--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:50:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1525/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -616.90 -621.41
2 -616.91 -620.77
--------------------------------------
TOTAL -616.90 -621.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894483 0.088982 0.365089 1.485967 0.869405 1363.10 1432.05 1.000
r(A<->C){all} 0.172803 0.019911 0.000018 0.463027 0.136753 215.17 236.84 1.000
r(A<->G){all} 0.163858 0.019325 0.000121 0.452071 0.125748 135.56 186.31 1.001
r(A<->T){all} 0.160598 0.020074 0.000009 0.446721 0.122674 312.81 326.21 1.004
r(C<->G){all} 0.168926 0.019854 0.000015 0.454694 0.136144 135.44 185.48 1.000
r(C<->T){all} 0.159516 0.018616 0.000026 0.430414 0.120495 194.88 261.19 1.000
r(G<->T){all} 0.174299 0.022217 0.000103 0.489285 0.133201 153.25 188.22 1.000
pi(A){all} 0.177297 0.000321 0.141687 0.211558 0.176971 1280.94 1311.03 1.001
pi(C){all} 0.307498 0.000467 0.267401 0.349752 0.307752 1208.81 1284.95 1.000
pi(G){all} 0.306920 0.000451 0.265242 0.345417 0.306859 1313.66 1366.36 1.000
pi(T){all} 0.208284 0.000361 0.171830 0.245336 0.207640 1280.70 1298.26 1.000
alpha{1,2} 0.427009 0.242398 0.000181 1.390142 0.262903 1130.49 1180.11 1.000
alpha{3} 0.450569 0.225820 0.000216 1.425669 0.303943 1282.24 1322.19 1.000
pinvar{all} 0.996386 0.000021 0.987921 0.999998 0.997747 1145.90 1241.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -581.521522
Model 2: PositiveSelection -581.52143
Model 0: one-ratio -581.521558
Model 7: beta -581.52143
Model 8: beta&w>1 -581.521495
Model 0 vs 1 7.200000004559115E-5
Model 2 vs 1 1.83999999990192E-4
Model 8 vs 7 1.2999999989915523E-4
>C1
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C2
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C3
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C4
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C5
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C6
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=151
C1 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C2 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C3 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C4 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C5 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C6 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
**************************************************
C1 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C2 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C3 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C4 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C5 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C6 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
**************************************************
C1 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C2 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C3 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C4 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C5 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C6 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
**************************************************
C1 E
C2 E
C3 E
C4 E
C5 E
C6 E
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 151 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 151 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4530]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4530]--->[4530]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.467 Mb, Max= 30.685 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C2 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C3 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C4 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C5 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C6 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
**************************************************
C1 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C2 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C3 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C4 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C5 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C6 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
**************************************************
C1 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C2 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C3 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C4 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C5 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C6 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
**************************************************
C1 E
C2 E
C3 E
C4 E
C5 E
C6 E
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C2 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C3 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C4 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C5 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C6 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
**************************************************
C1 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C2 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C3 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C4 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C5 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C6 CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
**************************************************
C1 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C2 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C3 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C4 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C5 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C6 GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
**************************************************
C1 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C2 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C3 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C4 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C5 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C6 CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
**************************************************
C1 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C2 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C3 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C4 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C5 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C6 GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
**************************************************
C1 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C2 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C3 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C4 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C5 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C6 ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
**************************************************
C1 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C2 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C3 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C4 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C5 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C6 ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
**************************************************
C1 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C2 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C3 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C4 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C5 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C6 GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
**************************************************
C1 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C2 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C3 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C4 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C5 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C6 TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
**************************************************
C1 GAA
C2 GAA
C3 GAA
C4 GAA
C5 GAA
C6 GAA
***
>C1
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C2
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C3
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C4
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C5
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C6
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C1
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C2
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C3
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C4
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C5
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C6
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 453 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855776
Setting output file names to "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 852429742
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5360226034
Seed = 277974678
Swapseed = 1579855776
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1013.835717 -- -24.965149
Chain 2 -- -1013.835717 -- -24.965149
Chain 3 -- -1013.835717 -- -24.965149
Chain 4 -- -1013.835658 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1013.835717 -- -24.965149
Chain 2 -- -1013.835717 -- -24.965149
Chain 3 -- -1013.835658 -- -24.965149
Chain 4 -- -1013.835717 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1013.836] (-1013.836) (-1013.836) (-1013.836) * [-1013.836] (-1013.836) (-1013.836) (-1013.836)
500 -- (-628.083) (-628.915) [-624.273] (-630.648) * (-632.845) [-623.807] (-630.061) (-631.654) -- 0:00:00
1000 -- (-622.485) (-637.014) (-622.184) [-623.401] * (-632.299) [-624.594] (-627.528) (-631.129) -- 0:00:00
1500 -- (-634.414) [-627.767] (-623.327) (-629.198) * (-627.813) (-629.578) [-626.626] (-627.698) -- 0:00:00
2000 -- (-626.146) (-626.765) (-624.653) [-628.532] * (-632.772) (-632.072) [-625.589] (-633.167) -- 0:00:00
2500 -- (-626.181) (-629.869) [-622.581] (-627.843) * (-626.186) (-633.516) [-624.686] (-621.366) -- 0:00:00
3000 -- (-634.912) (-628.221) (-623.962) [-625.880] * (-621.175) (-629.376) (-627.666) [-622.804] -- 0:00:00
3500 -- (-635.755) [-625.162] (-625.010) (-625.484) * (-627.024) (-624.240) [-624.623] (-630.918) -- 0:00:00
4000 -- (-626.096) [-628.972] (-625.706) (-631.953) * (-634.263) (-621.375) [-627.453] (-630.357) -- 0:00:00
4500 -- [-624.394] (-630.467) (-636.772) (-627.120) * (-624.973) [-622.118] (-634.876) (-624.299) -- 0:00:00
5000 -- (-631.382) (-625.995) (-633.472) [-623.473] * (-624.117) [-630.934] (-631.276) (-622.228) -- 0:00:00
Average standard deviation of split frequencies: 0.098209
5500 -- (-639.302) [-630.750] (-624.785) (-629.562) * (-625.086) [-625.042] (-631.520) (-622.621) -- 0:00:00
6000 -- (-627.939) (-629.556) (-624.604) [-624.373] * (-626.974) [-626.980] (-628.770) (-624.610) -- 0:00:00
6500 -- (-628.254) [-621.558] (-633.396) (-631.953) * (-633.813) (-624.014) (-629.520) [-630.117] -- 0:00:00
