) (-395.962) * (-399.452) (-398.520) (-396.079) [-394.414] -- 0:00:05
      906000 -- (-395.109) (-395.662) (-394.571) [-396.688] * (-400.239) [-397.209] (-398.029) (-394.462) -- 0:00:05
      906500 -- (-399.206) [-394.856] (-398.512) (-394.669) * (-394.893) (-400.373) (-396.504) [-396.381] -- 0:00:05
      907000 -- [-395.103] (-397.130) (-396.694) (-395.142) * (-395.482) (-395.051) [-395.176] (-396.983) -- 0:00:05
      907500 -- (-395.949) (-400.408) (-397.440) [-395.816] * (-397.027) (-395.320) [-395.045] (-404.663) -- 0:00:05
      908000 -- (-396.297) (-396.720) [-395.352] (-395.831) * (-400.001) (-395.705) (-398.824) [-397.758] -- 0:00:05
      908500 -- (-395.666) (-396.674) [-396.514] (-400.444) * (-403.150) [-395.426] (-396.811) (-399.643) -- 0:00:05
      909000 -- [-394.901] (-395.666) (-395.876) (-398.534) * (-398.368) (-398.322) (-398.794) [-395.838] -- 0:00:05
      909500 -- (-398.612) (-394.871) [-395.401] (-396.235) * (-397.177) (-397.219) [-396.066] (-397.543) -- 0:00:05
      910000 -- (-395.418) (-396.127) (-397.614) [-396.693] * (-398.145) (-397.465) (-396.797) [-396.515] -- 0:00:05

      Average standard deviation of split frequencies: 0.006005

      910500 -- [-394.363] (-394.704) (-397.810) (-394.663) * (-397.562) (-397.902) [-397.275] (-396.467) -- 0:00:05
      911000 -- (-396.069) (-397.357) [-395.110] (-402.248) * (-396.537) (-397.243) (-398.382) [-395.950] -- 0:00:05
      911500 -- (-402.432) (-394.532) [-395.515] (-400.570) * (-396.372) [-397.094] (-395.106) (-396.831) -- 0:00:05
      912000 -- (-397.465) [-395.810] (-394.713) (-396.244) * (-396.069) (-401.190) [-400.104] (-396.094) -- 0:00:05
      912500 -- (-397.243) (-395.679) [-395.161] (-395.770) * (-394.220) (-395.978) (-396.563) [-394.900] -- 0:00:05
      913000 -- (-399.765) (-397.045) [-396.203] (-398.031) * (-395.761) (-394.298) (-396.911) [-395.211] -- 0:00:05
      913500 -- (-400.156) (-399.168) (-396.514) [-396.537] * (-398.235) [-394.939] (-396.924) (-395.168) -- 0:00:05
      914000 -- (-400.643) [-396.988] (-396.945) (-395.640) * (-395.108) (-400.461) [-395.216] (-396.082) -- 0:00:05
      914500 -- (-402.624) (-394.944) (-398.623) [-396.941] * (-395.651) (-397.117) (-395.800) [-396.722] -- 0:00:05
      915000 -- [-397.678] (-396.259) (-396.147) (-399.349) * [-395.955] (-397.679) (-395.088) (-395.754) -- 0:00:05

      Average standard deviation of split frequencies: 0.005833

      915500 -- (-395.164) (-394.389) (-395.857) [-396.516] * [-395.459] (-397.463) (-399.629) (-395.232) -- 0:00:05
      916000 -- (-396.166) [-395.218] (-395.684) (-398.608) * [-394.720] (-398.520) (-397.496) (-395.617) -- 0:00:05
      916500 -- (-395.570) [-396.916] (-395.226) (-395.461) * [-395.737] (-395.531) (-397.428) (-395.288) -- 0:00:05
      917000 -- [-395.434] (-395.565) (-395.711) (-395.479) * (-395.506) [-397.011] (-398.737) (-397.597) -- 0:00:05
      917500 -- (-395.398) [-397.196] (-396.036) (-398.490) * (-399.216) (-399.237) [-395.824] (-404.869) -- 0:00:05
      918000 -- (-394.212) (-398.327) (-394.906) [-396.744] * [-399.847] (-396.639) (-396.623) (-403.616) -- 0:00:05
      918500 -- (-394.212) (-399.585) (-396.884) [-396.545] * (-397.731) [-395.985] (-397.000) (-402.301) -- 0:00:04
      919000 -- (-394.798) (-397.390) [-395.078] (-395.772) * (-396.717) (-396.231) (-394.342) [-395.198] -- 0:00:04
      919500 -- (-400.119) [-400.180] (-394.958) (-395.168) * (-396.609) [-397.814] (-394.740) (-396.375) -- 0:00:04
      920000 -- (-396.638) (-396.462) [-395.065] (-397.134) * (-398.015) (-396.662) [-395.323] (-397.978) -- 0:00:04

      Average standard deviation of split frequencies: 0.006247

      920500 -- (-399.394) (-395.119) (-394.940) [-398.454] * (-395.219) (-396.342) (-396.075) [-395.762] -- 0:00:04
      921000 -- [-399.799] (-396.767) (-396.129) (-399.425) * (-396.685) (-396.583) (-397.801) [-396.491] -- 0:00:04
      921500 -- [-395.656] (-399.844) (-396.166) (-394.540) * (-399.748) [-395.475] (-399.701) (-401.160) -- 0:00:04
      922000 -- [-394.493] (-397.380) (-396.312) (-396.357) * (-395.843) (-394.960) [-396.141] (-399.200) -- 0:00:04
      922500 -- [-397.800] (-401.192) (-394.838) (-397.174) * (-395.793) (-397.150) [-396.947] (-400.265) -- 0:00:04
      923000 -- [-394.867] (-399.457) (-399.224) (-400.758) * (-397.068) (-394.763) [-395.543] (-399.620) -- 0:00:04
      923500 -- [-398.122] (-399.172) (-399.731) (-397.584) * [-397.613] (-399.262) (-397.008) (-396.737) -- 0:00:04
      924000 -- (-398.916) (-398.249) (-396.210) [-395.306] * (-397.349) (-397.244) [-395.225] (-399.076) -- 0:00:04
      924500 -- (-395.785) (-394.440) (-394.986) [-398.435] * (-396.840) (-395.104) [-394.528] (-399.109) -- 0:00:04
      925000 -- (-397.252) [-397.135] (-394.315) (-396.344) * [-395.128] (-394.502) (-395.761) (-400.032) -- 0:00:04

      Average standard deviation of split frequencies: 0.006313

      925500 -- (-396.002) [-396.920] (-395.048) (-394.585) * (-396.647) [-396.620] (-398.135) (-399.356) -- 0:00:04
      926000 -- (-400.623) [-398.398] (-395.001) (-397.022) * (-395.894) (-396.029) [-396.591] (-397.782) -- 0:00:04
      926500 -- (-395.044) (-394.588) (-395.118) [-394.271] * (-395.070) (-397.077) (-394.546) [-395.160] -- 0:00:04
      927000 -- (-394.960) (-394.263) (-395.868) [-394.738] * [-395.121] (-398.889) (-396.409) (-395.150) -- 0:00:04
      927500 -- [-395.758] (-396.352) (-395.551) (-400.246) * [-395.202] (-395.204) (-398.370) (-394.270) -- 0:00:04
      928000 -- (-395.701) (-394.967) [-394.233] (-398.020) * (-396.764) (-398.413) (-400.031) [-395.942] -- 0:00:04
      928500 -- (-394.540) [-396.646] (-394.450) (-397.910) * (-396.137) (-394.646) (-397.902) [-396.657] -- 0:00:04
      929000 -- (-396.717) (-397.694) [-395.822] (-396.922) * [-396.571] (-396.464) (-398.681) (-395.779) -- 0:00:04
      929500 -- (-396.111) (-394.948) [-396.754] (-395.714) * (-397.087) [-395.745] (-396.740) (-395.713) -- 0:00:04
      930000 -- (-395.145) (-396.567) [-395.619] (-399.175) * (-396.323) [-395.885] (-399.976) (-398.142) -- 0:00:04