7000 -- [-628.189] (-632.574) (-634.868) (-632.624) * (-631.745) [-623.893] (-630.714) (-626.794) -- 0:00:00
7500 -- (-625.219) (-633.820) (-629.158) [-628.330] * (-629.440) (-628.944) (-624.831) [-623.004] -- 0:00:00
8000 -- [-624.356] (-628.002) (-629.959) (-628.284) * (-630.498) (-625.113) [-623.987] (-626.270) -- 0:00:00
8500 -- [-622.035] (-624.717) (-631.319) (-630.447) * (-625.557) [-623.499] (-627.508) (-623.206) -- 0:00:00
9000 -- [-626.192] (-633.849) (-629.866) (-627.422) * (-625.566) (-629.148) (-627.975) [-627.857] -- 0:00:00
9500 -- (-626.440) (-629.668) (-622.665) [-626.895] * (-627.954) (-629.169) (-625.803) [-629.661] -- 0:00:00
10000 -- (-633.273) (-627.012) (-632.674) [-626.286] * (-626.073) (-632.505) (-622.710) [-624.079] -- 0:00:00
Average standard deviation of split frequencies: 0.056821
10500 -- (-627.346) (-625.410) [-622.360] (-624.852) * [-628.403] (-629.886) (-621.441) (-624.335) -- 0:00:00
11000 -- (-626.899) (-622.381) (-620.862) [-622.459] * (-627.822) (-624.581) (-629.581) [-625.824] -- 0:00:00
11500 -- [-625.132] (-625.952) (-630.607) (-633.954) * (-628.694) (-628.476) (-641.274) [-625.770] -- 0:00:00
12000 -- (-631.792) (-633.571) [-635.885] (-633.049) * (-626.972) (-635.422) [-622.600] (-628.994) -- 0:00:00
12500 -- (-625.673) (-635.713) (-626.217) [-623.801] * (-628.743) (-625.798) (-625.190) [-625.760] -- 0:00:00
13000 -- (-626.507) (-632.358) [-629.784] (-628.112) * (-627.678) [-620.326] (-626.529) (-632.031) -- 0:01:15
13500 -- (-636.020) (-641.177) [-623.767] (-624.040) * (-628.102) (-626.320) [-623.933] (-627.792) -- 0:01:13
14000 -- (-638.532) [-630.274] (-630.589) (-633.194) * (-630.205) (-627.400) [-627.076] (-621.576) -- 0:01:10
14500 -- (-621.444) [-632.439] (-627.514) (-629.267) * (-623.689) (-626.877) (-622.813) [-624.997] -- 0:01:07
15000 -- (-624.228) [-632.034] (-622.911) (-623.984) * [-623.675] (-635.037) (-633.739) (-626.230) -- 0:01:05
Average standard deviation of split frequencies: 0.045831
15500 -- (-618.758) [-626.683] (-628.968) (-625.998) * (-622.887) (-631.069) [-630.690] (-626.208) -- 0:01:03
16000 -- [-619.672] (-632.882) (-629.766) (-627.310) * (-627.139) (-622.757) [-616.662] (-623.027) -- 0:01:01
16500 -- (-617.777) (-628.065) [-623.624] (-627.740) * (-631.768) (-628.394) (-618.971) [-627.587] -- 0:00:59
17000 -- (-616.582) (-636.879) (-640.504) [-631.073] * (-624.974) (-631.020) [-617.726] (-624.072) -- 0:00:57
17500 -- (-618.021) [-616.324] (-631.743) (-635.799) * [-631.881] (-631.847) (-616.562) (-630.791) -- 0:00:56
18000 -- (-619.204) (-616.192) (-631.876) [-623.867] * [-620.641] (-624.258) (-617.889) (-631.734) -- 0:00:54
18500 -- [-617.236] (-619.194) (-637.098) (-631.475) * (-624.431) (-628.048) [-615.805] (-626.724) -- 0:00:53
19000 -- (-616.780) [-617.043] (-623.931) (-634.432) * (-629.328) (-623.503) [-616.305] (-632.988) -- 0:00:51
19500 -- [-620.977] (-619.054) (-632.293) (-627.640) * (-632.031) (-631.298) [-616.083] (-630.064) -- 0:00:50
20000 -- (-618.285) (-615.786) (-630.468) [-630.069] * [-622.902] (-631.895) (-617.199) (-644.122) -- 0:00:49
Average standard deviation of split frequencies: 0.053223
20500 -- (-615.508) [-617.121] (-622.381) (-625.583) * (-626.770) (-620.724) [-617.853] (-643.336) -- 0:00:47
21000 -- [-616.475] (-620.915) (-624.311) (-625.275) * [-625.784] (-626.110) (-616.544) (-619.958) -- 0:00:46
21500 -- (-616.183) [-618.340] (-627.489) (-622.340) * [-621.458] (-627.329) (-617.160) (-617.625) -- 0:00:45
22000 -- (-620.677) (-616.771) [-623.536] (-632.011) * (-632.384) [-624.125] (-618.241) (-619.035) -- 0:00:44
22500 -- (-620.395) [-615.965] (-628.875) (-632.986) * [-626.611] (-625.615) (-622.323) (-618.234) -- 0:00:43
23000 -- (-621.599) [-616.064] (-628.212) (-635.005) * [-627.145] (-630.227) (-619.821) (-618.946) -- 0:00:42
23500 -- (-615.852) (-616.968) [-624.837] (-626.640) * (-628.919) [-628.408] (-616.190) (-618.278) -- 0:00:41
24000 -- (-618.360) (-617.596) (-626.778) [-623.993] * [-625.233] (-628.360) (-616.239) (-616.494) -- 0:00:40
24500 -- (-617.627) (-618.379) [-621.822] (-624.994) * (-622.571) [-622.447] (-616.815) (-620.780) -- 0:00:39
25000 -- (-618.812) [-618.577] (-647.267) (-631.436) * [-629.484] (-622.522) (-616.651) (-619.434) -- 0:00:39
Average standard deviation of split frequencies: 0.045759
25500 -- [-619.029] (-616.206) (-616.788) (-628.920) * (-636.305) (-632.689) (-618.536) [-617.168] -- 0:00:38
26000 -- (-615.721) [-619.001] (-619.430) (-628.959) * [-626.011] (-623.249) (-618.256) (-616.091) -- 0:00:37
26500 -- (-617.892) (-617.984) [-617.606] (-628.985) * (-624.168) [-619.702] (-617.462) (-616.053) -- 0:00:36
27000 -- (-618.946) (-615.829) [-616.589] (-622.797) * (-622.900) (-620.615) (-617.621) [-617.326] -- 0:00:36
27500 -- (-620.217) (-616.147) [-625.105] (-631.346) * (-629.975) (-619.079) [-615.314] (-618.402) -- 0:00:35
28000 -- (-616.516) (-618.158) [-619.024] (-621.045) * (-627.521) (-618.917) (-619.300) [-617.248] -- 0:00:34
28500 -- (-617.022) [-617.178] (-619.012) (-628.006) * [-631.832] (-618.975) (-616.545) (-618.496) -- 0:00:34
29000 -- (-618.660) [-618.566] (-620.053) (-623.618) * (-643.981) [-616.860] (-617.729) (-617.797) -- 0:00:33
29500 -- (-619.017) (-618.014) [-616.141] (-626.197) * (-646.516) (-619.516) (-618.734) [-618.165] -- 0:01:05
30000 -- [-616.805] (-617.739) (-617.195) (-624.357) * (-640.223) (-615.904) [-617.216] (-618.018) -- 0:01:04
Average standard deviation of split frequencies: 0.053436
30500 -- (-615.925) (-616.150) (-618.621) [-625.119] * (-624.675) [-616.126] (-616.036) (-617.433) -- 0:01:03
31000 -- (-617.551) [-618.184] (-618.084) (-624.156) * (-617.622) (-616.285) [-618.954] (-618.693) -- 0:01:02
31500 -- (-616.724) (-617.433) [-617.572] (-626.401) * (-618.116) [-616.014] (-618.889) (-616.832) -- 0:01:01
32000 -- (-617.915) [-616.668] (-618.801) (-630.893) * (-618.674) [-619.024] (-615.831) (-616.025) -- 0:01:00
32500 -- (-615.787) (-616.030) (-616.575) [-623.742] * [-618.572] (-617.411) (-617.824) (-617.609) -- 0:00:59
33000 -- (-615.998) (-619.817) (-619.001) [-625.791] * [-615.492] (-620.627) (-617.401) (-616.816) -- 0:00:58
33500 -- (-619.096) [-616.719] (-620.679) (-627.583) * (-615.743) (-619.198) [-617.363] (-615.532) -- 0:00:57
34000 -- [-618.211] (-616.752) (-617.419) (-623.016) * [-616.728] (-617.684) (-616.801) (-621.371) -- 0:00:56
34500 -- [-619.171] (-618.734) (-616.546) (-626.451) * (-616.942) [-616.658] (-620.268) (-619.401) -- 0:00:55
35000 -- (-617.495) (-618.908) (-622.894) [-623.609] * (-616.968) (-617.205) (-619.570) [-617.076] -- 0:00:55
Average standard deviation of split frequencies: 0.041778
35500 -- (-616.105) (-619.857) [-619.444] (-624.565) * (-616.810) [-617.275] (-618.057) (-620.150) -- 0:00:54
36000 -- [-617.580] (-621.654) (-619.680) (-623.841) * (-619.011) (-617.798) [-617.143] (-628.428) -- 0:00:53
36500 -- [-619.106] (-617.519) (-620.902) (-626.179) * (-621.533) (-616.155) [-616.147] (-619.547) -- 0:00:52
37000 -- (-618.546) [-618.016] (-619.447) (-631.051) * (-620.840) (-617.009) (-617.043) [-623.795] -- 0:00:52
37500 -- [-616.373] (-617.065) (-618.706) (-624.574) * (-620.179) (-618.564) (-617.481) [-617.339] -- 0:00:51
38000 -- [-617.046] (-616.805) (-617.871) (-633.617) * (-617.622) [-616.942] (-616.853) (-616.038) -- 0:00:50
38500 -- (-618.497) (-616.596) (-616.058) [-627.252] * (-618.349) [-617.695] (-616.316) (-619.611) -- 0:00:49
39000 -- [-620.169] (-615.658) (-616.694) (-625.225) * [-620.116] (-618.724) (-616.503) (-616.942) -- 0:00:49
39500 -- (-618.345) (-617.027) [-620.946] (-635.184) * (-617.801) (-617.543) [-618.903] (-617.657) -- 0:00:48
40000 -- [-618.816] (-617.522) (-616.737) (-624.513) * [-618.085] (-617.650) (-617.356) (-616.092) -- 0:00:48
Average standard deviation of split frequencies: 0.038436
40500 -- [-619.428] (-618.754) (-620.282) (-634.089) * (-616.108) [-618.150] (-616.820) (-617.702) -- 0:00:47
41000 -- (-618.366) (-621.109) [-619.579] (-629.396) * (-615.821) (-617.197) [-616.800] (-615.603) -- 0:00:46
41500 -- [-616.973] (-621.458) (-615.842) (-627.106) * [-617.176] (-617.861) (-616.960) (-617.212) -- 0:00:46
42000 -- [-616.612] (-619.717) (-616.634) (-626.451) * (-617.086) (-616.335) [-618.929] (-615.833) -- 0:00:45
42500 -- (-616.541) (-621.343) [-616.486] (-625.938) * (-616.246) (-618.755) [-619.450] (-616.083) -- 0:00:45
43000 -- (-617.014) [-618.116] (-616.429) (-625.014) * (-617.570) [-615.389] (-618.499) (-617.021) -- 0:00:44
43500 -- (-618.933) (-616.586) [-616.001] (-628.523) * (-620.388) (-616.012) (-621.633) [-616.571] -- 0:00:43
44000 -- [-616.160] (-617.857) (-616.123) (-633.989) * (-615.717) [-618.615] (-619.761) (-616.897) -- 0:00:43
44500 -- (-615.763) (-616.231) [-616.431] (-629.153) * [-616.772] (-617.832) (-618.481) (-616.512) -- 0:00:42
45000 -- [-618.018] (-620.517) (-616.729) (-634.034) * (-616.042) [-617.517] (-619.271) (-618.295) -- 0:01:03
Average standard deviation of split frequencies: 0.035402
45500 -- (-617.255) [-620.551] (-616.495) (-627.890) * [-620.407] (-622.373) (-618.112) (-616.396) -- 0:01:02
46000 -- (-615.587) [-619.805] (-616.735) (-622.759) * (-617.183) [-618.023] (-618.725) (-615.765) -- 0:01:02
46500 -- (-621.778) (-618.865) [-617.175] (-627.945) * (-621.882) (-619.445) (-616.760) [-619.405] -- 0:01:01
47000 -- [-617.360] (-619.452) (-618.304) (-638.761) * (-622.258) [-617.680] (-617.888) (-618.544) -- 0:01:00
47500 -- [-617.062] (-619.855) (-619.471) (-622.063) * (-621.495) (-621.307) [-617.296] (-620.397) -- 0:01:00
48000 -- (-618.245) [-616.788] (-617.303) (-620.163) * (-618.168) (-617.204) [-616.392] (-619.067) -- 0:00:59
48500 -- (-620.224) (-615.817) (-616.027) [-616.282] * (-616.961) [-618.548] (-617.978) (-616.554) -- 0:00:58
49000 -- (-618.172) (-619.320) [-616.991] (-620.713) * (-617.924) (-617.747) (-618.651) [-615.513] -- 0:00:58
49500 -- [-618.986] (-620.504) (-617.640) (-617.070) * (-616.799) (-622.109) (-619.245) [-615.962] -- 0:00:57
50000 -- [-619.862] (-616.996) (-621.775) (-615.872) * (-620.559) (-617.903) [-619.461] (-615.705) -- 0:00:57
Average standard deviation of split frequencies: 0.027447
50500 -- (-620.883) (-617.920) (-616.559) [-617.861] * [-617.493] (-620.713) (-618.898) (-619.055) -- 0:00:56
51000 -- (-620.379) (-619.102) (-618.412) [-616.424] * [-620.086] (-618.900) (-622.385) (-621.064) -- 0:00:55
51500 -- [-619.080] (-616.783) (-618.299) (-617.937) * [-618.962] (-619.943) (-618.719) (-619.143) -- 0:00:55
52000 -- (-617.880) (-619.473) (-620.773) [-616.303] * [-617.255] (-617.164) (-619.813) (-617.759) -- 0:00:54
52500 -- [-617.249] (-619.655) (-619.051) (-618.111) * (-619.261) (-616.875) [-618.283] (-618.772) -- 0:00:54
53000 -- (-617.467) (-617.030) [-619.068] (-618.066) * (-618.493) (-617.396) (-618.520) [-618.078] -- 0:00:53
53500 -- [-619.106] (-619.171) (-618.824) (-619.064) * (-619.550) (-620.918) [-616.924] (-618.019) -- 0:00:53
54000 -- (-618.201) (-620.975) (-617.705) [-615.644] * (-620.218) (-620.482) (-619.452) [-615.951] -- 0:00:52
54500 -- (-617.320) (-619.793) [-619.128] (-616.225) * (-618.390) (-618.737) (-618.677) [-615.526] -- 0:00:52
55000 -- (-620.910) (-617.032) (-625.020) [-615.660] * (-617.757) (-616.288) (-622.340) [-617.787] -- 0:00:51
Average standard deviation of split frequencies: 0.022596