      Average standard deviation of split frequencies: 0.005876

      930500 -- (-398.209) (-395.744) [-396.292] (-397.105) * [-397.034] (-395.661) (-396.134) (-398.587) -- 0:00:04
      931000 -- (-394.539) (-396.433) (-396.554) [-396.658] * (-395.587) (-396.472) (-397.959) [-396.548] -- 0:00:04
      931500 -- (-395.549) [-395.743] (-398.013) (-395.231) * (-399.333) (-395.029) [-396.887] (-396.446) -- 0:00:04
      932000 -- (-395.600) (-395.547) [-395.238] (-400.348) * (-397.503) (-394.639) [-395.579] (-397.559) -- 0:00:04
      932500 -- (-394.475) (-397.858) [-394.551] (-399.371) * [-396.299] (-396.706) (-399.268) (-398.254) -- 0:00:04
      933000 -- (-397.144) (-396.722) (-394.818) [-397.664] * (-395.323) [-395.991] (-399.435) (-395.929) -- 0:00:04
      933500 -- (-396.894) (-399.702) (-395.058) [-397.193] * (-395.207) (-399.905) [-402.992] (-397.527) -- 0:00:04
      934000 -- (-395.571) (-400.330) (-397.106) [-396.903] * (-395.982) [-395.742] (-398.042) (-395.990) -- 0:00:04
      934500 -- (-397.146) (-401.458) (-397.748) [-394.795] * (-395.790) [-397.036] (-396.408) (-397.642) -- 0:00:03
      935000 -- (-396.631) (-395.650) [-398.410] (-394.156) * (-404.893) (-395.342) (-395.571) [-397.798] -- 0:00:03

      Average standard deviation of split frequencies: 0.005775

      935500 -- (-397.409) (-396.782) (-398.178) [-394.332] * (-402.195) (-400.718) (-395.499) [-396.014] -- 0:00:03
      936000 -- (-395.410) (-398.180) [-396.534] (-397.233) * (-397.574) (-396.434) (-395.772) [-395.297] -- 0:00:03
      936500 -- (-394.108) (-394.980) [-395.982] (-400.062) * (-396.943) (-396.068) [-395.305] (-399.357) -- 0:00:03
      937000 -- (-394.146) (-395.461) [-395.470] (-395.990) * (-394.604) (-398.109) [-394.808] (-398.398) -- 0:00:03
      937500 -- [-395.413] (-399.229) (-394.736) (-396.913) * (-396.944) (-395.135) [-395.674] (-398.376) -- 0:00:03
      938000 -- (-396.874) (-394.604) (-394.872) [-397.893] * (-395.778) (-395.068) [-396.341] (-397.340) -- 0:00:03
      938500 -- [-394.752] (-398.789) (-395.414) (-395.327) * [-396.510] (-395.008) (-395.514) (-398.210) -- 0:00:03
      939000 -- (-400.364) [-396.493] (-397.687) (-397.855) * (-395.544) [-395.186] (-396.384) (-396.712) -- 0:00:03
      939500 -- (-397.915) (-398.531) (-394.363) [-394.703] * [-401.088] (-395.314) (-396.025) (-396.197) -- 0:00:03
      940000 -- [-394.721] (-395.256) (-397.354) (-397.275) * [-395.899] (-395.301) (-394.999) (-396.121) -- 0:00:03

      Average standard deviation of split frequencies: 0.005446

      940500 -- (-394.788) (-395.190) [-402.876] (-397.938) * (-397.703) (-394.703) [-394.963] (-395.622) -- 0:00:03
      941000 -- (-398.092) [-395.443] (-398.430) (-393.991) * [-395.142] (-396.216) (-397.413) (-400.450) -- 0:00:03
      941500 -- (-397.252) (-397.007) (-398.655) [-393.982] * (-397.831) [-397.037] (-397.218) (-394.888) -- 0:00:03
      942000 -- (-394.660) (-394.739) [-395.157] (-394.550) * (-400.815) [-396.130] (-396.158) (-395.151) -- 0:00:03
      942500 -- (-395.309) (-394.786) (-394.819) [-396.884] * [-398.016] (-394.477) (-398.392) (-396.730) -- 0:00:03
      943000 -- (-397.800) (-395.910) [-398.857] (-398.078) * (-399.574) (-397.261) (-395.378) [-398.510] -- 0:00:03
      943500 -- (-399.385) (-395.325) (-398.513) [-394.603] * [-394.910] (-396.623) (-395.639) (-396.248) -- 0:00:03
      944000 -- (-399.246) [-398.611] (-395.032) (-395.764) * (-396.012) (-396.073) (-399.510) [-395.446] -- 0:00:03
      944500 -- [-396.071] (-400.626) (-395.842) (-395.301) * [-397.116] (-394.811) (-397.540) (-397.011) -- 0:00:03
      945000 -- (-396.579) [-396.096] (-398.273) (-396.048) * [-395.740] (-399.920) (-396.774) (-398.216) -- 0:00:03

      Average standard deviation of split frequencies: 0.005747

      945500 -- (-395.846) (-396.515) (-396.212) [-397.097] * [-395.645] (-398.365) (-397.219) (-395.873) -- 0:00:03
      946000 -- (-397.614) [-395.552] (-395.747) (-397.940) * (-397.055) (-396.473) (-394.871) [-398.649] -- 0:00:03
      946500 -- (-395.093) [-397.833] (-400.450) (-396.050) * (-397.441) (-399.508) [-394.940] (-395.518) -- 0:00:03
      947000 -- (-395.371) (-399.316) [-396.122] (-396.822) * (-396.149) (-396.667) (-395.154) [-395.526] -- 0:00:03
      947500 -- [-398.192] (-398.198) (-395.028) (-394.461) * [-395.717] (-396.161) (-397.710) (-398.720) -- 0:00:03
      948000 -- (-397.403) (-398.609) (-394.785) [-400.601] * (-400.385) (-399.723) [-395.837] (-400.633) -- 0:00:03
      948500 -- (-399.555) (-396.711) (-395.151) [-396.452] * (-396.160) [-396.569] (-395.701) (-398.398) -- 0:00:03
      949000 -- (-396.719) (-395.570) (-396.547) [-394.157] * (-394.935) (-397.477) (-397.234) [-396.519] -- 0:00:03
      949500 -- (-395.134) (-395.498) (-395.647) [-393.996] * (-396.632) (-397.451) (-397.782) [-396.014] -- 0:00:03
      950000 -- [-396.394] (-395.072) (-396.020) (-395.815) * (-396.641) (-403.500) (-395.875) [-398.279] -- 0:00:03

      Average standard deviation of split frequencies: 0.005950

      950500 -- (-396.576) (-400.102) [-395.300] (-395.692) * (-397.863) [-395.296] (-397.709) (-398.887) -- 0:00:03
      951000 -- (-395.194) (-394.589) [-394.472] (-395.617) * (-398.704) [-395.231] (-396.997) (-395.264) -- 0:00:02
      951500 -- [-395.170] (-395.928) (-399.498) (-396.739) * (-396.156) (-395.780) [-398.296] (-394.696) -- 0:00:02
      952000 -- (-395.248) [-398.112] (-398.227) (-395.577) * [-396.723] (-395.924) (-399.413) (-397.668) -- 0:00:02
      952500 -- (-398.480) [-395.538] (-396.405) (-394.980) * [-395.098] (-395.807) (-396.433) (-399.259) -- 0:00:02
      953000 -- (-398.166) [-395.206] (-397.182) (-396.010) * (-396.468) (-396.867) [-396.684] (-399.460) -- 0:00:02
      953500 -- (-397.839) (-395.398) [-398.313] (-395.369) * (-398.418) (-396.608) [-398.977] (-398.525) -- 0:00:02
      954000 -- [-400.127] (-396.916) (-396.447) (-396.599) * (-396.130) (-400.053) [-395.417] (-395.854) -- 0:00:02
      954500 -- (-397.424) (-396.501) [-396.745] (-395.683) * (-396.168) (-398.941) (-394.958) [-397.088] -- 0:00:02
      955000 -- [-394.505] (-395.036) (-395.033) (-399.603) * (-395.546) (-398.706) [-398.426] (-396.809) -- 0:00:02