55500 -- (-620.647) (-617.894) [-617.112] (-621.536) * (-616.472) [-617.662] (-620.351) (-617.076) -- 0:00:51
56000 -- [-619.394] (-617.414) (-617.517) (-617.880) * (-617.523) [-618.682] (-622.133) (-616.722) -- 0:00:50
56500 -- [-618.185] (-618.876) (-617.014) (-619.067) * (-617.342) (-615.556) (-617.121) [-616.788] -- 0:00:50
57000 -- (-620.719) [-615.657] (-617.452) (-618.042) * [-624.421] (-616.624) (-623.266) (-619.028) -- 0:00:49
57500 -- [-620.236] (-618.493) (-618.098) (-619.823) * [-621.470] (-617.298) (-619.292) (-617.577) -- 0:00:49
58000 -- (-622.420) [-617.245] (-618.139) (-617.916) * (-615.592) [-617.521] (-618.139) (-618.346) -- 0:00:48
58500 -- (-617.524) (-619.615) [-618.095] (-619.343) * [-617.196] (-622.369) (-616.532) (-617.234) -- 0:00:48
59000 -- (-616.903) (-616.912) (-618.652) [-619.880] * (-618.549) (-617.042) (-621.892) [-616.856] -- 0:00:47
59500 -- (-620.674) (-616.693) (-617.483) [-616.306] * [-617.392] (-618.229) (-618.310) (-616.188) -- 0:00:47
60000 -- [-617.285] (-616.521) (-615.677) (-616.629) * [-615.510] (-619.944) (-618.175) (-617.247) -- 0:00:47
Average standard deviation of split frequencies: 0.024283
60500 -- (-618.069) [-618.890] (-618.251) (-618.138) * (-617.144) [-617.095] (-618.404) (-616.352) -- 0:01:02
61000 -- (-617.821) (-616.746) [-618.464] (-616.897) * (-618.488) (-615.924) (-617.338) [-616.193] -- 0:01:01
61500 -- (-616.373) (-615.866) [-618.264] (-617.991) * [-619.870] (-618.149) (-617.136) (-615.288) -- 0:01:01
62000 -- (-616.562) (-616.686) (-618.818) [-617.700] * (-618.042) (-617.108) (-616.438) [-618.896] -- 0:01:00
62500 -- (-616.533) (-615.611) [-617.467] (-616.914) * (-618.729) (-616.241) [-616.304] (-616.399) -- 0:01:00
63000 -- (-617.101) (-618.639) [-616.422] (-619.043) * (-617.246) (-617.856) [-615.791] (-619.840) -- 0:00:59
63500 -- [-619.433] (-617.857) (-616.517) (-616.813) * (-619.875) (-616.198) (-617.974) [-617.575] -- 0:00:58
64000 -- (-619.232) [-617.055] (-619.005) (-618.067) * (-618.564) (-618.317) [-617.470] (-616.795) -- 0:00:58
64500 -- (-618.588) (-617.962) (-617.134) [-620.400] * (-620.249) (-617.281) [-617.549] (-622.605) -- 0:00:58
65000 -- (-618.106) [-620.254] (-617.187) (-619.680) * (-619.623) (-615.746) [-618.465] (-618.807) -- 0:00:57
Average standard deviation of split frequencies: 0.023468
65500 -- (-618.270) (-620.176) (-617.447) [-617.759] * (-618.651) (-620.274) (-621.535) [-618.149] -- 0:00:57
66000 -- (-617.507) [-615.914] (-619.201) (-617.779) * (-615.580) (-618.500) (-617.455) [-618.280] -- 0:00:56
66500 -- (-618.029) (-616.190) (-619.061) [-616.561] * (-617.002) (-617.184) (-618.556) [-616.408] -- 0:00:56
67000 -- (-616.542) [-616.864] (-618.767) (-622.830) * (-619.677) [-616.366] (-619.956) (-616.456) -- 0:00:55
67500 -- (-615.685) [-616.155] (-616.785) (-618.466) * (-616.752) (-615.921) (-616.458) [-616.215] -- 0:00:55
68000 -- (-616.071) (-616.841) [-616.443] (-617.414) * (-617.505) [-619.897] (-616.458) (-619.988) -- 0:00:54
68500 -- (-617.889) [-616.165] (-616.335) (-619.182) * (-617.847) (-617.740) (-617.420) [-618.123] -- 0:00:54
69000 -- (-618.961) (-619.257) (-616.254) [-616.269] * [-617.001] (-619.927) (-616.856) (-616.302) -- 0:00:53
69500 -- (-619.823) [-617.914] (-616.508) (-616.074) * (-617.348) (-618.372) [-618.143] (-617.096) -- 0:00:53
70000 -- (-617.671) [-617.267] (-616.607) (-616.579) * [-618.110] (-617.248) (-616.101) (-617.960) -- 0:00:53
Average standard deviation of split frequencies: 0.021347
70500 -- (-619.230) (-618.993) [-615.883] (-617.895) * [-616.713] (-621.638) (-615.827) (-619.331) -- 0:00:52
71000 -- (-617.301) [-615.901] (-617.005) (-618.497) * (-616.414) [-617.967] (-615.505) (-618.026) -- 0:00:52
71500 -- (-617.543) (-617.444) (-617.014) [-619.237] * (-618.354) [-618.054] (-617.423) (-619.660) -- 0:00:51
72000 -- (-620.377) (-619.537) (-617.310) [-619.538] * (-619.339) [-616.696] (-616.472) (-619.514) -- 0:00:51
72500 -- (-622.109) [-617.810] (-620.018) (-617.869) * [-616.759] (-616.979) (-619.056) (-618.525) -- 0:00:51
73000 -- (-618.471) (-621.673) [-615.897] (-618.542) * (-617.134) [-621.397] (-616.694) (-617.697) -- 0:00:50
73500 -- [-618.415] (-618.157) (-618.848) (-617.358) * (-620.741) [-615.984] (-616.517) (-619.157) -- 0:00:50
74000 -- (-618.308) (-618.469) (-619.766) [-617.668] * (-618.970) [-618.408] (-616.422) (-617.609) -- 0:00:50
74500 -- (-617.454) (-617.580) [-619.992] (-618.058) * (-621.272) (-618.196) [-616.497] (-618.693) -- 0:00:49
75000 -- (-616.353) [-615.927] (-619.171) (-616.799) * (-622.775) [-616.716] (-617.236) (-620.800) -- 0:00:49
Average standard deviation of split frequencies: 0.020469
75500 -- [-617.725] (-616.581) (-618.591) (-616.389) * [-618.465] (-618.178) (-618.565) (-616.775) -- 0:00:48
76000 -- (-622.470) (-617.141) (-617.400) [-616.317] * (-617.290) (-617.942) (-617.308) [-617.219] -- 0:00:48
76500 -- [-616.591] (-617.807) (-615.530) (-616.969) * (-617.388) (-616.348) (-617.424) [-618.963] -- 0:01:00
77000 -- (-616.950) [-616.834] (-616.593) (-620.227) * (-619.340) (-616.634) (-620.238) [-616.345] -- 0:00:59
77500 -- (-618.423) [-619.401] (-617.091) (-618.230) * (-617.659) (-615.691) [-625.598] (-619.046) -- 0:00:59
78000 -- [-617.832] (-616.718) (-617.026) (-621.481) * [-616.298] (-618.434) (-617.710) (-619.791) -- 0:00:59
78500 -- (-616.593) (-615.859) (-617.042) [-616.889] * (-617.318) (-618.288) [-617.604] (-621.154) -- 0:00:58
79000 -- (-617.796) (-617.550) (-615.616) [-618.235] * [-617.171] (-616.481) (-616.940) (-619.940) -- 0:00:58
79500 -- (-618.400) (-620.362) (-617.805) [-616.636] * (-615.787) (-615.849) (-616.979) [-616.003] -- 0:00:57
80000 -- (-618.569) (-620.090) [-619.011] (-618.096) * (-616.792) [-615.811] (-617.492) (-617.058) -- 0:00:57
Average standard deviation of split frequencies: 0.024349
80500 -- (-620.011) [-616.113] (-616.551) (-620.523) * [-617.787] (-617.430) (-618.246) (-619.949) -- 0:00:57
81000 -- [-619.966] (-619.083) (-621.595) (-621.113) * (-616.144) (-617.417) [-616.472] (-617.190) -- 0:00:56
81500 -- [-619.642] (-620.359) (-616.571) (-619.956) * (-617.744) (-615.686) (-616.052) [-617.055] -- 0:00:56
82000 -- [-617.619] (-617.411) (-616.164) (-620.034) * [-616.972] (-616.247) (-619.032) (-618.289) -- 0:00:55
82500 -- [-617.854] (-620.335) (-617.479) (-616.352) * [-616.557] (-618.045) (-617.297) (-618.307) -- 0:00:55
83000 -- (-618.300) (-617.613) (-624.264) [-619.783] * (-616.618) (-620.727) (-618.145) [-616.968] -- 0:00:55
83500 -- (-616.647) (-616.538) [-617.622] (-616.411) * (-621.095) (-619.678) (-615.434) [-615.709] -- 0:00:54
84000 -- [-616.365] (-618.390) (-615.952) (-616.272) * (-617.927) [-620.338] (-615.719) (-622.046) -- 0:00:54
84500 -- (-617.062) (-616.259) [-617.847] (-617.730) * [-617.592] (-616.128) (-615.724) (-616.511) -- 0:00:54
85000 -- (-618.468) [-621.478] (-616.371) (-617.867) * (-620.560) [-616.227] (-621.186) (-617.842) -- 0:00:53
Average standard deviation of split frequencies: 0.024392
85500 -- (-622.647) (-620.941) (-616.360) [-618.490] * (-619.189) (-617.922) (-617.102) [-615.398] -- 0:00:53
86000 -- [-617.107] (-617.996) (-617.970) (-618.243) * (-618.734) (-618.338) (-619.449) [-616.470] -- 0:00:53
86500 -- (-619.383) [-616.578] (-615.560) (-620.283) * (-617.486) (-615.662) (-618.891) [-616.775] -- 0:00:52
87000 -- (-620.191) (-619.133) (-616.260) [-615.729] * [-615.935] (-616.984) (-621.614) (-617.433) -- 0:00:52
87500 -- (-622.547) [-620.077] (-618.120) (-620.334) * (-617.255) (-617.709) [-616.553] (-618.279) -- 0:00:52
88000 -- (-618.040) (-620.463) (-617.963) [-617.165] * (-617.287) (-618.404) [-615.737] (-618.489) -- 0:00:51
88500 -- (-617.782) [-619.617] (-621.013) (-617.396) * (-616.753) (-618.180) (-616.118) [-619.731] -- 0:00:51
89000 -- (-616.787) [-617.853] (-616.676) (-616.127) * (-618.414) [-616.945] (-616.271) (-616.778) -- 0:00:51
89500 -- (-617.315) (-618.479) (-618.565) [-617.894] * [-616.008] (-616.215) (-617.599) (-616.728) -- 0:00:50
90000 -- (-620.201) [-618.624] (-617.560) (-620.509) * (-617.611) [-616.636] (-617.294) (-616.716) -- 0:00:50
Average standard deviation of split frequencies: 0.025997
90500 -- (-618.774) [-615.958] (-617.382) (-617.749) * (-617.741) [-616.744] (-626.419) (-618.084) -- 0:00:50
91000 -- (-618.147) (-617.558) [-619.078] (-623.539) * (-618.685) [-621.041] (-618.757) (-615.561) -- 0:00:49
91500 -- (-619.493) (-617.131) [-616.603] (-622.991) * (-617.693) (-617.719) [-616.510] (-616.960) -- 0:00:49
92000 -- (-616.949) (-618.208) [-617.079] (-619.145) * [-617.710] (-617.710) (-615.257) (-617.129) -- 0:00:49
92500 -- (-619.687) [-615.771] (-616.792) (-622.357) * (-620.536) (-618.182) [-616.733] (-617.432) -- 0:00:49
93000 -- (-615.657) (-615.904) [-616.641] (-620.669) * (-616.454) (-620.710) [-618.021] (-618.804) -- 0:00:48
93500 -- [-616.475] (-617.767) (-617.353) (-621.600) * [-618.666] (-621.888) (-617.792) (-617.602) -- 0:00:58
94000 -- (-617.887) (-617.027) (-618.040) [-618.888] * [-618.512] (-621.958) (-616.245) (-616.326) -- 0:00:57
94500 -- (-617.523) (-621.050) (-617.637) [-621.710] * (-617.775) [-620.362] (-617.701) (-615.643) -- 0:00:57
95000 -- [-616.560] (-617.468) (-621.845) (-624.049) * (-618.612) (-617.143) [-615.566] (-617.611) -- 0:00:57
Average standard deviation of split frequencies: 0.025289
95500 -- (-616.320) (-616.044) (-619.469) [-623.921] * [-616.331] (-616.731) (-615.797) (-622.953) -- 0:00:56
96000 -- (-616.425) (-621.930) (-615.166) [-619.418] * (-618.172) [-620.475] (-616.059) (-616.325) -- 0:00:56
96500 -- [-619.710] (-620.682) (-619.930) (-618.785) * (-617.197) (-617.809) (-616.877) [-619.994] -- 0:00:56
97000 -- [-617.102] (-615.535) (-620.747) (-616.341) * (-615.889) (-620.304) (-617.451) [-617.984] -- 0:00:55
97500 -- (-620.765) [-621.434] (-618.837) (-618.337) * (-616.409) (-617.272) [-616.114] (-618.704) -- 0:00:55
98000 -- (-617.279) (-616.739) [-616.516] (-617.607) * [-617.593] (-615.456) (-618.350) (-619.354) -- 0:00:55
98500 -- (-619.962) [-617.922] (-617.815) (-616.356) * (-617.580) (-616.715) [-617.879] (-618.710) -- 0:00:54
99000 -- (-623.012) [-618.740] (-616.343) (-620.392) * (-615.750) [-615.247] (-616.875) (-618.830) -- 0:00:54
99500 -- [-619.793] (-618.056) (-618.019) (-617.656) * (-616.328) [-615.681] (-615.449) (-620.993) -- 0:00:54
100000 -- [-616.523] (-617.072) (-617.492) (-617.029) * (-616.894) (-616.181) [-616.669] (-619.690) -- 0:00:54
Average standard deviation of split frequencies: 0.023168
100500 -- (-615.849) (-620.537) [-620.849] (-619.018) * [-616.171] (-616.222) (-616.669) (-621.455) -- 0:00:53
101000 -- (-616.207) (-617.174) (-618.989) [-616.706] * (-616.542) [-616.496] (-616.710) (-621.050) -- 0:00:53
101500 -- (-617.532) [-617.151] (-618.417) (-618.378) * [-615.462] (-619.287) (-617.012) (-618.275) -- 0:00:53
102000 -- (-618.613) (-615.571) (-615.589) [-616.801] * [-617.173] (-618.517) (-617.067) (-619.346) -- 0:00:52
102500 -- (-619.088) (-616.614) [-617.256] (-615.971) * (-620.681) [-617.653] (-619.131) (-619.435) -- 0:00:52
103000 -- [-616.421] (-617.914) (-616.337) (-620.769) * (-616.604) [-616.328] (-616.472) (-617.668) -- 0:00:52
103500 -- (-617.882) [-617.416] (-620.035) (-619.536) * (-621.020) [-616.523] (-616.556) (-617.542) -- 0:00:51