      Average standard deviation of split frequencies: 0.005753

      955500 -- (-395.684) (-395.384) [-395.569] (-396.317) * (-395.529) (-397.318) [-396.411] (-396.604) -- 0:00:02
      956000 -- (-394.957) [-397.313] (-398.340) (-396.769) * (-397.247) (-396.745) [-395.518] (-396.489) -- 0:00:02
      956500 -- (-395.076) (-396.321) (-402.155) [-394.528] * (-395.789) (-401.627) (-397.111) [-395.830] -- 0:00:02
      957000 -- (-400.663) (-395.752) [-397.637] (-399.886) * (-395.594) (-397.065) (-396.431) [-395.769] -- 0:00:02
      957500 -- (-397.415) (-397.399) [-398.412] (-397.509) * (-397.689) [-396.346] (-403.674) (-397.826) -- 0:00:02
      958000 -- [-397.280] (-398.296) (-399.315) (-394.785) * [-396.355] (-395.559) (-400.417) (-395.892) -- 0:00:02
      958500 -- (-397.459) (-399.081) (-396.333) [-394.595] * (-395.904) (-394.451) [-396.098] (-396.454) -- 0:00:02
      959000 -- (-396.524) (-397.568) (-396.171) [-395.295] * (-398.579) (-394.608) [-394.385] (-395.162) -- 0:00:02
      959500 -- (-395.151) [-395.096] (-400.849) (-397.258) * (-396.963) (-395.682) (-397.999) [-395.121] -- 0:00:02
      960000 -- (-395.041) (-394.430) (-396.098) [-394.535] * (-394.162) [-395.347] (-399.482) (-396.187) -- 0:00:02

      Average standard deviation of split frequencies: 0.006019

      960500 -- (-397.808) [-396.928] (-400.440) (-396.927) * (-396.692) [-396.520] (-397.951) (-395.560) -- 0:00:02
      961000 -- [-395.579] (-394.335) (-397.564) (-398.814) * (-397.003) [-394.501] (-398.131) (-394.368) -- 0:00:02
      961500 -- (-397.538) [-397.574] (-395.845) (-397.582) * [-395.902] (-394.660) (-398.699) (-403.910) -- 0:00:02
      962000 -- (-396.034) (-395.992) [-397.656] (-394.536) * [-397.149] (-395.054) (-395.504) (-394.309) -- 0:00:02
      962500 -- (-395.725) (-398.973) [-395.936] (-395.511) * (-396.995) (-394.635) (-396.752) [-394.828] -- 0:00:02
      963000 -- (-398.755) (-394.827) (-396.933) [-397.993] * (-395.880) [-394.426] (-395.768) (-395.186) -- 0:00:02
      963500 -- (-399.685) (-397.492) [-396.568] (-394.902) * (-394.232) (-394.294) (-399.310) [-396.215] -- 0:00:02
      964000 -- [-397.296] (-402.869) (-395.007) (-397.886) * [-395.254] (-395.629) (-395.738) (-397.379) -- 0:00:02
      964500 -- (-396.177) (-399.132) (-396.192) [-396.125] * [-398.631] (-396.931) (-397.388) (-398.146) -- 0:00:02
      965000 -- (-395.958) (-397.157) [-396.903] (-397.700) * (-396.783) (-395.486) (-396.007) [-397.227] -- 0:00:02

      Average standard deviation of split frequencies: 0.006181

      965500 -- (-400.887) [-397.531] (-397.588) (-395.116) * [-394.112] (-395.472) (-401.989) (-396.668) -- 0:00:02
      966000 -- (-398.765) [-396.049] (-394.904) (-394.106) * [-396.903] (-396.391) (-399.767) (-397.374) -- 0:00:02
      966500 -- (-398.096) [-401.810] (-399.631) (-394.157) * (-396.350) [-396.493] (-397.944) (-397.641) -- 0:00:02
      967000 -- (-396.164) [-396.956] (-397.438) (-395.503) * (-396.570) [-394.785] (-399.315) (-395.816) -- 0:00:02
      967500 -- (-395.680) (-398.183) (-400.698) [-394.683] * (-395.905) [-395.870] (-402.046) (-401.348) -- 0:00:01
      968000 -- (-397.765) (-398.199) (-396.846) [-394.842] * (-397.846) (-396.668) (-401.280) [-396.013] -- 0:00:01
      968500 -- (-396.077) [-397.625] (-395.053) (-398.913) * (-396.506) (-396.598) (-395.284) [-394.667] -- 0:00:01
      969000 -- [-395.494] (-398.191) (-396.486) (-394.740) * (-397.142) [-396.693] (-398.290) (-395.106) -- 0:00:01
      969500 -- (-399.201) [-397.424] (-402.120) (-395.156) * (-397.519) (-399.085) [-397.190] (-395.200) -- 0:00:01
      970000 -- (-397.369) (-399.674) [-397.676] (-395.389) * (-395.331) [-395.197] (-397.225) (-395.140) -- 0:00:01

      Average standard deviation of split frequencies: 0.006540

      970500 -- (-397.783) (-399.778) (-395.416) [-395.598] * (-397.672) (-394.741) (-396.727) [-396.590] -- 0:00:01
      971000 -- [-396.679] (-394.852) (-396.249) (-396.602) * (-400.484) (-396.260) [-398.298] (-395.324) -- 0:00:01
      971500 -- [-398.371] (-396.182) (-394.242) (-395.152) * (-397.222) [-394.938] (-396.515) (-394.776) -- 0:00:01
      972000 -- (-398.657) [-396.115] (-395.220) (-396.057) * (-396.787) [-395.038] (-395.871) (-398.948) -- 0:00:01
      972500 -- (-396.229) (-395.052) (-395.133) [-397.613] * (-399.826) [-395.615] (-394.891) (-399.158) -- 0:00:01
      973000 -- (-395.155) [-396.364] (-394.471) (-396.245) * (-399.234) [-395.783] (-396.934) (-394.056) -- 0:00:01
      973500 -- (-397.418) (-396.411) (-394.920) [-395.895] * [-394.155] (-395.085) (-396.854) (-395.188) -- 0:00:01
      974000 -- (-396.522) (-395.070) [-395.260] (-396.968) * [-397.453] (-397.490) (-395.802) (-396.238) -- 0:00:01
      974500 -- (-395.488) (-397.211) [-394.798] (-401.073) * [-394.752] (-395.319) (-394.864) (-396.002) -- 0:00:01
      975000 -- (-397.345) (-394.845) (-394.996) [-397.089] * (-395.890) [-395.490] (-396.066) (-394.918) -- 0:00:01

      Average standard deviation of split frequencies: 0.006408

      975500 -- (-396.134) (-394.903) [-399.518] (-396.570) * [-394.610] (-398.951) (-395.570) (-395.647) -- 0:00:01
      976000 -- (-397.586) (-395.347) [-394.541] (-398.072) * [-395.829] (-394.171) (-398.051) (-399.506) -- 0:00:01
      976500 -- (-396.505) (-402.991) [-396.327] (-398.316) * (-394.829) (-395.083) [-397.143] (-398.445) -- 0:00:01
      977000 -- (-394.852) (-396.285) [-396.340] (-395.286) * (-395.042) (-394.691) [-395.949] (-397.218) -- 0:00:01
      977500 -- (-395.805) (-396.296) (-405.883) [-394.171] * (-397.303) [-394.710] (-395.393) (-396.576) -- 0:00:01
      978000 -- (-396.871) [-394.486] (-398.038) (-395.970) * (-397.284) (-396.555) [-395.037] (-395.270) -- 0:00:01
      978500 -- (-400.347) [-395.193] (-395.601) (-397.019) * (-397.458) (-397.457) [-396.191] (-395.992) -- 0:00:01
      979000 -- (-396.285) [-395.371] (-396.729) (-398.268) * (-396.606) [-398.435] (-395.159) (-396.742) -- 0:00:01
      979500 -- (-394.661) (-396.583) [-394.342] (-397.893) * (-396.549) [-395.671] (-396.682) (-397.401) -- 0:00:01
      980000 -- (-396.495) (-401.053) [-395.883] (-400.216) * [-396.983] (-396.584) (-395.167) (-396.008) -- 0:00:01

      Average standard deviation of split frequencies: 0.006570

      980500 -- [-395.882] (-401.044) (-395.106) (-394.524) * (-398.791) (-395.293) [-396.908] (-396.947) -- 0:00:01
      981000 -- (-400.263) (-402.650) (-396.129) [-394.705] * (-399.761) [-397.128] (-398.572) (-397.818) -- 0:00:01
      981500 -- (-397.328) (-395.903) [-395.196] (-396.248) * (-397.255) (-395.255) [-398.204] (-404.726) -- 0:00:01
      982000 -- (-395.962) (-404.363) (-394.781) [-395.440] * (-396.237) [-396.201] (-400.220) (-403.969) -- 0:00:01
      982500 -- (-396.938) (-398.394) (-394.688) [-396.042] * (-395.900) (-395.708) [-396.376] (-394.816) -- 0:00:01
      983000 -- [-396.561] (-398.151) (-398.398) (-403.269) * [-396.048] (-396.517) (-395.946) (-399.045) -- 0:00:01
      983500 -- [-398.092] (-394.428) (-397.528) (-397.235) * (-394.771) [-398.139] (-396.037) (-402.192) -- 0:00:01
      984000 -- (-398.342) (-394.929) (-395.020) [-400.124] * (-398.479) (-402.062) (-395.816) [-394.412] -- 0:00:00
      984500 -- (-398.173) (-395.802) [-396.549] (-395.176) * [-397.835] (-398.791) (-397.362) (-397.078) -- 0:00:00
      985000 -- (-398.110) (-400.648) [-395.109] (-399.191) * (-399.028) (-397.013) (-395.709) [-396.667] -- 0:00:00

      Average standard deviation of split frequencies: 0.006311

      985500 -- (-396.728) (-402.068) [-397.042] (-394.382) * (-397.796) [-397.870] (-398.113) (-395.123) -- 0:00:00
      986000 -- [-395.963] (-397.087) (-400.109) (-394.795) * [-395.642] (-397.059) (-398.805) (-395.487) -- 0:00:00
      986500 -- (-394.782) (-396.883) (-396.194) [-398.439] * (-397.434) [-397.719] (-398.719) (-398.674) -- 0:00:00
      987000 -- (-398.027) (-397.875) (-395.056) [-395.496] * [-395.895] (-395.712) (-398.512) (-401.416) -- 0:00:00
      987500 -- (-395.255) [-396.799] (-397.569) (-394.042) * (-394.988) (-396.328) [-395.614] (-395.336) -- 0:00:00
      988000 -- (-398.130) [-396.507] (-395.612) (-394.055) * (-395.128) (-398.693) (-399.047) [-394.537] -- 0:00:00
      988500 -- (-396.148) (-399.328) [-395.093] (-396.199) * (-396.829) [-397.885] (-395.437) (-395.326) -- 0:00:00
      989000 -- (-395.413) (-398.447) (-399.745) [-396.658] * (-398.019) (-399.600) (-398.977) [-395.821] -- 0:00:00
      989500 -- (-399.468) [-395.462] (-396.871) (-395.387) * (-396.401) (-399.529) (-400.174) [-404.059] -- 0:00:00
      990000 -- (-394.865) [-395.870] (-395.705) (-397.354) * (-397.499) (-398.067) [-396.330] (-396.088) -- 0:00:00

      Average standard deviation of split frequencies: 0.006630

      990500 -- (-398.928) (-395.066) (-407.146) [-396.734] * (-397.823) [-397.181] (-397.698) (-395.992) -- 0:00:00
      991000 -- (-396.417) (-398.975) [-398.022] (-399.560) * [-395.829] (-395.832) (-395.020) (-395.339) -- 0:00:00
      991500 -- [-396.955] (-399.066) (-396.984) (-394.634) * (-397.016) [-395.402] (-394.595) (-396.503) -- 0:00:00
      992000 -- [-395.762] (-395.536) (-396.534) (-395.690) * (-399.750) (-396.366) [-396.136] (-396.042) -- 0:00:00
      992500 -- (-395.276) [-397.152] (-398.970) (-395.643) * (-395.695) [-394.514] (-397.981) (-395.532) -- 0:00:00
      993000 -- (-397.583) (-397.812) (-396.936) [-397.091] * (-397.535) (-395.626) [-394.467] (-394.548) -- 0:00:00
      993500 -- (-397.862) (-397.593) (-397.634) [-394.716] * (-396.957) (-396.321) (-397.248) [-394.695] -- 0:00:00
      994000 -- (-395.739) (-396.067) [-395.705] (-397.408) * (-395.402) (-396.018) (-398.878) [-394.349] -- 0:00:00
      994500 -- [-395.566] (-394.737) (-400.804) (-400.754) * (-397.684) (-395.366) (-398.368) [-394.570] -- 0:00:00
      995000 -- (-398.417) [-396.276] (-397.847) (-395.863) * (-398.196) [-394.128] (-395.478) (-397.859) -- 0:00:00

      Average standard deviation of split frequencies: 0.006721

      995500 -- [-396.972] (-397.024) (-396.239) (-395.887) * (-398.911) (-395.819) (-395.524) [-398.396] -- 0:00:00
      996000 -- (-395.691) [-396.712] (-395.278) (-395.786) * (-394.106) (-397.587) [-395.375] (-398.043) -- 0:00:00
      996500 -- (-394.949) (-401.268) (-397.027) [-394.037] * (-394.605) [-396.482] (-396.588) (-399.667) -- 0:00:00
      997000 -- [-395.075] (-398.353) (-399.514) (-395.147) * [-394.742] (-397.041) (-397.149) (-398.877) -- 0:00:00
      997500 -- [-399.079] (-397.704) (-395.987) (-395.513) * (-394.442) (-397.383) [-396.994] (-398.487) -- 0:00:00
      998000 -- (-398.058) (-395.725) (-396.952) [-394.831] * (-394.557) [-394.966] (-397.951) (-395.082) -- 0:00:00
      998500 -- [-396.106] (-394.695) (-396.982) (-396.807) * (-396.479) (-398.678) [-400.194] (-397.690) -- 0:00:00
      999000 -- (-395.548) (-395.456) (-402.225) [-400.469] * (-395.614) (-401.446) (-400.489) [-397.381] -- 0:00:00
      999500 -- (-395.745) (-395.052) (-398.178) [-403.837] * [-394.853] (-394.893) (-398.218) (-397.021) -- 0:00:00
      1000000 -- [-400.164] (-397.835) (-395.916) (-397.315) * (-397.559) (-397.576) [-397.586] (-397.202) -- 0:00:00

      Average standard deviation of split frequencies: 0.006721

      Analysis completed in 1 mins 1 seconds
      Analysis used 58.97 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -393.89
      Likelihood of best state for "cold" chain of run 2 was -393.89