104000 -- (-619.841) (-616.087) [-616.824] (-617.113) * [-618.379] (-616.587) (-615.696) (-622.440) -- 0:00:51
104500 -- (-618.600) (-617.432) (-616.506) [-617.045] * [-620.062] (-616.630) (-615.565) (-616.194) -- 0:00:51
105000 -- (-616.813) (-617.511) [-616.464] (-617.503) * [-618.284] (-617.314) (-617.352) (-619.218) -- 0:00:51
Average standard deviation of split frequencies: 0.021177
105500 -- [-616.854] (-616.901) (-617.939) (-621.813) * [-617.561] (-616.559) (-616.235) (-617.825) -- 0:00:50
106000 -- (-618.874) (-615.512) (-617.523) [-619.055] * (-618.137) (-617.291) [-616.849] (-620.636) -- 0:00:50
106500 -- (-616.329) (-618.189) [-626.943] (-617.901) * [-617.367] (-617.396) (-618.086) (-624.309) -- 0:00:50
107000 -- [-615.895] (-615.942) (-619.341) (-618.595) * (-616.319) (-618.032) (-615.346) [-618.156] -- 0:00:50
107500 -- (-616.580) (-617.399) [-617.471] (-618.881) * (-621.126) (-618.115) (-617.964) [-617.693] -- 0:00:49
108000 -- (-616.863) [-618.354] (-618.033) (-618.693) * (-618.329) (-617.987) [-618.484] (-617.851) -- 0:00:49
108500 -- (-615.713) [-619.815] (-620.701) (-616.799) * [-617.913] (-617.033) (-616.277) (-617.107) -- 0:00:49
109000 -- (-616.647) (-620.045) (-620.222) [-617.417] * [-618.592] (-618.226) (-615.698) (-619.638) -- 0:00:49
109500 -- (-617.288) (-616.311) (-619.268) [-618.850] * (-621.885) [-616.680] (-616.756) (-616.132) -- 0:00:48
110000 -- (-617.640) (-616.839) (-616.562) [-619.127] * (-619.414) (-617.581) (-617.688) [-615.457] -- 0:00:56
Average standard deviation of split frequencies: 0.023124
110500 -- (-618.114) (-616.941) [-619.840] (-616.384) * [-618.370] (-617.791) (-616.397) (-616.352) -- 0:00:56
111000 -- (-618.761) (-616.037) (-617.034) [-616.055] * (-620.652) (-618.575) (-620.490) [-618.195] -- 0:00:56
111500 -- (-618.678) (-617.330) [-617.766] (-617.341) * (-621.038) (-617.576) [-618.059] (-617.540) -- 0:00:55
112000 -- (-619.570) [-618.373] (-621.547) (-619.064) * (-618.220) (-618.126) (-617.373) [-615.534] -- 0:00:55
112500 -- (-616.529) (-617.198) [-616.179] (-622.919) * (-618.236) (-618.344) (-620.575) [-616.087] -- 0:00:55
113000 -- (-616.035) (-618.325) (-617.299) [-616.516] * (-616.658) (-618.452) [-618.245] (-616.058) -- 0:00:54
113500 -- (-619.032) (-617.616) (-618.137) [-619.191] * (-617.775) [-618.080] (-620.373) (-615.854) -- 0:00:54
114000 -- [-617.419] (-616.817) (-617.817) (-617.898) * (-619.774) (-616.635) (-621.201) [-615.806] -- 0:00:54
114500 -- (-618.146) [-617.641] (-616.823) (-617.769) * (-618.216) [-616.643] (-617.335) (-617.445) -- 0:00:54
115000 -- (-617.148) [-617.468] (-616.828) (-617.154) * (-616.238) (-617.396) (-621.468) [-617.082] -- 0:00:53
Average standard deviation of split frequencies: 0.022448
115500 -- (-617.632) [-617.443] (-615.509) (-616.388) * (-615.989) [-616.851] (-622.257) (-616.459) -- 0:00:53
116000 -- (-618.117) (-616.926) (-619.673) [-616.411] * (-615.752) [-616.494] (-618.511) (-615.748) -- 0:00:53
116500 -- (-617.638) (-618.337) (-616.255) [-617.407] * (-615.310) (-616.084) (-616.596) [-616.779] -- 0:00:53
117000 -- [-617.035] (-618.411) (-617.844) (-617.587) * (-618.340) [-616.074] (-617.255) (-616.960) -- 0:00:52
117500 -- (-617.399) (-622.538) (-615.719) [-616.475] * [-617.880] (-619.681) (-617.181) (-616.857) -- 0:00:52
118000 -- [-620.714] (-618.220) (-616.645) (-616.241) * (-616.577) (-625.429) [-617.637] (-616.603) -- 0:00:52
118500 -- (-616.985) [-616.232] (-620.562) (-617.767) * (-617.653) (-617.315) (-617.021) [-617.003] -- 0:00:52
119000 -- (-618.834) [-616.155] (-616.670) (-617.157) * (-617.042) (-616.832) (-617.700) [-616.828] -- 0:00:51
119500 -- (-620.664) [-618.090] (-615.576) (-620.470) * (-617.689) [-616.867] (-616.940) (-616.261) -- 0:00:51
120000 -- (-616.486) (-619.590) [-615.647] (-620.063) * (-618.843) [-617.199] (-617.059) (-616.769) -- 0:00:51
Average standard deviation of split frequencies: 0.023234
120500 -- (-616.016) (-617.171) (-617.815) [-619.334] * (-619.324) (-615.373) (-615.936) [-615.916] -- 0:00:51
121000 -- (-620.662) [-617.295] (-619.794) (-621.501) * [-616.878] (-621.645) (-616.159) (-616.308) -- 0:00:50
121500 -- (-617.260) [-618.032] (-616.263) (-617.770) * [-620.241] (-617.430) (-617.483) (-617.339) -- 0:00:50
122000 -- [-615.927] (-617.816) (-616.914) (-617.026) * (-619.806) (-620.800) [-615.905] (-619.153) -- 0:00:50
122500 -- (-617.581) (-620.840) [-618.371] (-616.729) * (-621.645) [-616.692] (-619.556) (-620.320) -- 0:00:50
123000 -- (-618.397) (-618.303) (-618.481) [-618.377] * (-617.760) (-616.398) [-617.776] (-618.989) -- 0:00:49
123500 -- (-617.516) [-620.075] (-617.964) (-616.160) * (-621.235) [-616.593] (-616.621) (-616.748) -- 0:00:49
124000 -- (-618.273) [-620.117] (-616.075) (-616.758) * (-617.396) [-616.326] (-618.582) (-617.270) -- 0:00:49
124500 -- (-619.390) [-616.526] (-616.130) (-617.087) * (-616.298) (-617.412) [-616.090] (-623.859) -- 0:00:49
125000 -- (-617.155) [-615.901] (-618.541) (-615.801) * [-617.809] (-616.934) (-616.129) (-617.965) -- 0:00:49
Average standard deviation of split frequencies: 0.022788
125500 -- (-618.664) (-617.339) [-617.835] (-617.222) * (-616.778) (-616.108) (-617.263) [-617.664] -- 0:00:48
126000 -- (-618.170) (-619.919) (-619.713) [-616.658] * (-616.474) (-615.742) [-618.136] (-616.725) -- 0:00:48
126500 -- (-616.868) (-617.248) (-619.323) [-619.153] * (-615.861) (-616.871) (-618.986) [-617.413] -- 0:00:48
127000 -- (-619.142) [-616.341] (-627.707) (-618.635) * (-617.578) [-617.921] (-615.832) (-616.910) -- 0:00:54
127500 -- (-616.941) (-616.231) (-619.291) [-617.410] * (-620.151) (-618.763) (-616.332) [-618.830] -- 0:00:54
128000 -- (-616.249) (-617.787) [-617.486] (-618.328) * [-620.235] (-617.199) (-620.025) (-619.078) -- 0:00:54
128500 -- (-619.129) [-618.821] (-616.224) (-621.164) * [-618.699] (-618.396) (-617.784) (-621.660) -- 0:00:54
129000 -- (-616.240) (-616.853) [-616.286] (-619.019) * (-615.907) [-617.018] (-617.832) (-624.223) -- 0:00:54
129500 -- [-615.345] (-616.523) (-618.133) (-622.608) * (-622.842) (-619.019) (-618.522) [-618.749] -- 0:00:53
130000 -- (-615.932) (-617.526) [-616.286] (-618.953) * (-616.014) [-617.544] (-616.710) (-619.492) -- 0:00:53
Average standard deviation of split frequencies: 0.022333
130500 -- [-615.763] (-618.413) (-618.780) (-617.911) * [-616.456] (-616.398) (-616.334) (-618.915) -- 0:00:53
131000 -- (-616.515) (-617.225) (-617.347) [-620.565] * (-617.128) (-620.387) (-616.756) [-618.747] -- 0:00:53
131500 -- (-617.039) (-618.116) (-620.672) [-617.250] * [-621.456] (-619.656) (-616.756) (-618.971) -- 0:00:52
132000 -- (-619.768) [-616.441] (-617.936) (-616.152) * (-616.724) [-616.328] (-616.199) (-617.182) -- 0:00:52
132500 -- (-620.081) [-618.111] (-616.636) (-617.991) * (-624.971) [-616.278] (-617.738) (-617.069) -- 0:00:52
133000 -- (-621.386) (-616.557) (-616.772) [-622.398] * (-620.178) (-621.016) (-618.450) [-619.391] -- 0:00:52
133500 -- [-617.465] (-616.453) (-620.021) (-617.199) * [-618.794] (-616.198) (-618.887) (-619.597) -- 0:00:51
134000 -- (-618.422) (-619.536) (-623.824) [-616.145] * [-617.659] (-618.120) (-618.130) (-618.474) -- 0:00:51
134500 -- (-617.539) (-616.320) (-619.462) [-620.471] * (-619.291) (-617.232) [-616.611] (-617.336) -- 0:00:51
135000 -- (-618.660) [-616.783] (-619.384) (-618.642) * (-618.981) [-615.563] (-618.048) (-616.379) -- 0:00:51
Average standard deviation of split frequencies: 0.020797
135500 -- [-616.841] (-618.886) (-617.070) (-618.507) * (-617.126) [-615.764] (-617.329) (-619.484) -- 0:00:51
136000 -- (-617.335) (-617.602) [-618.601] (-626.549) * (-617.842) (-618.437) (-620.953) [-617.758] -- 0:00:50
136500 -- (-616.637) (-617.500) (-617.017) [-619.868] * [-618.807] (-616.888) (-620.164) (-617.560) -- 0:00:50
137000 -- [-616.310] (-617.781) (-621.501) (-621.204) * (-617.160) (-619.414) (-619.826) [-618.558] -- 0:00:50
137500 -- (-617.222) (-620.222) (-622.925) [-617.329] * [-617.223] (-620.255) (-615.990) (-616.874) -- 0:00:50
138000 -- (-617.218) [-617.080] (-617.165) (-617.841) * (-617.652) (-616.561) (-616.741) [-616.528] -- 0:00:49
138500 -- (-618.038) (-616.630) (-616.411) [-616.952] * [-620.909] (-616.935) (-615.784) (-615.589) -- 0:00:49
139000 -- (-619.418) (-619.351) (-617.444) [-619.752] * (-621.772) (-617.221) [-616.209] (-616.639) -- 0:00:49
139500 -- (-617.025) (-617.833) (-620.941) [-618.255] * (-618.795) (-615.232) [-616.003] (-616.279) -- 0:00:49
140000 -- (-616.423) (-616.733) [-619.645] (-617.692) * (-618.030) [-619.251] (-616.716) (-615.880) -- 0:00:49
Average standard deviation of split frequencies: 0.020989
140500 -- (-616.160) [-619.573] (-617.844) (-617.245) * (-617.038) [-620.380] (-619.153) (-618.558) -- 0:00:48
141000 -- (-615.915) [-618.310] (-615.946) (-618.447) * (-618.807) [-617.776] (-616.640) (-617.025) -- 0:00:48
141500 -- (-616.352) (-620.495) [-616.582] (-621.060) * [-622.914] (-617.297) (-616.429) (-618.404) -- 0:00:48
142000 -- (-618.507) [-617.241] (-617.354) (-616.117) * (-621.461) [-617.148] (-616.549) (-618.462) -- 0:00:48
142500 -- (-620.319) (-617.002) [-617.494] (-616.472) * (-615.460) [-616.364] (-618.386) (-618.421) -- 0:00:48
143000 -- [-616.980] (-617.709) (-619.608) (-616.945) * [-616.212] (-617.730) (-616.835) (-618.917) -- 0:00:47
143500 -- (-619.668) (-616.663) (-616.873) [-617.173] * (-616.275) [-615.931] (-616.771) (-619.413) -- 0:00:53
144000 -- [-616.652] (-615.820) (-617.112) (-618.297) * (-618.370) (-618.780) [-616.292] (-616.260) -- 0:00:53
144500 -- (-617.804) [-617.394] (-616.700) (-620.660) * (-621.645) [-617.037] (-618.062) (-616.021) -- 0:00:53
145000 -- [-617.208] (-617.523) (-621.575) (-619.297) * (-619.792) [-616.270] (-617.582) (-618.284) -- 0:00:53
Average standard deviation of split frequencies: 0.018727
145500 -- (-616.494) (-616.175) [-619.342] (-619.833) * (-618.945) (-617.082) [-617.694] (-615.939) -- 0:00:52
146000 -- (-623.519) (-618.325) [-617.006] (-618.727) * (-621.390) (-617.650) (-617.754) [-621.804] -- 0:00:52
146500 -- (-618.889) [-617.473] (-616.652) (-619.655) * (-618.722) [-617.231] (-617.545) (-620.543) -- 0:00:52
147000 -- (-617.490) (-616.211) [-617.835] (-619.778) * [-615.699] (-615.808) (-618.994) (-616.164) -- 0:00:52
147500 -- [-615.819] (-617.303) (-617.445) (-618.053) * [-618.625] (-615.966) (-617.355) (-616.612) -- 0:00:52
148000 -- (-616.511) (-617.538) (-617.400) [-620.578] * (-619.485) [-616.809] (-616.334) (-616.984) -- 0:00:51
148500 -- (-615.684) [-623.631] (-617.902) (-620.215) * (-619.144) (-617.268) (-617.972) [-620.384] -- 0:00:51
149000 -- [-617.228] (-618.816) (-617.257) (-620.412) * (-619.410) (-616.357) [-616.336] (-620.395) -- 0:00:51
149500 -- (-620.154) (-619.413) (-616.855) [-617.475] * (-619.826) [-617.244] (-618.236) (-620.812) -- 0:00:51
150000 -- (-616.340) [-615.967] (-616.685) (-618.212) * (-619.338) (-617.969) (-616.611) [-619.825] -- 0:00:51
Average standard deviation of split frequencies: 0.018773
150500 -- (-616.356) [-618.142] (-616.026) (-619.124) * (-619.395) (-620.924) [-616.793] (-619.510) -- 0:00:50
151000 -- (-616.757) (-618.388) [-617.941] (-623.755) * (-623.042) (-616.598) [-617.222] (-617.008) -- 0:00:50