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            75.8 %     ( 69 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            40.1 %     ( 33 %)     Dirichlet(Pi{all})
            38.6 %     ( 31 %)     Slider(Pi{all})
            79.0 %     ( 53 %)     Multiplier(Alpha{1,2})
            77.9 %     ( 45 %)     Multiplier(Alpha{3})
            26.4 %     ( 30 %)     Slider(Pinvar{all})
            98.6 %     (100 %)     ExtSPR(Tau{all},V{all})
            70.3 %     ( 68 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.4 %     ( 90 %)     ParsSPR(Tau{all},V{all})
            28.1 %     ( 27 %)     Multiplier(V{all})
            97.5 %     ( 99 %)     Nodeslider(V{all})
            30.5 %     ( 24 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            75.6 %     ( 63 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            40.2 %     ( 26 %)     Dirichlet(Pi{all})
            39.4 %     ( 16 %)     Slider(Pi{all})
            79.0 %     ( 57 %)     Multiplier(Alpha{1,2})
            78.3 %     ( 54 %)     Multiplier(Alpha{3})
            26.7 %     ( 16 %)     Slider(Pinvar{all})
            98.6 %     (100 %)     ExtSPR(Tau{all},V{all})
            70.1 %     ( 72 %)     ExtTBR(Tau{all},V{all})
           100.0 %     (100 %)     NNI(Tau{all},V{all})
            89.6 %     ( 95 %)     ParsSPR(Tau{all},V{all})
            28.1 %     ( 32 %)     Multiplier(V{all})
            97.4 %     ( 94 %)     Nodeslider(V{all})
            30.6 %     ( 23 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166991            0.82    0.67 
         3 |  165880  166561            0.84 
         4 |  166418  166978  167172         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.64    0.50 
         2 |  166505            0.82    0.67 
         3 |  167341  166532            0.84 
         4 |  166482  166213  166927         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -395.51
      |   1                            1                           |
      |               1                                            |
      |                                             2              |
      | 2                  2  2  1      2  2   1 2         12   2  |
      |    2       1             2 2           2     * 1 2   1     |
      |  *2  1               1      11            2     1        12|
      |                 2   2      1     121112              22*   |
      |    12   *21 *    2   2 12   22 21   22     21 22  12     2 |
      |21      1     1221 2     1        21   1 2 1     21    1    |
      |     1                  2  2   1         1  1  1     1   1  |
      |      2 2  2    1 1  1                                     1|
      |1      *           11          2          1                 |
      |            2                                               |
      |                           1                       2        |
      |          1   2        1                                    |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -397.36
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -395.63          -398.87
        2       -395.64          -398.42
      --------------------------------------
      TOTAL     -395.63          -398.67
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.896569    0.088716    0.364753    1.492079    0.865948   1429.62   1465.31    1.000
      r(A<->C){all}   0.164364    0.020207    0.000109    0.460436    0.123398    165.54    298.28    1.000
      r(A<->G){all}   0.175485    0.021959    0.000111    0.476632    0.136343    238.54    245.64    1.000
      r(A<->T){all}   0.153878    0.017526    0.000063    0.419009    0.118289    116.15    176.11    1.002
      r(C<->G){all}   0.171717    0.019716    0.000127    0.458213    0.139008    321.67    333.99    1.000
      r(C<->T){all}   0.172194    0.019816    0.000011    0.444855    0.138384    240.99    278.02    1.001
      r(G<->T){all}   0.162362    0.019194    0.000038    0.432821    0.126298    259.38    289.25    1.000
      pi(A){all}      0.178055    0.000498    0.134130    0.221433    0.177557   1187.44   1272.16    1.000
      pi(C){all}      0.294746    0.000703    0.246508    0.351172    0.294059   1098.49   1148.49    1.000
      pi(G){all}      0.287008    0.000692    0.234797    0.337725    0.286737   1178.77   1296.37    1.000
      pi(T){all}      0.240190    0.000597    0.193106    0.287051    0.240206   1244.86   1305.99    1.000
      alpha{1,2}      0.405508    0.212621    0.000147    1.325281    0.243990   1394.28   1407.19    1.000
      alpha{3}        0.431717    0.214520    0.000166    1.380933    0.276220   1189.62   1345.31    1.000
      pinvar{all}     0.993954    0.000055    0.980013    0.999995    0.996341    847.89   1125.92    1.002
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6

   Key to taxon bipartitions (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------
    1 -- .*****
    2 -- .*....
    3 -- ..*...
    4 -- ...*..
    5 -- ....*.
    6 -- .....*
    7 -- .*.*..
    8 -- .*..*.
    9 -- ...*.*
   10 -- ..**..
   11 -- ..*..*
   12 -- .**...
   13 -- ....**
   14 -- .**.**
   15 -- ..****
   16 -- ...**.
   17 -- .*.***
   18 -- .****.
   19 -- .*...*
   20 -- .***.*
   21 -- ..*.*.
   ------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    7   453    0.150899    0.007066    0.145903    0.155896    2
    8   451    0.150233    0.000471    0.149900    0.150566    2
    9   446    0.148568    0.000942    0.147901    0.149234    2
   10   441    0.146902    0.007066    0.141905    0.151899    2
   11   436    0.145237    0.000000    0.145237    0.145237    2
   12   433    0.144237    0.012719    0.135243    0.153231    2
   13   431    0.143571    0.006124    0.139241    0.147901    2
   14   431    0.143571    0.011777    0.135243    0.151899    2
   15   430    0.143238    0.010364    0.135909    0.150566    2
   16   426    0.141905    0.006595    0.137242    0.146569    2
   17   426    0.141905    0.009422    0.135243    0.148568    2
   18   411    0.136909    0.000471    0.136576    0.137242    2
   19   411    0.136909    0.018373    0.123917    0.149900    2
   20   400    0.133245    0.007537    0.127915    0.138574    2
   21   396    0.131912    0.001884    0.130580    0.133245    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.104226    0.011166    0.000006    0.316387    0.071871    1.000    2
   length{all}[2]     0.097388    0.010210    0.000000    0.300315    0.065091    1.000    2
   length{all}[3]     0.100681    0.010422    0.000034    0.306829    0.068865    1.000    2
   length{all}[4]     0.098305    0.009272    0.000002    0.293085    0.067973    1.000    2
   length{all}[5]     0.102159    0.010651    0.000011    0.302533    0.071970    1.000    2
   length{all}[6]     0.098303    0.010223    0.000014    0.299693    0.065949    1.000    2
   length{all}[7]     0.094328    0.007848    0.000052    0.273514    0.070492    0.998    2
   length{all}[8]     0.101202    0.010312    0.000087    0.325974    0.067106    0.998    2
   length{all}[9]     0.105202    0.010918    0.000726    0.312565    0.075570    0.998    2
   length{all}[10]    0.096537    0.010794    0.000003    0.302478    0.065006    0.998    2
   length{all}[11]    0.098234    0.008125    0.000055    0.268673    0.071775    0.999    2
   length{all}[12]    0.093569    0.008920    0.000550    0.274962    0.062951    0.998    2
   length{all}[13]    0.095757    0.009263    0.001447    0.284984    0.070438    1.003    2
   length{all}[14]    0.099822    0.010038    0.000047    0.280595    0.071661    1.007    2
   length{all}[15]    0.105456    0.010834    0.000162    0.301254    0.077334    0.999    2
   length{all}[16]    0.089720    0.008697    0.000175    0.290599    0.062666    1.007    2
   length{all}[17]    0.102336    0.008950    0.000161    0.297197    0.075777    0.998    2
   length{all}[18]    0.098520    0.010617    0.000052    0.288625    0.063106    0.999    2
   length{all}[19]    0.093252    0.009895    0.000040    0.295222    0.060061    1.000    2
   length{all}[20]    0.095682    0.010078    0.000178    0.297239    0.063716    0.998    2
   length{all}[21]    0.098006    0.011493    0.000309    0.325716    0.065170    1.000    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.006721
       Maximum standard deviation of split frequencies = 0.018373
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.007


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   |                                                                               
   |------------------------------------------------------------------------ C3 (3)
   +                                                                               
   |------------------------------------------------------------------------ C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------------ C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |----------------------------------------------------------------- C2 (2)
   |                                                                               
   |--------------------------------------------------------------------- C3 (3)
   +                                                                               
   |-------------------------------------------------------------------- C4 (4)
   |                                                                               
   |------------------------------------------------------------------------ C5 (5)
   |                                                                               
   \------------------------------------------------------------------ C6 (6)
                                                                                   
   |---------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (105 trees sampled):
      50 % credible set contains 45 trees
      90 % credible set contains 91 trees
      95 % credible set contains 97 trees
      99 % credible set contains 104 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 6  	ls = 288
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Reading seq # 5: C5       
Reading seq # 6: C6       
Sequences read..
Counting site patterns..  0:00

Compressing,     43 patterns at     96 /     96 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     43 patterns at     96 /     96 sites (100.0%),  0:00
Counting codons..

      120 bytes for distance
    41968 bytes for conP
     3784 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.059531    0.048301    0.107182    0.040032    0.102978    0.085752    0.300000    1.300000

ntime & nrate & np:     6     2     8

Bounds (np=8):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     8
lnL0 =  -421.002460

Iterating by ming2
Initial: fx=   421.002460
x=  0.05953  0.04830  0.10718  0.04003  0.10298  0.08575  0.30000  1.30000

  1 h-m-p  0.0000 0.0004 229.9862 +++     398.510869  m 0.0004    14 | 1/8
  2 h-m-p  0.0018 0.0089  34.9212 ------------..  | 1/8
  3 h-m-p  0.0000 0.0001 211.2272 ++      394.597172  m 0.0001    46 | 2/8
  4 h-m-p  0.0007 0.0128  25.3636 -----------..  | 2/8
  5 h-m-p  0.0000 0.0001 188.9308 ++      390.334770  m 0.0001    77 | 3/8
  6 h-m-p  0.0010 0.0163  20.3060 -----------..  | 3/8
  7 h-m-p  0.0000 0.0003 163.6605 +++     382.819900  m 0.0003   109 | 4/8
  8 h-m-p  0.0026 0.0242  14.4040 ------------..  | 4/8
  9 h-m-p  0.0000 0.0002 134.1144 +++     379.496731  m 0.0002   142 | 5/8
 10 h-m-p  0.0020 0.0457   8.5707 ------------..  | 5/8
 11 h-m-p  0.0000 0.0000  95.0972 ++      379.089123  m 0.0000   174 | 6/8
 12 h-m-p  0.4119 8.0000   0.0000 --C     379.089123  0 0.0064   187 | 6/8
 13 h-m-p  1.4026 8.0000   0.0000 Y       379.089123  0 0.3507   200
Out..
lnL  =  -379.089123
201 lfun, 201 eigenQcodon, 1206 P(t)

Time used:  0:00


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.030142    0.075749    0.041890    0.105784    0.048015    0.061468    0.299775    0.686696    0.255496

ntime & nrate & np:     6     2     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 11.746029

np =     9
lnL0 =  -412.439943

Iterating by ming2
Initial: fx=   412.439943
x=  0.03014  0.07575  0.04189  0.10578  0.04801  0.06147  0.29977  0.68670  0.25550

  1 h-m-p  0.0000 0.0003 218.6522 +++     396.188692  m 0.0003    15 | 1/9
  2 h-m-p  0.0001 0.0007  99.1666 ++      390.725744  m 0.0007    27 | 2/9
  3 h-m-p  0.0000 0.0000 1685.7557 ++      388.639691  m 0.0000    39 | 3/9
  4 h-m-p  0.0000 0.0000 2727.1849 ++      384.930683  m 0.0000    51 | 4/9
  5 h-m-p  0.0000 0.0000 4837.2744 ++      382.235550  m 0.0000    63 | 5/9
  6 h-m-p  0.0000 0.0000 35356.3112 ++      381.619419  m 0.0000    75 | 6/9
  7 h-m-p  0.0012 0.0657   6.3726 -----------..  | 6/9
  8 h-m-p  0.0000 0.0003  92.8111 +++     379.089111  m 0.0003   109 | 7/9
  9 h-m-p  1.6000 8.0000   0.0000 ++      379.089111  m 8.0000   121 | 7/9
 10 h-m-p  0.0554 8.0000   0.0017 -----Y   379.089111  0 0.0000   140 | 7/9
 11 h-m-p  0.0160 8.0000   0.0000 -------------..  | 7/9
 12 h-m-p  0.0160 8.0000   0.0001 +++++   379.089110  m 8.0000   182 | 7/9
 13 h-m-p  0.0062 3.0817   0.4518 ---------C   379.089110  0 0.0000   205 | 7/9
 14 h-m-p  0.0160 8.0000   0.0001 +++++   379.089110  m 8.0000   222 | 7/9
 15 h-m-p  0.0047 2.3411   0.3534 ---------C   379.089110  0 0.0000   245 | 7/9
 16 h-m-p  0.0160 8.0000   0.0000 ------C   379.089110  0 0.0000   265 | 7/9
 17 h-m-p  0.0160 8.0000   0.0000 +++++   379.089110  m 8.0000   282 | 7/9
 18 h-m-p  0.0001 0.0423   6.5964 +++++   379.089100  m 0.0423   299 | 8/9
 19 h-m-p  0.2938 1.4691   0.2814 ++      379.089068  m 1.4691   311 | 9/9
 20 h-m-p  0.0160 8.0000   0.0000 N       379.089068  0 0.0160   324
Out..
lnL  =  -379.089068
325 lfun, 975 eigenQcodon, 3900 P(t)

Time used:  0:01


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.105353    0.040639    0.105116    0.077510    0.067857    0.054047    0.000100    1.760893    0.551863    0.290411    1.492458

ntime & nrate & np:     6     3    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 12.700388

np =    11
lnL0 =  -419.519834

Iterating by ming2
Initial: fx=   419.519834
x=  0.10535  0.04064  0.10512  0.07751  0.06786  0.05405  0.00011  1.76089  0.55186  0.29041  1.49246

  1 h-m-p  0.0000 0.0000 209.9276 ++      419.375848  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0013 151.6765 ++++    397.658927  m 0.0013    32 | 2/11
  3 h-m-p  0.0000 0.0002 193.6854 ++      392.560744  m 0.0002    46 | 3/11
  4 h-m-p  0.0003 0.0017  57.6590 ++      387.508667  m 0.0017    60 | 4/11
  5 h-m-p  0.0005 0.0027  11.3763 -----------..  | 4/11
  6 h-m-p  0.0000 0.0000 178.4371 ++      386.009291  m 0.0000    97 | 5/11
  7 h-m-p  0.0160 8.0000   4.4190 -------------..  | 5/11
  8 h-m-p  0.0000 0.0001 155.5577 ++      383.687599  m 0.0001   136 | 6/11
  9 h-m-p  0.0160 8.0000   3.3978 -------------..  | 6/11
 10 h-m-p  0.0000 0.0003 128.5356 +++     379.109248  m 0.0003   176 | 7/11
 11 h-m-p  0.0160 8.0000   1.7547 -------------..  | 7/11
 12 h-m-p  0.0000 0.0000  94.1294 ++      379.089099  m 0.0000   215 | 8/11
 13 h-m-p  0.0160 8.0000   0.0000 Y       379.089099  0 0.0160   229 | 8/11
 14 h-m-p  0.0276 8.0000   0.0000 C       379.089099  0 0.0069   246
Out..
lnL  =  -379.089099
247 lfun, 988 eigenQcodon, 4446 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -379.094699  S =  -379.088232    -0.002472
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  43 patterns   0:02
	did  20 /  43 patterns   0:02
	did  30 /  43 patterns   0:02
	did  40 /  43 patterns   0:02
	did  43 /  43 patterns   0:02
Time used:  0:02


Model 7: beta

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.011840    0.073728    0.069804    0.090098    0.073531    0.013102    0.000100    0.733108    1.240581

ntime & nrate & np:     6     1     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 15.713086

np =     9
lnL0 =  -409.365963

Iterating by ming2
Initial: fx=   409.365963
x=  0.01184  0.07373  0.06980  0.09010  0.07353  0.01310  0.00011  0.73311  1.24058

  1 h-m-p  0.0000 0.0000 217.7214 ++      409.188952  m 0.0000    14 | 1/9
  2 h-m-p  0.0001 0.0338  21.5591 ---------..  | 1/9
  3 h-m-p  0.0000 0.0001 217.7917 ++      403.119249  m 0.0001    45 | 2/9
  4 h-m-p  0.0013 0.0369  19.8033 -----------..  | 2/9
  5 h-m-p  0.0000 0.0000 200.4817 ++      402.561354  m 0.0000    78 | 3/9
  6 h-m-p  0.0001 0.0418  17.5035 ----------..  | 3/9
  7 h-m-p  0.0000 0.0006 178.6389 +++     381.777564  m 0.0006   111 | 4/9
  8 h-m-p  0.0089 0.0674  11.0785 -------------..  | 4/9
  9 h-m-p  0.0000 0.0000 161.9431 ++      380.705043  m 0.0000   146 | 5/9
 10 h-m-p  0.0012 0.1878   4.6067 -----------..  | 5/9
 11 h-m-p  0.0000 0.0000 132.4430 ++      380.667081  m 0.0000   179 | 6/9
 12 h-m-p  0.0005 0.2453   3.6172 -----------..  | 6/9
 13 h-m-p  0.0000 0.0002  93.3672 +++     379.089098  m 0.0002   213 | 7/9
 14 h-m-p  1.6000 8.0000   0.0000 ++      379.089098  m 8.0000   225 | 7/9
 15 h-m-p  0.1772 8.0000   0.0000 --Y     379.089098  0 0.0028   241 | 7/9
 16 h-m-p  0.0160 8.0000   0.0001 --Y     379.089098  0 0.0003   257 | 7/9
 17 h-m-p  0.0160 8.0000   0.0007 -----N   379.089098  0 0.0000   276
Out..
lnL  =  -379.089098
277 lfun, 3047 eigenQcodon, 16620 P(t)