151500 -- (-618.663) (-617.334) [-616.443] (-620.835) * (-618.199) (-617.598) (-620.107) [-618.052] -- 0:00:50
152000 -- (-616.356) (-617.546) [-616.704] (-618.218) * (-617.439) [-617.427] (-617.434) (-616.601) -- 0:00:50
152500 -- (-618.165) (-624.116) [-617.691] (-618.963) * (-616.941) (-621.314) [-617.227] (-616.159) -- 0:00:50
153000 -- (-616.489) (-620.594) [-621.875] (-616.884) * [-616.803] (-617.588) (-618.822) (-622.781) -- 0:00:49
153500 -- (-618.030) [-616.708] (-620.165) (-619.374) * (-616.396) (-618.237) [-620.787] (-620.017) -- 0:00:49
154000 -- (-616.217) (-617.763) (-616.526) [-617.000] * [-615.687] (-618.062) (-617.701) (-619.436) -- 0:00:49
154500 -- (-617.117) (-616.995) [-621.880] (-618.430) * (-617.343) [-616.952] (-617.631) (-616.657) -- 0:00:49
155000 -- (-616.172) (-615.850) (-616.282) [-621.172] * (-619.264) [-618.787] (-616.113) (-616.155) -- 0:00:49
Average standard deviation of split frequencies: 0.019085
155500 -- (-617.184) [-616.592] (-616.478) (-620.699) * [-616.736] (-618.969) (-616.953) (-616.561) -- 0:00:48
156000 -- (-617.431) (-615.659) [-616.850] (-620.584) * (-619.959) [-617.432] (-616.289) (-616.079) -- 0:00:48
156500 -- (-616.514) (-617.958) [-616.792] (-616.412) * (-618.766) [-617.434] (-619.031) (-617.929) -- 0:00:48
157000 -- (-616.911) (-616.061) [-620.199] (-616.258) * (-615.599) (-618.041) [-616.590] (-619.003) -- 0:00:48
157500 -- (-618.085) [-617.040] (-615.411) (-616.894) * (-615.389) (-618.227) (-617.598) [-619.538] -- 0:00:48
158000 -- (-617.716) [-616.151] (-617.004) (-619.949) * (-616.614) (-623.101) [-617.876] (-624.437) -- 0:00:47
158500 -- [-619.866] (-618.403) (-619.324) (-616.827) * (-616.670) (-618.704) [-619.028] (-617.768) -- 0:00:47
159000 -- [-618.514] (-619.586) (-617.887) (-616.348) * (-617.117) [-617.900] (-617.135) (-616.425) -- 0:00:47
159500 -- (-617.492) (-620.411) (-618.595) [-617.540] * [-617.221] (-617.744) (-615.669) (-616.494) -- 0:00:47
160000 -- (-616.358) (-615.624) (-618.292) [-616.970] * (-617.253) (-616.368) [-617.224] (-619.856) -- 0:00:47
Average standard deviation of split frequencies: 0.016789
160500 -- (-619.673) (-619.692) [-617.092] (-616.534) * (-616.477) (-616.777) [-618.015] (-617.549) -- 0:00:52
161000 -- (-617.019) (-618.122) [-615.916] (-619.701) * (-619.354) (-619.558) [-618.283] (-619.097) -- 0:00:52
161500 -- (-617.635) [-617.617] (-615.699) (-620.357) * (-619.983) (-617.224) [-618.206] (-618.183) -- 0:00:51
162000 -- (-623.690) (-618.585) [-615.532] (-619.034) * (-617.974) (-618.125) [-617.430] (-616.206) -- 0:00:51
162500 -- (-619.896) (-617.543) (-615.918) [-615.649] * (-616.739) [-616.456] (-619.750) (-616.922) -- 0:00:51
163000 -- (-617.036) (-623.029) (-620.410) [-618.252] * (-618.664) [-617.992] (-617.644) (-615.350) -- 0:00:51
163500 -- (-616.382) [-620.109] (-620.432) (-618.297) * (-617.968) (-615.384) [-616.922] (-615.579) -- 0:00:51
164000 -- [-616.876] (-615.827) (-619.880) (-621.083) * (-619.494) [-615.554] (-618.824) (-623.622) -- 0:00:50
164500 -- (-616.876) [-616.166] (-618.321) (-618.379) * [-616.490] (-616.980) (-615.955) (-617.647) -- 0:00:50
165000 -- (-619.691) [-616.037] (-616.080) (-617.730) * (-616.546) [-616.600] (-617.044) (-620.876) -- 0:00:50
Average standard deviation of split frequencies: 0.019131
165500 -- (-618.264) (-617.130) [-616.576] (-619.089) * (-615.565) (-616.243) (-616.485) [-617.679] -- 0:00:50
166000 -- (-617.795) (-615.844) [-615.767] (-619.715) * (-616.747) (-616.007) [-618.192] (-617.300) -- 0:00:50
166500 -- (-618.499) [-616.068] (-617.360) (-620.266) * (-616.776) (-617.831) [-621.119] (-616.624) -- 0:00:50
167000 -- (-616.229) (-617.780) [-616.694] (-621.819) * (-616.490) (-617.608) (-618.921) [-619.451] -- 0:00:49
167500 -- [-616.685] (-616.577) (-617.184) (-619.561) * (-619.037) (-616.435) [-622.035] (-616.699) -- 0:00:49
168000 -- (-616.091) (-617.841) [-615.941] (-620.370) * (-618.199) (-619.212) (-616.952) [-616.302] -- 0:00:49
168500 -- (-618.045) (-618.695) [-616.845] (-621.034) * [-615.945] (-618.179) (-616.541) (-619.357) -- 0:00:49
169000 -- [-616.893] (-618.542) (-620.870) (-620.537) * [-615.552] (-616.486) (-619.112) (-620.040) -- 0:00:49
169500 -- (-617.826) [-617.848] (-619.078) (-617.611) * (-619.723) [-615.687] (-621.604) (-618.500) -- 0:00:48
170000 -- [-619.078] (-617.871) (-616.591) (-616.836) * (-622.145) (-616.201) [-620.127] (-616.654) -- 0:00:48
Average standard deviation of split frequencies: 0.019949
170500 -- [-617.325] (-621.309) (-617.778) (-617.583) * (-616.562) (-617.036) (-621.158) [-616.316] -- 0:00:48
171000 -- (-619.961) (-620.486) [-618.191] (-619.422) * (-617.942) [-616.023] (-617.978) (-615.331) -- 0:00:48
171500 -- [-619.862] (-616.640) (-618.228) (-618.048) * (-617.866) [-616.891] (-616.231) (-615.331) -- 0:00:48
172000 -- (-621.122) (-616.942) [-617.019] (-616.534) * (-618.205) [-618.737] (-615.863) (-616.553) -- 0:00:48
172500 -- (-621.163) (-617.035) (-616.547) [-617.002] * (-617.583) (-621.713) [-618.128] (-616.784) -- 0:00:47
173000 -- [-618.274] (-616.830) (-617.731) (-620.601) * [-617.778] (-622.143) (-619.744) (-617.197) -- 0:00:47
173500 -- [-618.520] (-616.638) (-623.384) (-618.834) * (-618.012) [-617.591] (-620.436) (-615.510) -- 0:00:47
174000 -- (-617.621) (-616.764) [-623.021] (-619.836) * (-617.601) (-618.556) (-617.913) [-617.121] -- 0:00:47
174500 -- (-616.766) (-617.732) (-617.734) [-617.126] * (-617.321) (-622.986) (-618.095) [-616.300] -- 0:00:47
175000 -- (-619.095) [-617.791] (-615.746) (-619.201) * (-619.017) (-619.417) [-618.028] (-615.651) -- 0:00:47
Average standard deviation of split frequencies: 0.020683
175500 -- (-616.867) (-618.313) (-615.297) [-616.657] * (-616.978) (-619.514) [-615.816] (-617.718) -- 0:00:46
176000 -- (-616.291) (-616.776) [-617.658] (-617.045) * (-618.262) (-622.483) [-618.521] (-617.704) -- 0:00:46
176500 -- [-615.935] (-616.612) (-617.457) (-617.288) * (-617.711) [-618.499] (-616.699) (-617.249) -- 0:00:46
177000 -- (-619.724) (-619.352) (-616.950) [-619.236] * (-617.497) [-618.608] (-616.413) (-621.131) -- 0:00:46
177500 -- (-616.763) [-618.240] (-620.084) (-616.364) * (-617.268) [-618.862] (-619.547) (-621.038) -- 0:00:50
178000 -- (-620.435) (-616.335) (-620.203) [-615.880] * (-618.847) (-616.258) [-616.555] (-616.855) -- 0:00:50
178500 -- (-622.886) (-616.365) [-617.205] (-617.070) * (-616.772) [-616.729] (-617.804) (-618.788) -- 0:00:50
179000 -- (-617.637) (-615.956) (-619.828) [-615.960] * (-618.127) [-619.871] (-617.894) (-617.577) -- 0:00:50
179500 -- (-616.218) (-615.783) [-618.973] (-618.515) * (-618.278) (-617.404) (-617.090) [-617.697] -- 0:00:50
180000 -- (-616.483) [-615.955] (-616.991) (-617.062) * [-616.363] (-617.298) (-616.902) (-617.187) -- 0:00:50
Average standard deviation of split frequencies: 0.021309
180500 -- (-615.905) [-616.333] (-617.437) (-616.914) * (-618.534) [-616.331] (-621.294) (-615.783) -- 0:00:49
181000 -- [-616.678] (-616.479) (-616.745) (-620.170) * [-617.639] (-620.240) (-619.219) (-616.132) -- 0:00:49
181500 -- [-616.379] (-617.423) (-619.988) (-620.556) * [-618.024] (-621.220) (-617.368) (-616.726) -- 0:00:49
182000 -- (-617.920) (-617.965) [-619.191] (-618.353) * (-617.583) (-617.901) (-615.456) [-616.768] -- 0:00:49
182500 -- (-621.815) [-616.584] (-618.264) (-615.585) * (-619.548) [-619.406] (-620.088) (-618.099) -- 0:00:49
183000 -- (-618.797) (-615.635) [-616.163] (-616.343) * (-615.966) (-620.009) (-619.950) [-617.967] -- 0:00:49
183500 -- (-617.095) [-617.143] (-617.484) (-615.426) * (-615.985) [-619.422] (-616.877) (-619.274) -- 0:00:48
184000 -- (-617.130) (-616.619) (-619.454) [-615.670] * (-615.959) (-620.075) [-616.411] (-618.912) -- 0:00:48
184500 -- (-617.165) [-619.025] (-623.522) (-619.103) * [-619.782] (-615.626) (-616.064) (-618.811) -- 0:00:48
185000 -- [-617.208] (-616.847) (-618.739) (-620.160) * (-617.346) (-616.954) [-616.987] (-617.580) -- 0:00:48
Average standard deviation of split frequencies: 0.023077
185500 -- (-616.501) (-622.199) (-620.995) [-617.308] * (-619.861) (-618.204) (-619.597) [-616.680] -- 0:00:48
186000 -- (-617.847) (-624.166) (-616.974) [-616.209] * [-616.902] (-618.692) (-617.113) (-617.164) -- 0:00:48
186500 -- (-618.305) (-617.648) [-620.646] (-621.904) * [-618.772] (-618.678) (-620.568) (-621.194) -- 0:00:47
187000 -- (-616.599) (-622.300) [-619.508] (-617.212) * [-619.734] (-619.608) (-618.235) (-621.804) -- 0:00:47
187500 -- (-617.084) (-617.997) [-617.439] (-617.120) * [-616.878] (-616.996) (-622.394) (-623.912) -- 0:00:47
188000 -- (-616.263) [-618.803] (-617.900) (-616.870) * (-619.323) (-616.402) (-618.377) [-618.507] -- 0:00:47
188500 -- [-618.155] (-617.316) (-621.069) (-621.677) * (-618.411) [-616.036] (-616.096) (-617.337) -- 0:00:47
189000 -- (-615.974) (-617.412) [-616.465] (-621.520) * (-618.656) (-615.664) [-616.211] (-616.171) -- 0:00:47
189500 -- (-616.850) [-617.967] (-616.176) (-617.660) * (-620.659) [-618.028] (-615.984) (-617.072) -- 0:00:47
190000 -- [-617.418] (-617.630) (-617.338) (-616.196) * [-617.896] (-618.411) (-618.144) (-617.728) -- 0:00:46
Average standard deviation of split frequencies: 0.023213
190500 -- [-616.241] (-617.158) (-618.521) (-617.032) * [-617.397] (-620.213) (-616.739) (-619.054) -- 0:00:46
191000 -- (-616.812) (-617.695) [-622.014] (-617.330) * (-616.999) [-619.993] (-616.918) (-616.019) -- 0:00:46
191500 -- (-617.481) [-617.485] (-622.005) (-621.240) * [-617.692] (-619.952) (-619.637) (-617.688) -- 0:00:46
192000 -- [-616.235] (-618.661) (-618.633) (-618.264) * [-617.141] (-615.678) (-619.510) (-617.164) -- 0:00:46
192500 -- (-621.377) (-617.485) [-617.768] (-617.757) * (-616.326) (-616.977) (-619.699) [-616.910] -- 0:00:46
193000 -- [-619.052] (-617.212) (-616.133) (-616.345) * [-615.795] (-616.520) (-621.545) (-617.268) -- 0:00:45
193500 -- (-617.447) (-618.077) [-616.850] (-618.367) * (-617.968) (-617.677) [-615.851] (-617.303) -- 0:00:45
194000 -- (-617.499) [-618.319] (-620.121) (-617.706) * (-619.127) [-620.820] (-617.871) (-616.483) -- 0:00:49
194500 -- (-615.822) (-616.448) (-617.398) [-619.303] * (-619.929) (-616.960) [-618.668] (-615.394) -- 0:00:49
195000 -- [-617.838] (-618.304) (-620.267) (-617.651) * (-621.830) [-617.326] (-618.795) (-626.171) -- 0:00:49
Average standard deviation of split frequencies: 0.020887
195500 -- (-619.473) (-616.897) [-618.269] (-618.092) * (-623.010) (-618.964) (-617.082) [-620.800] -- 0:00:49
196000 -- (-621.270) [-616.157] (-617.069) (-617.482) * [-618.391] (-618.261) (-617.129) (-618.547) -- 0:00:49
196500 -- [-619.405] (-616.388) (-617.066) (-617.620) * (-618.790) [-617.176] (-617.749) (-618.896) -- 0:00:49
197000 -- (-620.922) [-617.112] (-618.206) (-621.939) * (-621.733) (-617.257) [-617.396] (-617.128) -- 0:00:48
197500 -- (-618.030) (-619.529) (-616.051) [-615.607] * [-620.012] (-620.615) (-617.827) (-618.932) -- 0:00:48
198000 -- (-616.873) (-621.465) [-617.704] (-616.258) * (-618.245) (-618.020) (-616.113) [-618.490] -- 0:00:48
198500 -- (-616.233) (-619.711) [-617.947] (-618.602) * [-616.009] (-616.038) (-616.732) (-616.936) -- 0:00:48
199000 -- [-616.156] (-617.443) (-616.150) (-618.062) * (-621.273) (-627.313) (-616.736) [-617.347] -- 0:00:48
199500 -- (-616.003) (-619.031) (-615.386) [-616.989] * (-618.264) (-618.159) (-620.336) [-615.617] -- 0:00:48
200000 -- [-615.934] (-616.040) (-615.622) (-618.867) * [-617.844] (-617.249) (-619.487) (-617.777) -- 0:00:48
Average standard deviation of split frequencies: 0.020321
200500 -- (-620.410) (-616.050) (-615.766) [-617.789] * (-620.486) [-616.157] (-617.166) (-616.071) -- 0:00:47
201000 -- (-617.303) (-616.058) [-615.440] (-616.771) * [-620.782] (-616.118) (-617.104) (-619.149) -- 0:00:47
201500 -- [-617.508] (-616.932) (-616.120) (-615.654) * [-620.153] (-616.143) (-618.304) (-618.559) -- 0:00:47
202000 -- (-618.818) [-617.301] (-619.342) (-617.631) * (-617.232) (-617.571) (-616.626) [-617.348] -- 0:00:47
202500 -- (-616.990) [-617.044] (-617.875) (-618.834) * (-618.835) (-620.338) [-620.265] (-616.970) -- 0:00:47
203000 -- [-617.562] (-617.958) (-618.233) (-618.864) * [-616.489] (-621.807) (-618.015) (-615.640) -- 0:00:47
203500 -- [-615.959] (-618.402) (-621.212) (-617.118) * (-619.003) (-616.618) [-618.004] (-617.671) -- 0:00:46
204000 -- [-616.265] (-616.351) (-620.916) (-615.209) * (-619.805) [-617.380] (-616.804) (-617.889) -- 0:00:46
204500 -- (-616.718) (-621.027) [-616.665] (-615.555) * (-617.927) [-616.416] (-617.152) (-617.788) -- 0:00:46
205000 -- (-617.291) (-619.014) [-616.223] (-616.313) * (-617.896) [-617.234] (-617.364) (-617.537) -- 0:00:46
Average standard deviation of split frequencies: 0.018765
205500 -- (-618.015) (-620.328) [-616.320] (-617.708) * (-618.151) (-616.951) [-617.088] (-617.338) -- 0:00:46
206000 -- [-617.910] (-619.314) (-615.642) (-617.085) * (-620.455) [-616.806] (-620.188) (-620.340) -- 0:00:46
206500 -- (-615.304) (-617.567) (-617.628) [-615.336] * [-619.059] (-617.126) (-621.303) (-622.667) -- 0:00:46
207000 -- (-618.192) (-622.107) [-618.226] (-617.065) * (-616.364) (-620.603) (-615.710) [-616.974] -- 0:00:45
207500 -- (-616.297) [-619.795] (-617.329) (-619.371) * (-616.007) (-623.060) (-616.378) [-615.366] -- 0:00:45
208000 -- (-617.266) [-620.641] (-616.173) (-616.497) * [-615.544] (-617.890) (-619.191) (-615.572) -- 0:00:45
208500 -- (-617.194) (-617.696) [-619.180] (-617.045) * (-618.437) (-618.728) (-620.234) [-619.102] -- 0:00:45
209000 -- (-616.174) (-619.484) [-618.553] (-619.585) * (-618.188) (-623.091) (-618.136) [-620.025] -- 0:00:45
209500 -- (-618.938) (-625.859) [-618.680] (-622.665) * (-618.133) (-619.104) [-619.840] (-617.421) -- 0:00:45
210000 -- (-619.648) (-618.199) (-616.695) [-618.296] * (-619.193) [-619.655] (-618.833) (-617.659) -- 0:00:45
Average standard deviation of split frequencies: 0.016606
210500 -- [-622.275] (-618.364) (-618.752) (-619.072) * (-617.692) (-616.316) (-617.157) [-618.900] -- 0:00:45
211000 -- (-617.724) [-616.757] (-618.514) (-617.460) * (-619.449) (-616.806) [-620.606] (-617.288) -- 0:00:48
211500 -- (-622.139) [-616.028] (-618.330) (-619.099) * (-616.625) (-618.559) (-615.422) [-615.532] -- 0:00:48
212000 -- (-617.967) [-617.121] (-616.728) (-617.092) * (-619.526) (-616.080) [-616.466] (-615.861) -- 0:00:48
212500 -- (-621.819) (-617.254) (-616.766) [-615.980] * (-616.502) (-615.714) [-616.008] (-618.765) -- 0:00:48
213000 -- (-617.488) [-618.028] (-617.103) (-616.959) * (-617.859) (-615.547) (-615.418) [-616.492] -- 0:00:48
213500 -- (-618.664) (-617.077) (-616.675) [-617.448] * (-617.137) (-616.476) (-616.064) [-616.280] -- 0:00:47
214000 -- (-620.308) (-620.565) [-615.840] (-617.401) * (-620.537) (-616.690) (-617.956) [-617.544] -- 0:00:47
214500 -- (-617.201) (-622.959) (-621.255) [-617.092] * (-621.557) (-620.801) [-616.202] (-617.707) -- 0:00:47
215000 -- (-617.147) (-619.323) [-615.787] (-615.359) * [-624.958] (-616.771) (-616.897) (-615.789) -- 0:00:47
Average standard deviation of split frequencies: 0.016247
215500 -- [-616.916] (-619.738) (-616.706) (-616.391) * [-619.516] (-620.226) (-616.552) (-621.445) -- 0:00:47
216000 -- (-619.417) (-616.928) [-617.435] (-615.773) * [-619.642] (-618.860) (-616.033) (-616.478) -- 0:00:47
216500 -- (-618.064) (-616.553) [-618.616] (-620.035) * (-618.637) (-617.674) [-618.947] (-620.206) -- 0:00:47
217000 -- (-615.526) (-617.870) [-619.444] (-618.211) * (-617.056) (-616.450) (-621.060) [-616.308] -- 0:00:46
217500 -- (-616.778) [-617.101] (-615.457) (-616.714) * (-619.480) [-615.570] (-620.467) (-616.958) -- 0:00:46
218000 -- (-615.990) [-617.516] (-619.781) (-616.640) * (-619.304) [-615.293] (-619.471) (-618.027) -- 0:00:46
218500 -- (-616.231) (-617.476) (-616.816) [-619.892] * [-616.189] (-617.187) (-617.067) (-617.639) -- 0:00:46
219000 -- [-616.229] (-619.012) (-619.060) (-617.261) * (-615.894) [-615.976] (-617.394) (-616.175) -- 0:00:46
219500 -- (-615.960) (-619.640) [-616.843] (-617.393) * (-616.743) (-615.738) (-618.222) [-619.303] -- 0:00:46
220000 -- [-615.937] (-618.911) (-619.857) (-616.255) * (-615.687) (-617.408) [-619.189] (-618.153) -- 0:00:46
Average standard deviation of split frequencies: 0.016865
220500 -- (-616.267) [-616.822] (-618.792) (-618.545) * (-616.928) (-619.977) (-617.446) [-617.909] -- 0:00:45
221000 -- [-615.434] (-616.326) (-618.506) (-618.375) * [-616.903] (-616.269) (-618.583) (-617.964) -- 0:00:45
221500 -- (-615.625) [-619.243] (-616.992) (-618.599) * (-616.847) (-616.962) (-615.809) [-617.076] -- 0:00:45
222000 -- (-616.955) [-617.075] (-617.560) (-616.609) * (-619.380) (-617.778) [-618.846] (-616.624) -- 0:00:45
222500 -- (-618.140) (-617.493) [-617.704] (-620.598) * (-620.823) (-621.488) [-617.500] (-619.091) -- 0:00:45
223000 -- (-616.445) (-623.739) (-617.271) [-616.961] * (-620.639) [-617.034] (-618.364) (-618.952) -- 0:00:45
223500 -- (-623.100) [-619.923] (-618.783) (-616.786) * [-617.838] (-620.650) (-619.601) (-618.453) -- 0:00:45
224000 -- [-619.231] (-620.037) (-623.036) (-618.010) * (-619.956) (-618.334) (-620.847) [-617.602] -- 0:00:45
224500 -- (-617.748) [-618.409] (-620.538) (-617.213) * [-617.078] (-623.127) (-615.557) (-617.025) -- 0:00:44
225000 -- (-618.488) [-618.432] (-619.975) (-616.442) * (-619.249) (-621.189) [-616.042] (-617.450) -- 0:00:44
Average standard deviation of split frequencies: 0.016797
225500 -- (-616.358) [-619.159] (-618.670) (-616.253) * (-616.340) (-618.096) (-616.647) [-616.985] -- 0:00:44
226000 -- (-616.877) (-624.098) (-622.962) [-616.175] * [-617.973] (-618.093) (-619.497) (-618.193) -- 0:00:44
226500 -- [-615.879] (-619.270) (-618.894) (-618.203) * (-618.064) (-618.017) (-616.183) [-619.602] -- 0:00:44
227000 -- [-619.809] (-618.407) (-618.879) (-617.497) * (-618.363) [-619.271] (-619.513) (-617.551) -- 0:00:44
227500 -- (-618.148) (-618.087) [-617.978] (-621.647) * (-617.445) (-620.350) [-619.266] (-619.742) -- 0:00:47
228000 -- (-616.461) (-619.515) [-617.766] (-624.933) * (-615.864) (-617.390) [-620.854] (-621.071) -- 0:00:47
228500 -- (-617.256) (-617.121) [-616.750] (-620.305) * (-618.686) [-616.048] (-616.919) (-618.675) -- 0:00:47
229000 -- (-615.951) (-616.372) [-619.586] (-616.157) * (-616.625) (-620.921) (-620.280) [-616.714] -- 0:00:47
229500 -- [-617.309] (-617.942) (-624.261) (-617.005) * (-622.363) (-618.008) [-616.454] (-616.829) -- 0:00:47
230000 -- (-619.150) [-617.317] (-622.672) (-616.227) * [-617.064] (-617.079) (-618.134) (-616.159) -- 0:00:46
Average standard deviation of split frequencies: 0.017258
230500 -- [-616.331] (-617.542) (-617.988) (-616.545) * (-617.589) [-616.113] (-617.953) (-616.015) -- 0:00:46
231000 -- [-616.917] (-617.077) (-617.559) (-619.185) * (-623.620) (-617.116) (-616.102) [-615.988] -- 0:00:46
231500 -- (-621.698) (-620.324) [-616.423] (-617.817) * (-623.680) [-617.081] (-616.337) (-618.692) -- 0:00:46
232000 -- (-618.184) (-617.673) (-620.810) [-621.720] * (-616.828) (-620.927) (-615.863) [-615.785] -- 0:00:46
232500 -- (-615.749) [-616.809] (-618.808) (-617.256) * (-615.935) (-620.125) [-616.382] (-618.278) -- 0:00:46
233000 -- (-618.385) (-616.919) (-616.805) [-615.585] * (-617.702) (-618.441) (-616.783) [-618.587] -- 0:00:46
233500 -- (-620.345) (-618.695) (-617.539) [-616.150] * [-616.463] (-616.613) (-616.233) (-618.802) -- 0:00:45
234000 -- (-617.927) (-618.160) (-616.126) [-616.063] * (-616.552) [-616.326] (-616.354) (-616.644) -- 0:00:45
234500 -- [-616.040] (-617.128) (-616.122) (-617.245) * (-618.848) [-617.165] (-617.617) (-617.312) -- 0:00:45
235000 -- [-616.265] (-616.576) (-615.898) (-617.359) * [-616.457] (-617.981) (-616.440) (-616.856) -- 0:00:45
Average standard deviation of split frequencies: 0.015536
235500 -- (-616.736) (-616.085) (-616.691) [-619.348] * (-617.798) [-617.035] (-616.178) (-617.267) -- 0:00:45
236000 -- (-618.413) (-617.162) (-616.276) [-616.173] * (-616.209) (-616.881) (-616.122) [-618.207] -- 0:00:45
236500 -- (-616.115) (-615.860) [-617.856] (-616.212) * (-617.896) (-618.410) [-616.148] (-619.407) -- 0:00:45
237000 -- (-618.720) (-616.519) (-617.244) [-616.215] * (-617.387) (-617.920) (-616.505) [-619.187] -- 0:00:45
237500 -- (-617.714) (-618.317) [-617.046] (-619.428) * (-617.956) (-618.524) [-619.152] (-619.485) -- 0:00:44
238000 -- [-617.623] (-617.138) (-617.721) (-618.608) * (-615.810) [-618.786] (-616.790) (-617.026) -- 0:00:44
238500 -- (-619.796) (-617.934) [-617.070] (-628.815) * (-618.561) (-618.516) [-617.354] (-618.978) -- 0:00:44
239000 -- (-620.016) [-617.284] (-617.422) (-617.340) * [-616.436] (-618.140) (-616.858) (-617.558) -- 0:00:44
239500 -- (-624.254) [-617.857] (-618.364) (-617.146) * (-620.908) [-621.092] (-621.585) (-617.177) -- 0:00:44
240000 -- (-616.899) (-618.290) [-615.945] (-618.046) * [-621.945] (-619.790) (-621.211) (-618.103) -- 0:00:44
Average standard deviation of split frequencies: 0.015979
240500 -- (-618.281) (-618.363) (-617.014) [-616.927] * (-616.768) (-618.936) [-618.337] (-620.171) -- 0:00:44
241000 -- (-617.120) (-616.713) (-616.720) [-616.889] * [-616.913] (-616.951) (-617.685) (-616.775) -- 0:00:44
241500 -- (-615.932) [-617.961] (-617.298) (-618.172) * (-617.568) (-616.903) (-620.452) [-618.019] -- 0:00:43
242000 -- (-621.912) (-616.433) [-617.401] (-618.923) * [-619.506] (-619.049) (-617.630) (-620.224) -- 0:00:43
242500 -- (-616.865) (-616.066) [-619.649] (-619.454) * (-619.785) [-616.564] (-619.175) (-619.766) -- 0:00:43
243000 -- (-619.304) (-615.770) [-615.884] (-615.966) * (-617.097) (-617.083) [-618.201] (-616.595) -- 0:00:43
243500 -- [-616.245] (-616.498) (-616.116) (-616.269) * (-617.762) [-619.289] (-617.658) (-615.930) -- 0:00:46
244000 -- (-618.000) [-616.523] (-617.338) (-617.380) * (-615.782) (-616.078) (-616.163) [-617.146] -- 0:00:46
244500 -- [-618.736] (-617.162) (-618.144) (-618.035) * (-617.736) [-615.924] (-616.394) (-617.623) -- 0:00:46
245000 -- (-618.902) [-617.174] (-617.554) (-616.427) * [-616.912] (-617.544) (-616.184) (-618.007) -- 0:00:46
Average standard deviation of split frequencies: 0.015734
245500 -- (-617.978) [-619.004] (-619.918) (-616.334) * (-618.731) (-615.406) [-617.597] (-618.093) -- 0:00:46
246000 -- (-617.111) (-618.609) (-617.575) [-616.643] * (-617.767) [-616.206] (-621.712) (-615.734) -- 0:00:45
246500 -- (-615.361) [-617.644] (-620.429) (-619.348) * (-615.907) (-617.709) (-617.572) [-617.541] -- 0:00:45
247000 -- [-617.707] (-616.624) (-617.874) (-617.725) * (-618.040) (-618.993) [-617.053] (-615.646) -- 0:00:45