Time used:  0:06


Model 8: beta&w>1

TREE #  1
(1, 2, 3, 4, 5, 6);   MP score: 0
    0.079739    0.087887    0.092026    0.068650    0.022584    0.064260    0.000100    0.900000    0.294229    1.275538    1.299946

ntime & nrate & np:     6     2    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 17.187431

np =    11
lnL0 =  -415.442275

Iterating by ming2
Initial: fx=   415.442275
x=  0.07974  0.08789  0.09203  0.06865  0.02258  0.06426  0.00011  0.90000  0.29423  1.27554  1.29995

  1 h-m-p  0.0000 0.0000 201.4165 ++      415.342040  m 0.0000    16 | 1/11
  2 h-m-p  0.0000 0.0012 111.0651 ++++    404.052364  m 0.0012    32 | 2/11
  3 h-m-p  0.0002 0.0012 119.3256 ++      385.212147  m 0.0012    46 | 3/11
  4 h-m-p  0.0003 0.0017  36.5661 ++      384.016337  m 0.0017    60 | 4/11
  5 h-m-p  0.0000 0.0000 11995.3657 ++      382.509768  m 0.0000    74 | 5/11
  6 h-m-p  0.0003 0.0015  21.5772 ----------..  | 5/11
  7 h-m-p  0.0000 0.0001 158.7379 ++      381.097673  m 0.0001   110 | 6/11
  8 h-m-p  0.0011 0.0416   6.6330 -----------..  | 6/11
  9 h-m-p  0.0000 0.0001 130.8510 ++      379.499990  m 0.0001   147 | 7/11
 10 h-m-p  0.0018 0.0592   4.6312 ------------..  | 7/11
 11 h-m-p  0.0000 0.0000  93.7454 ++      379.089100  m 0.0000   185 | 8/11
 12 h-m-p  0.1858 8.0000   0.0000 +++     379.089100  m 8.0000   200 | 8/11
 13 h-m-p  0.0366 8.0000   0.0007 ++++    379.089100  m 8.0000   219 | 8/11
 14 h-m-p  0.0208 7.4702   0.2735 --------C   379.089100  0 0.0000   244 | 8/11
 15 h-m-p  0.0160 8.0000   0.0010 +++++   379.089100  m 8.0000   264 | 8/11
 16 h-m-p  0.0284 7.4255   0.2764 ----------N   379.089100  0 0.0000   291 | 8/11
 17 h-m-p  0.0160 8.0000   0.0000 -----N   379.089100  0 0.0000   313 | 8/11
 18 h-m-p  0.0160 8.0000   0.0000 --------N   379.089100  0 0.0000   338
Out..
lnL  =  -379.089100
339 lfun, 4068 eigenQcodon, 22374 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -379.096439  S =  -379.088198    -0.003613
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  43 patterns   0:12
	did  20 /  43 patterns   0:12
	did  30 /  43 patterns   0:12
	did  40 /  43 patterns   0:13
	did  43 /  43 patterns   0:13
Time used:  0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 

NC_011896_1_WP_010908386_1_1614_MLBR_RS07670          MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
NC_002677_1_NP_302065_1_937_ML1523                    MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440   MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870   MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370       MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570       MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
                                                      **************************************************

NC_011896_1_WP_010908386_1_1614_MLBR_RS07670          DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
NC_002677_1_NP_302065_1_937_ML1523                    DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440   DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870   DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370       DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570       DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
                                                      **********************************************



>NC_011896_1_WP_010908386_1_1614_MLBR_RS07670
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NC_002677_1_NP_302065_1_937_ML1523
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570
ATGTCATTCCTGACTACACAGCCTGAAGCATTGGCCACCCCGGCGGCTGT
CGTCGATATGGCTCCGGCCTCCGCCGCCGGGGTCTCCGTTTTGGCCTCCG
GAGCCGCAGTTGGTGTTGTCGCAGTCACCTCCGCCCGGGTCGTCCGTAGG
GACAAAATGAATGGCCTTGGTAATGGTAGGTCGTTGCTGGGCCAGCCGCA
AAAACCTCGACTGAGGCTGTGGACGGCCATCGCCGCAGTAACAACCTCGG
TTCTTGTCAGTTGTTTTATCAGAGTTAATCTGACTAAC
>NC_011896_1_WP_010908386_1_1614_MLBR_RS07670
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>NC_002677_1_NP_302065_1_937_ML1523
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
>NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570
MSFLTTQPEALATPAAVVDMAPASAAGVSVLASGAAVGVVAVTSARVVRR
DKMNGLGNGRSLLGQPQKPRLRLWTAIAAVTTSVLVSCFIRVNLTN
#NEXUS

[ID: 5490007798]
begin taxa;
	dimensions ntax=6;
	taxlabels
		NC_011896_1_WP_010908386_1_1614_MLBR_RS07670
		NC_002677_1_NP_302065_1_937_ML1523
		NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440
		NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870
		NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370
		NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570
		;
end;
begin trees;
	translate
		1	NC_011896_1_WP_010908386_1_1614_MLBR_RS07670,
		2	NC_002677_1_NP_302065_1_937_ML1523,
		3	NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440,
		4	NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870,
		5	NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370,
		6	NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.07187126,2:0.06509148,3:0.0688649,4:0.06797268,5:0.07196968,6:0.06594947);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.07187126,2:0.06509148,3:0.0688649,4:0.06797268,5:0.07196968,6:0.06594947);
end;
      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -395.63          -398.87
2       -395.64          -398.42
--------------------------------------
TOTAL     -395.63          -398.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1523/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896569    0.088716    0.364753    1.492079    0.865948   1429.62   1465.31    1.000
r(A<->C){all}   0.164364    0.020207    0.000109    0.460436    0.123398    165.54    298.28    1.000
r(A<->G){all}   0.175485    0.021959    0.000111    0.476632    0.136343    238.54    245.64    1.000
r(A<->T){all}   0.153878    0.017526    0.000063    0.419009    0.118289    116.15    176.11    1.002
r(C<->G){all}   0.171717    0.019716    0.000127    0.458213    0.139008    321.67    333.99    1.000
r(C<->T){all}   0.172194    0.019816    0.000011    0.444855    0.138384    240.99    278.02    1.001
r(G<->T){all}   0.162362    0.019194    0.000038    0.432821    0.126298    259.38    289.25    1.000
pi(A){all}      0.178055    0.000498    0.134130    0.221433    0.177557   1187.44   1272.16    1.000
pi(C){all}      0.294746    0.000703    0.246508    0.351172    0.294059   1098.49   1148.49    1.000
pi(G){all}      0.287008    0.000692    0.234797    0.337725    0.286737   1178.77   1296.37    1.000
pi(T){all}      0.240190    0.000597    0.193106    0.287051    0.240206   1244.86   1305.99    1.000
alpha{1,2}      0.405508    0.212621    0.000147    1.325281    0.243990   1394.28   1407.19    1.000
alpha{3}        0.431717    0.214520    0.000166    1.380933    0.276220   1189.62   1345.31    1.000
pinvar{all}     0.993954    0.000055    0.980013    0.999995    0.996341    847.89   1125.92    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018)  /data/7res/ML1523/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio, 
Codon frequency model: F3x4
Site-class models: 
ns =   6  ls =  96