247500 -- (-618.348) (-617.901) [-615.800] (-617.471) * (-616.468) [-618.949] (-618.859) (-621.239) -- 0:00:45
248000 -- (-617.665) (-616.633) [-619.346] (-616.958) * (-622.927) (-619.005) (-619.805) [-616.458] -- 0:00:45
248500 -- (-617.323) [-618.855] (-617.848) (-616.747) * [-618.539] (-623.056) (-617.181) (-617.256) -- 0:00:45
249000 -- (-618.349) [-616.196] (-616.144) (-617.284) * [-620.261] (-621.357) (-619.853) (-615.940) -- 0:00:45
249500 -- [-617.005] (-617.512) (-615.790) (-617.573) * (-621.573) [-618.625] (-616.169) (-616.092) -- 0:00:45
250000 -- (-618.058) (-618.778) (-618.064) [-617.963] * [-616.480] (-616.995) (-617.341) (-618.934) -- 0:00:45
Average standard deviation of split frequencies: 0.016716
250500 -- (-617.136) [-617.476] (-619.853) (-623.595) * (-621.389) (-618.272) (-617.316) [-616.821] -- 0:00:44
251000 -- (-615.684) (-617.083) (-618.136) [-619.359] * [-618.011] (-620.405) (-616.406) (-617.640) -- 0:00:44
251500 -- [-617.740] (-620.249) (-616.755) (-620.740) * (-616.048) (-619.177) [-617.015] (-616.852) -- 0:00:44
252000 -- [-618.332] (-618.702) (-616.598) (-620.380) * (-615.946) [-616.951] (-621.935) (-618.019) -- 0:00:44
252500 -- (-618.936) [-616.479] (-615.942) (-620.889) * [-617.230] (-622.018) (-617.689) (-617.410) -- 0:00:44
253000 -- (-615.576) [-615.803] (-618.963) (-618.307) * (-616.310) [-620.980] (-616.378) (-616.591) -- 0:00:44
253500 -- (-615.578) (-617.577) (-619.015) [-618.015] * (-615.930) (-617.470) (-617.597) [-617.105] -- 0:00:44
254000 -- (-619.127) (-617.432) [-617.602] (-616.651) * (-619.474) [-616.092] (-621.863) (-617.861) -- 0:00:44
254500 -- [-617.707] (-616.513) (-617.974) (-618.075) * [-618.274] (-616.102) (-620.965) (-617.299) -- 0:00:43
255000 -- [-617.079] (-615.782) (-621.228) (-618.251) * (-616.662) [-616.102] (-617.760) (-619.815) -- 0:00:43
Average standard deviation of split frequencies: 0.017494
255500 -- (-618.290) (-618.188) [-623.508] (-617.245) * [-616.300] (-616.112) (-616.011) (-621.893) -- 0:00:43
256000 -- [-615.986] (-617.829) (-628.644) (-615.593) * [-619.029] (-616.680) (-620.397) (-621.005) -- 0:00:43
256500 -- [-617.658] (-617.999) (-618.034) (-615.628) * (-617.490) [-618.692] (-619.077) (-618.092) -- 0:00:43
257000 -- [-616.993] (-618.729) (-619.461) (-616.526) * (-616.739) [-617.119] (-616.851) (-618.936) -- 0:00:43
257500 -- [-617.658] (-616.899) (-620.745) (-617.644) * [-616.110] (-621.945) (-617.969) (-615.414) -- 0:00:43
258000 -- [-617.149] (-621.609) (-616.425) (-622.608) * (-616.557) (-616.916) (-615.958) [-617.300] -- 0:00:43
258500 -- (-620.001) (-619.893) (-616.805) [-623.030] * (-617.541) (-618.640) (-616.299) [-619.234] -- 0:00:43
259000 -- (-619.379) (-618.517) [-617.328] (-617.334) * (-616.677) [-618.463] (-616.424) (-616.579) -- 0:00:42
259500 -- (-615.647) [-616.266] (-617.888) (-616.193) * (-616.925) (-618.276) [-617.399] (-616.295) -- 0:00:42
260000 -- (-615.559) [-616.742] (-617.938) (-618.673) * [-617.650] (-616.565) (-616.918) (-621.268) -- 0:00:42
Average standard deviation of split frequencies: 0.016808
260500 -- [-616.558] (-616.163) (-618.351) (-617.062) * [-616.443] (-617.140) (-616.597) (-616.001) -- 0:00:45
261000 -- [-618.728] (-617.773) (-615.707) (-616.655) * [-617.130] (-618.627) (-618.013) (-618.836) -- 0:00:45
261500 -- [-618.306] (-620.181) (-616.628) (-618.008) * (-615.865) (-620.745) (-619.461) [-615.729] -- 0:00:45
262000 -- (-617.275) (-617.725) (-616.921) [-618.893] * (-616.333) (-618.745) [-617.304] (-616.684) -- 0:00:45
262500 -- (-616.510) [-617.147] (-619.989) (-619.573) * [-615.961] (-619.203) (-618.286) (-616.194) -- 0:00:44
263000 -- (-618.868) [-616.235] (-623.170) (-619.305) * [-616.532] (-618.254) (-617.843) (-616.336) -- 0:00:44
263500 -- [-618.636] (-618.060) (-616.963) (-616.088) * [-618.860] (-616.113) (-615.804) (-615.957) -- 0:00:44
264000 -- (-616.372) (-617.111) [-619.145] (-621.214) * (-618.378) (-617.971) (-617.425) [-617.088] -- 0:00:44
264500 -- (-616.618) (-617.007) (-617.895) [-618.632] * [-616.318] (-619.961) (-618.003) (-618.770) -- 0:00:44
265000 -- (-618.141) [-617.289] (-619.051) (-616.201) * (-619.055) [-616.771] (-618.396) (-615.903) -- 0:00:44
Average standard deviation of split frequencies: 0.016934
265500 -- (-619.358) [-618.483] (-615.642) (-616.086) * (-615.760) (-617.252) [-616.107] (-618.815) -- 0:00:44
266000 -- [-617.225] (-617.582) (-617.144) (-617.650) * (-618.742) (-617.313) (-616.436) [-616.007] -- 0:00:44
266500 -- (-615.589) (-617.544) (-620.946) [-621.065] * [-616.377] (-616.556) (-615.351) (-618.687) -- 0:00:44
267000 -- (-618.086) (-616.108) [-617.391] (-618.169) * [-620.022] (-620.483) (-618.891) (-618.768) -- 0:00:43
267500 -- (-622.429) (-618.854) (-615.738) [-617.644] * [-617.288] (-617.979) (-617.713) (-617.648) -- 0:00:43
268000 -- (-616.653) (-619.998) [-616.103] (-616.222) * (-619.410) (-615.315) (-617.447) [-620.172] -- 0:00:43
268500 -- (-617.578) (-618.406) (-620.542) [-625.837] * (-619.850) (-616.063) (-617.785) [-618.612] -- 0:00:43
269000 -- [-616.081] (-618.689) (-620.446) (-620.236) * (-617.908) (-616.414) [-622.976] (-617.985) -- 0:00:43
269500 -- [-615.908] (-618.724) (-618.440) (-617.637) * (-617.394) [-616.265] (-615.899) (-617.356) -- 0:00:43
270000 -- (-620.859) [-617.744] (-619.603) (-617.510) * (-619.919) [-619.926] (-616.430) (-620.229) -- 0:00:43
Average standard deviation of split frequencies: 0.017513
270500 -- (-616.004) (-618.920) [-618.484] (-617.573) * (-622.262) (-617.118) (-617.596) [-618.870] -- 0:00:43
271000 -- (-618.913) (-620.005) [-617.327] (-617.947) * [-618.668] (-616.497) (-617.578) (-616.571) -- 0:00:43
271500 -- (-618.687) (-617.185) (-617.199) [-617.129] * (-618.471) [-617.393] (-617.390) (-616.081) -- 0:00:42
272000 -- (-618.390) (-618.020) (-617.628) [-618.446] * (-617.022) [-619.162] (-616.789) (-617.349) -- 0:00:42
272500 -- [-616.230] (-620.732) (-618.879) (-617.201) * [-618.803] (-617.480) (-617.696) (-619.633) -- 0:00:42
273000 -- (-616.380) (-621.271) (-619.295) [-619.519] * (-618.180) (-617.361) [-617.050] (-615.731) -- 0:00:42
273500 -- (-623.282) (-621.741) [-616.687] (-617.020) * (-617.049) (-617.461) [-616.066] (-616.393) -- 0:00:42
274000 -- (-616.418) [-619.154] (-618.932) (-615.693) * (-618.555) (-622.594) [-617.260] (-616.825) -- 0:00:42
274500 -- (-618.269) (-616.066) [-618.099] (-616.927) * (-615.957) [-618.396] (-617.363) (-617.303) -- 0:00:42
275000 -- [-619.785] (-615.914) (-616.488) (-617.723) * (-619.854) (-615.695) [-616.874] (-617.707) -- 0:00:42
Average standard deviation of split frequencies: 0.016226
275500 -- (-620.109) (-616.474) (-617.047) [-617.789] * (-618.658) (-618.249) [-620.166] (-616.969) -- 0:00:42
276000 -- [-615.719] (-616.162) (-618.754) (-618.447) * (-617.014) (-617.348) [-617.869] (-616.128) -- 0:00:41
276500 -- (-618.648) [-616.379] (-619.449) (-616.091) * [-618.354] (-617.514) (-619.949) (-616.892) -- 0:00:41
277000 -- [-615.352] (-615.613) (-616.432) (-616.102) * [-622.773] (-619.254) (-616.494) (-617.559) -- 0:00:44
277500 -- (-615.646) (-618.240) (-617.011) [-616.034] * (-622.443) (-616.995) (-620.249) [-619.427] -- 0:00:44
278000 -- [-615.708] (-619.905) (-622.036) (-617.102) * (-616.377) [-616.279] (-619.999) (-621.567) -- 0:00:44
278500 -- (-615.912) [-617.776] (-620.606) (-615.963) * [-616.471] (-626.644) (-619.240) (-621.037) -- 0:00:44
279000 -- (-619.593) [-617.751] (-616.451) (-617.853) * (-617.259) [-626.095] (-617.745) (-618.187) -- 0:00:43
279500 -- (-616.778) [-615.712] (-616.255) (-617.653) * (-618.600) [-616.219] (-621.664) (-620.227) -- 0:00:43
280000 -- [-618.137] (-619.580) (-621.135) (-618.492) * (-617.134) [-617.790] (-619.806) (-618.468) -- 0:00:43
Average standard deviation of split frequencies: 0.017356
280500 -- (-618.662) (-618.475) (-616.184) [-619.607] * (-615.785) [-619.857] (-618.149) (-619.759) -- 0:00:43
281000 -- (-621.143) (-616.310) (-620.391) [-617.328] * [-617.313] (-619.024) (-620.123) (-617.159) -- 0:00:43
281500 -- [-616.487] (-623.862) (-620.621) (-615.889) * (-616.854) [-617.005] (-616.971) (-616.492) -- 0:00:43
282000 -- (-618.281) (-618.289) [-620.197] (-616.659) * (-621.403) [-620.139] (-617.533) (-619.098) -- 0:00:43
282500 -- (-617.243) (-617.402) (-618.097) [-618.407] * (-620.000) (-616.243) (-619.935) [-617.025] -- 0:00:43
283000 -- [-618.707] (-616.883) (-620.839) (-617.524) * (-618.041) [-616.483] (-621.863) (-620.886) -- 0:00:43
283500 -- (-619.878) (-616.595) (-617.896) [-615.390] * [-616.985] (-617.533) (-617.124) (-617.756) -- 0:00:42
284000 -- [-616.883] (-619.095) (-622.937) (-618.327) * (-619.025) (-616.351) [-618.116] (-617.980) -- 0:00:42
284500 -- [-617.372] (-617.515) (-615.869) (-619.284) * (-616.900) (-615.679) [-615.681] (-620.265) -- 0:00:42
285000 -- (-617.211) (-615.359) [-618.447] (-616.741) * [-616.629] (-618.227) (-620.090) (-618.008) -- 0:00:42
Average standard deviation of split frequencies: 0.016483
285500 -- (-619.860) [-620.050] (-616.231) (-619.272) * (-615.286) [-616.540] (-622.182) (-619.673) -- 0:00:42
286000 -- [-618.687] (-618.289) (-618.502) (-616.932) * (-621.073) (-617.372) (-617.934) [-618.732] -- 0:00:42
286500 -- (-616.867) (-620.163) (-618.890) [-617.214] * [-620.290] (-621.902) (-616.292) (-617.382) -- 0:00:42
287000 -- (-619.794) (-619.661) (-617.733) [-615.902] * [-618.126] (-617.482) (-620.511) (-621.817) -- 0:00:42
287500 -- (-619.417) (-616.470) (-620.459) [-615.790] * [-615.930] (-616.280) (-618.225) (-621.672) -- 0:00:42
288000 -- (-620.032) [-616.140] (-618.991) (-616.503) * (-619.477) (-616.599) (-619.936) [-617.035] -- 0:00:42
288500 -- (-617.046) [-616.344] (-618.525) (-625.594) * (-618.658) (-616.709) (-620.997) [-616.236] -- 0:00:41
289000 -- (-616.538) (-616.271) (-620.639) [-616.956] * (-616.863) (-620.839) (-616.245) [-616.225] -- 0:00:41
289500 -- (-616.704) [-617.531] (-619.669) (-615.940) * (-616.063) (-620.798) [-617.344] (-617.761) -- 0:00:41
290000 -- (-615.812) (-617.170) (-616.816) [-617.084] * (-619.202) [-620.206] (-616.563) (-616.788) -- 0:00:41
Average standard deviation of split frequencies: 0.017209
290500 -- (-615.770) [-617.482] (-617.049) (-616.555) * (-620.965) [-620.411] (-615.734) (-617.706) -- 0:00:41
291000 -- (-620.079) [-617.517] (-618.777) (-618.174) * (-616.514) [-617.937] (-616.650) (-617.962) -- 0:00:41
291500 -- [-619.270] (-617.370) (-618.274) (-616.370) * (-619.900) (-618.248) (-617.122) [-618.021] -- 0:00:41
292000 -- (-623.366) (-615.866) [-618.481] (-618.128) * (-617.178) [-616.113] (-617.348) (-616.306) -- 0:00:41
292500 -- (-617.839) [-618.310] (-617.427) (-621.377) * (-619.591) [-616.276] (-616.714) (-618.958) -- 0:00:41
293000 -- (-617.071) [-618.529] (-619.029) (-622.334) * [-616.915] (-615.912) (-616.381) (-618.717) -- 0:00:41
293500 -- (-615.467) (-615.920) [-619.113] (-619.396) * (-616.515) (-617.418) [-619.335] (-620.528) -- 0:00:40
294000 -- (-615.997) [-616.247] (-619.702) (-617.642) * (-618.055) (-617.115) (-617.125) [-616.077] -- 0:00:43
294500 -- [-619.870] (-616.869) (-618.561) (-616.195) * (-616.303) [-617.118] (-619.130) (-624.015) -- 0:00:43
295000 -- (-617.038) (-619.078) (-618.013) [-619.837] * (-618.279) (-617.420) [-623.501] (-621.059) -- 0:00:43
Average standard deviation of split frequencies: 0.017618