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   1   1   1   1   1 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   1   1   1   1   1   1
    TTC   1   1   1   1   1   1 |     TCC   4   4   4   4   4   4 |     TAC   0   0   0   0   0   0 |     TGC   0   0   0   0   0   0
Leu TTA   0   0   0   0   0   0 |     TCA   1   1   1   1   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   3   3   3   3   3   3 |     TCG   2   2   2   2   2   2 |     TAG   0   0   0   0   0   0 | Trp TGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   2   2   2   2   2   2 | Pro CCT   2   2   2   2   2   2 | His CAT   0   0   0   0   0   0 | Arg CGT   1   1   1   1   1   1
    CTC   0   0   0   0   0   0 |     CCC   0   0   0   0   0   0 |     CAC   0   0   0   0   0   0 |     CGC   0   0   0   0   0   0
    CTA   0   0   0   0   0   0 |     CCA   0   0   0   0   0   0 | Gln CAA   1   1   1   1   1   1 |     CGA   1   1   1   1   1   1
    CTG   5   5   5   5   5   5 |     CCG   3   3   3   3   3   3 |     CAG   2   2   2   2   2   2 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   0   0   0   0   0   0 | Thr ACT   2   2   2   2   2   2 | Asn AAT   3   3   3   3   3   3 | Ser AGT   1   1   1   1   1   1
    ATC   2   2   2   2   2   2 |     ACC   3   3   3   3   3   3 |     AAC   1   1   1   1   1   1 |     AGC   0   0   0   0   0   0
    ATA   0   0   0   0   0   0 |     ACA   2   2   2   2   2   2 | Lys AAA   2   2   2   2   2   2 | Arg AGA   1   1   1   1   1   1
Met ATG   3   3   3   3   3   3 |     ACG   1   1   1   1   1   1 |     AAG   0   0   0   0   0   0 |     AGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   5   5   5   5   5   5 | Ala GCT   2   2   2   2   2   2 | Asp GAT   1   1   1   1   1   1 | Gly GGT   3   3   3   3   3   3
    GTC   8   8   8   8   8   8 |     GCC   9   9   9   9   9   9 |     GAC   1   1   1   1   1   1 |     GGC   2   2   2   2   2   2
    GTA   1   1   1   1   1   1 |     GCA   4   4   4   4   4   4 | Glu GAA   1   1   1   1   1   1 |     GGA   1   1   1   1   1   1
    GTG   0   0   0   0   0   0 |     GCG   1   1   1   1   1   1 |     GAG   0   0   0   0   0   0 |     GGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

#2: NC_002677_1_NP_302065_1_937_ML1523             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

#3: NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

#4: NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

#5: NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

#6: NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570             
position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT       6 | Ser S TCT       0 | Tyr Y TAT       0 | Cys C TGT       6
      TTC       6 |       TCC      24 |       TAC       0 |       TGC       0
Leu L TTA       0 |       TCA       6 | *** * TAA       0 | *** * TGA       0
      TTG      18 |       TCG      12 |       TAG       0 | Trp W TGG       6
------------------------------------------------------------------------------
Leu L CTT      12 | Pro P CCT      12 | His H CAT       0 | Arg R CGT       6
      CTC       0 |       CCC       0 |       CAC       0 |       CGC       0
      CTA       0 |       CCA       0 | Gln Q CAA       6 |       CGA       6
      CTG      30 |       CCG      18 |       CAG      12 |       CGG       6
------------------------------------------------------------------------------
Ile I ATT       0 | Thr T ACT      12 | Asn N AAT      18 | Ser S AGT       6
      ATC      12 |       ACC      18 |       AAC       6 |       AGC       0
      ATA       0 |       ACA      12 | Lys K AAA      12 | Arg R AGA       6
Met M ATG      18 |       ACG       6 |       AAG       0 |       AGG      18
------------------------------------------------------------------------------
Val V GTT      30 | Ala A GCT      12 | Asp D GAT       6 | Gly G GGT      18
      GTC      48 |       GCC      54 |       GAC       6 |       GGC      12
      GTA       6 |       GCA      24 | Glu E GAA       6 |       GGA       6
      GTG       0 |       GCG       6 |       GAG       0 |       GGG       6
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.14583    C:0.18750    A:0.25000    G:0.41667
position  2:    T:0.32292    C:0.37500    A:0.12500    G:0.17708
position  3:    T:0.25000    C:0.32292    A:0.15625    G:0.27083
Average         T:0.23958    C:0.29514    A:0.17708    G:0.28819

Model 0: one-ratio


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  8):   -379.089123      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299775 1.299946

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.29977

omega (dN/dS) =  1.29995

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0
   7..2      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0
   7..3      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0
   7..4      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0
   7..5      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0
   7..6      0.000   193.0    95.0  1.2999  0.0000  0.0000   0.0   0.0

tree length for dN:       0.0000
tree length for dS:       0.0000


Time used:  0:00


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -379.089068      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=2)

p:   0.99999  0.00001
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0
   7..2       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0
   7..3       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0
   7..4       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0
   7..5       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0
   7..6       0.000    193.1     94.9   0.0000   0.0000   0.0000    0.0    0.0


Time used:  0:01


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -379.089099      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.684640 0.198852 0.000001 1.536612

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010


MLEs of dN/dS (w) for site classes (K=3)

p:   0.68464  0.19885  0.11651
w:   0.00000  1.00000  1.53661

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0
   7..2       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0
   7..3       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0
   7..4       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0
   7..5       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0
   7..6       0.000    193.1     94.9   0.3779   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670)

            Pr(w>1)     post mean +- SE for w



Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
w2:   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100

Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)

 0.010
 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010

sum of density on p0-p1 =   1.000000

Time used:  0:02


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np:  9):   -379.089098      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.732673 1.240673

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M7 (beta):
 p =   0.73267  q =   1.24067


MLEs of dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.01325  0.05973  0.12104  0.19373  0.27669  0.36977  0.47359  0.58985  0.72241  0.88289

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0
   7..2       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0
   7..3       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0
   7..4       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0
   7..5       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0
   7..6       0.000    193.1     94.9   0.3703   0.0000   0.0000    0.0    0.0


Time used:  0:06


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 3, 4, 5, 6);   MP score: 0
lnL(ntime:  6  np: 11):   -379.089100      +0.000000
   7..1     7..2     7..3     7..4     7..5     7..6  
 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.725118 0.005000 1.308796 1.452342

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =  0.000024

(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);

(NC_011896_1_WP_010908386_1_1614_MLBR_RS07670: 0.000004, NC_002677_1_NP_302065_1_937_ML1523: 0.000004, NZ_LVXE01000041_1_WP_010908386_1_1840_A3216_RS10440: 0.000004, NZ_LYPH01000047_1_WP_010908386_1_1859_A8144_RS08870: 0.000004, NZ_CP029543_1_WP_010908386_1_1644_DIJ64_RS08370: 0.000004, NZ_AP014567_1_WP_010908386_1_1684_JK2ML_RS08570: 0.000004);

Detailed output identifying parameters

kappa (ts/tv) =  0.00010

Parameters in M8 (beta&w>1):
  p0 =   0.72512  p =   0.00500 q =   1.30880
 (p1 =   0.27488) w =   1.45234


MLEs of dN/dS (w) for site classes (K=11)

p:   0.07251  0.07251  0.07251  0.07251  0.07251  0.07251  0.07251  0.07251  0.07251  0.07251  0.27488
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00002  1.45234

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0
   7..2       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0
   7..3       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0
   7..4       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0
   7..5       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0
   7..6       0.000    193.1     94.9   0.3992   0.0000   0.0000    0.0    0.0


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670)

            Pr(w>1)     post mean +- SE for w



Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908386_1_1614_MLBR_RS07670)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.099  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.101
p :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
q :   0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100
ws:   0.101  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.100  0.099

Time used:  0:13
Model 1: NearlyNeutral	-379.089068
Model 2: PositiveSelection	-379.089099
Model 0: one-ratio	-379.089123
Model 7: beta	-379.089098
Model 8: beta&w>1	-379.0891


Model 0 vs 1	1.0999999994965037E-4

Model 2 vs 1	6.199999995715189E-5

Model 8 vs 7	3.999999989900971E-6