295500 -- [-620.068] (-622.039) (-618.639) (-618.262) * (-616.286) [-615.681] (-616.826) (-617.797) -- 0:00:42
296000 -- (-617.456) (-616.402) [-619.166] (-616.866) * (-616.738) (-616.437) [-617.528] (-621.216) -- 0:00:42
296500 -- (-625.349) (-616.062) (-618.008) [-617.286] * (-619.183) (-618.754) [-617.439] (-617.199) -- 0:00:42
297000 -- (-617.589) (-624.116) [-617.549] (-617.367) * (-620.415) [-619.239] (-616.526) (-616.696) -- 0:00:42
297500 -- [-617.531] (-619.294) (-619.024) (-620.331) * (-620.593) (-616.502) [-615.995] (-617.826) -- 0:00:42
298000 -- (-619.984) (-621.681) (-622.247) [-615.608] * (-616.322) (-616.423) (-621.602) [-617.315] -- 0:00:42
298500 -- (-618.226) [-621.642] (-615.479) (-617.058) * (-618.655) [-619.878] (-616.844) (-616.622) -- 0:00:42
299000 -- (-619.729) (-616.358) [-617.807] (-619.320) * (-618.975) (-618.616) [-617.740] (-619.946) -- 0:00:42
299500 -- (-619.651) (-616.844) [-618.780] (-616.923) * (-617.875) (-618.629) [-618.355] (-618.490) -- 0:00:42
300000 -- (-619.683) [-615.649] (-617.214) (-616.569) * [-619.989] (-619.471) (-617.959) (-617.961) -- 0:00:42
Average standard deviation of split frequencies: 0.017638
300500 -- [-615.625] (-618.922) (-618.642) (-616.489) * [-616.770] (-617.943) (-617.275) (-622.561) -- 0:00:41
301000 -- [-615.427] (-616.778) (-615.793) (-620.152) * (-617.661) (-617.737) (-617.993) [-619.053] -- 0:00:41
301500 -- [-618.970] (-619.441) (-617.120) (-619.954) * (-617.192) [-616.543] (-619.036) (-617.883) -- 0:00:41
302000 -- (-622.073) (-616.277) [-617.093] (-624.795) * [-618.129] (-620.511) (-618.406) (-616.461) -- 0:00:41
302500 -- (-617.112) (-616.729) [-620.187] (-626.402) * (-616.925) (-621.536) (-617.416) [-617.349] -- 0:00:41
303000 -- [-617.108] (-616.907) (-616.473) (-625.458) * (-617.427) (-617.877) [-617.652] (-617.088) -- 0:00:41
303500 -- [-618.013] (-616.464) (-616.855) (-617.257) * (-617.848) (-620.718) (-620.519) [-616.983] -- 0:00:41
304000 -- (-617.532) [-616.631] (-618.341) (-617.656) * (-617.928) (-620.275) [-616.388] (-617.798) -- 0:00:41
304500 -- (-616.480) (-616.581) [-618.394] (-619.358) * (-617.281) (-618.578) [-618.593] (-619.225) -- 0:00:41
305000 -- (-617.844) [-617.569] (-615.848) (-620.039) * (-617.155) [-619.156] (-618.818) (-627.306) -- 0:00:41
Average standard deviation of split frequencies: 0.017909
305500 -- (-616.106) [-616.243] (-619.920) (-617.516) * (-620.370) [-618.226] (-617.642) (-623.254) -- 0:00:40
306000 -- (-616.196) (-617.503) [-624.522] (-617.592) * (-618.099) [-620.207] (-618.715) (-623.904) -- 0:00:40
306500 -- (-616.455) (-617.464) [-618.708] (-616.641) * (-616.778) (-618.930) (-618.509) [-621.062] -- 0:00:40
307000 -- (-620.636) [-620.490] (-619.754) (-617.102) * [-617.380] (-620.394) (-618.776) (-620.618) -- 0:00:40
307500 -- [-617.497] (-616.158) (-620.468) (-617.457) * (-617.003) (-616.676) [-618.949] (-620.202) -- 0:00:40
308000 -- (-617.125) [-616.752] (-621.118) (-617.914) * [-615.951] (-615.992) (-622.032) (-617.028) -- 0:00:40
308500 -- (-618.384) (-620.948) (-623.780) [-622.197] * (-618.574) (-615.503) [-617.733] (-616.602) -- 0:00:42
309000 -- [-618.945] (-618.526) (-618.169) (-617.683) * (-620.667) (-619.282) [-618.309] (-617.473) -- 0:00:42
309500 -- [-615.779] (-616.756) (-617.388) (-618.289) * (-618.216) (-620.568) (-616.171) [-619.693] -- 0:00:42
310000 -- (-616.411) [-619.553] (-617.343) (-617.606) * (-618.009) [-616.395] (-618.806) (-619.585) -- 0:00:42
Average standard deviation of split frequencies: 0.016334
310500 -- [-616.825] (-624.037) (-616.348) (-620.960) * (-616.579) [-616.094] (-617.824) (-617.590) -- 0:00:42
311000 -- (-616.017) (-619.365) (-619.489) [-617.430] * (-616.103) (-617.434) [-615.502] (-623.545) -- 0:00:42
311500 -- [-615.931] (-618.194) (-617.341) (-617.919) * [-617.777] (-618.775) (-616.307) (-618.392) -- 0:00:41
312000 -- (-617.280) (-616.272) (-617.325) [-617.417] * (-615.888) [-616.133] (-617.070) (-618.987) -- 0:00:41
312500 -- (-619.337) [-615.313] (-618.624) (-618.316) * [-616.701] (-615.514) (-620.066) (-615.634) -- 0:00:41
313000 -- [-619.218] (-616.849) (-619.266) (-616.018) * (-618.716) (-617.132) (-616.363) [-615.787] -- 0:00:41
313500 -- (-619.209) (-618.623) [-617.028] (-615.581) * [-616.946] (-620.053) (-617.686) (-617.369) -- 0:00:41
314000 -- (-616.664) (-616.572) [-617.192] (-618.054) * [-616.991] (-619.947) (-616.703) (-620.565) -- 0:00:41
314500 -- (-617.027) (-620.644) (-617.388) [-621.837] * [-617.761] (-619.605) (-616.053) (-615.239) -- 0:00:41
315000 -- (-616.429) (-617.641) (-623.197) [-619.234] * (-617.623) [-618.177] (-618.154) (-615.213) -- 0:00:41
Average standard deviation of split frequencies: 0.016876
315500 -- [-619.403] (-620.438) (-618.176) (-618.037) * [-615.801] (-616.982) (-617.245) (-617.554) -- 0:00:41
316000 -- (-620.222) (-617.364) (-617.346) [-617.918] * [-618.641] (-619.944) (-619.035) (-619.143) -- 0:00:41
316500 -- [-617.898] (-619.075) (-617.685) (-617.024) * (-618.783) (-617.450) (-622.954) [-618.367] -- 0:00:41
317000 -- [-619.709] (-618.899) (-616.857) (-617.750) * [-615.770] (-619.314) (-618.783) (-617.846) -- 0:00:40
317500 -- (-618.949) [-617.680] (-616.481) (-618.907) * (-618.581) [-615.532] (-619.506) (-618.103) -- 0:00:40
318000 -- (-617.340) (-619.301) [-619.178] (-619.346) * (-618.938) (-618.070) (-617.897) [-621.758] -- 0:00:40
318500 -- (-616.181) [-619.422] (-619.573) (-619.332) * (-621.089) [-618.244] (-616.693) (-618.934) -- 0:00:40
319000 -- (-617.130) [-616.446] (-616.883) (-616.851) * [-616.930] (-620.958) (-618.676) (-620.629) -- 0:00:40
319500 -- (-618.821) (-622.197) (-616.220) [-617.358] * (-617.928) [-619.656] (-617.197) (-617.374) -- 0:00:40
320000 -- [-618.036] (-618.157) (-616.736) (-617.373) * (-616.523) (-616.778) [-617.726] (-617.080) -- 0:00:40
Average standard deviation of split frequencies: 0.016538
320500 -- (-622.256) (-618.070) (-617.254) [-615.479] * (-621.396) (-617.511) (-617.003) [-619.184] -- 0:00:40
321000 -- [-618.328] (-616.785) (-619.400) (-617.025) * (-622.235) (-616.394) (-622.160) [-621.238] -- 0:00:40
321500 -- [-617.667] (-621.372) (-622.172) (-616.112) * (-620.498) [-620.237] (-617.936) (-619.749) -- 0:00:40
322000 -- (-620.367) (-621.261) (-620.764) [-615.155] * [-616.582] (-620.436) (-622.413) (-615.557) -- 0:00:40
322500 -- (-619.001) [-617.794] (-622.827) (-617.076) * (-617.159) [-621.047] (-619.230) (-617.383) -- 0:00:39
323000 -- (-617.732) (-616.286) [-616.414] (-615.356) * (-620.057) [-620.751] (-618.446) (-618.640) -- 0:00:41
323500 -- (-616.868) (-616.999) (-618.242) [-618.717] * (-618.378) (-618.878) [-616.087] (-619.112) -- 0:00:41
324000 -- (-622.075) [-619.636] (-619.893) (-615.973) * (-618.204) (-621.189) (-616.571) [-616.542] -- 0:00:41
324500 -- [-616.197] (-618.014) (-615.500) (-618.128) * (-618.204) (-615.936) [-616.673] (-617.705) -- 0:00:41
325000 -- (-619.656) (-620.895) [-615.526] (-618.287) * [-619.730] (-618.333) (-616.802) (-615.496) -- 0:00:41
Average standard deviation of split frequencies: 0.016268
325500 -- (-616.882) [-616.687] (-618.262) (-617.382) * [-617.089] (-616.220) (-620.455) (-620.003) -- 0:00:41
326000 -- (-618.357) (-617.786) (-618.985) [-620.486] * (-616.517) [-616.154] (-616.137) (-615.915) -- 0:00:41
326500 -- (-617.258) (-617.552) (-617.974) [-615.769] * (-616.468) (-616.578) [-619.370] (-617.874) -- 0:00:41
327000 -- (-617.684) [-616.928] (-622.549) (-618.675) * (-618.550) (-618.671) [-616.496] (-616.621) -- 0:00:41
327500 -- (-617.438) [-616.049] (-619.789) (-616.814) * [-621.755] (-617.426) (-617.317) (-616.696) -- 0:00:41
328000 -- (-622.061) [-616.975] (-619.346) (-616.986) * (-616.218) (-615.963) (-618.849) [-616.689] -- 0:00:40
328500 -- [-621.230] (-621.290) (-618.524) (-618.668) * [-621.995] (-617.557) (-622.669) (-617.363) -- 0:00:40
329000 -- (-619.113) [-616.700] (-619.628) (-616.892) * (-620.969) (-622.742) (-615.963) [-616.646] -- 0:00:40
329500 -- [-615.973] (-623.703) (-617.643) (-619.539) * [-617.707] (-619.977) (-615.452) (-616.869) -- 0:00:40
330000 -- (-616.787) (-618.041) [-620.826] (-619.715) * (-617.191) (-619.935) (-619.943) [-616.880] -- 0:00:40
Average standard deviation of split frequencies: 0.014969
330500 -- (-615.990) (-617.515) [-619.147] (-616.635) * [-615.499] (-616.710) (-619.214) (-622.325) -- 0:00:40
331000 -- (-616.327) [-616.958] (-617.386) (-615.967) * [-616.089] (-618.148) (-619.249) (-616.857) -- 0:00:40
331500 -- (-616.038) [-616.901] (-617.268) (-618.032) * (-617.976) (-616.214) (-618.708) [-617.450] -- 0:00:40
332000 -- (-618.539) [-617.931] (-616.563) (-621.840) * (-621.081) (-617.686) (-617.574) [-616.588] -- 0:00:40
332500 -- (-616.425) (-618.579) [-617.729] (-616.821) * (-619.259) [-617.258] (-617.411) (-616.876) -- 0:00:40
333000 -- (-616.451) (-620.395) [-617.759] (-619.030) * [-618.727] (-618.315) (-618.027) (-618.242) -- 0:00:40
333500 -- (-619.728) (-617.705) [-617.561] (-617.215) * (-620.824) [-616.621] (-622.808) (-618.756) -- 0:00:39
334000 -- (-618.863) [-615.835] (-620.269) (-617.319) * [-617.839] (-619.252) (-616.319) (-620.600) -- 0:00:39
334500 -- [-616.262] (-617.116) (-617.972) (-617.339) * [-617.326] (-618.842) (-617.537) (-617.954) -- 0:00:39
335000 -- (-617.096) [-616.620] (-616.900) (-618.067) * (-617.500) (-618.645) (-615.791) [-617.852] -- 0:00:39
Average standard deviation of split frequencies: 0.015020
335500 -- (-621.233) (-615.674) (-616.936) [-617.815] * (-617.450) (-617.907) (-617.443) [-618.137] -- 0:00:39
336000 -- [-616.162] (-615.947) (-619.876) (-616.841) * (-620.405) (-620.122) (-616.337) [-617.757] -- 0:00:39
336500 -- [-617.633] (-616.975) (-618.289) (-615.670) * [-616.823] (-618.599) (-618.085) (-617.046) -- 0:00:39
337000 -- (-615.544) (-615.975) (-617.915) [-615.626] * [-615.841] (-616.548) (-616.532) (-619.424) -- 0:00:39
337500 -- [-616.182] (-617.260) (-617.648) (-616.806) * [-616.296] (-627.072) (-621.987) (-618.948) -- 0:00:39
338000 -- (-617.250) [-616.946] (-616.823) (-616.253) * [-617.502] (-619.637) (-620.409) (-618.996) -- 0:00:41
338500 -- (-622.761) (-617.132) [-617.031] (-621.357) * (-615.797) (-617.667) [-616.105] (-619.352) -- 0:00:41
339000 -- (-620.364) [-618.211] (-617.400) (-617.020) * (-616.165) (-616.662) [-620.344] (-616.819) -- 0:00:40
339500 -- (-619.493) [-617.008] (-618.897) (-615.803) * [-621.475] (-616.676) (-620.153) (-620.740) -- 0:00:40
340000 -- [-617.225] (-618.204) (-616.716) (-621.535) * (-617.915) [-618.792] (-618.875) (-620.113) -- 0:00:40
Average standard deviation of split frequencies: 0.014407
340500 -- (-621.959) (-619.935) (-620.231) [-621.873] * (-620.850) [-619.090] (-618.536) (-619.539) -- 0:00:40
341000 -- (-622.922) [-616.429] (-621.055) (-624.163) * (-616.659) (-617.686) [-617.109] (-620.573) -- 0:00:40
341500 -- (-617.369) [-618.056] (-619.523) (-620.859) * (-617.910) [-617.550] (-616.515) (-616.919) -- 0:00:40
342000 -- (-618.425) (-617.490) [-622.320] (-616.721) * (-617.622) (-618.053) [-617.711] (-617.688) -- 0:00:40
342500 -- (-618.631) (-616.107) [-616.888] (-617.707) * [-618.124] (-616.939) (-619.175) (-616.095) -- 0:00:40
343000 -- (-619.891) [-616.355] (-618.177) (-618.282) * (-617.934) (-616.910) [-618.251] (-615.974) -- 0:00:40
343500 -- (-618.982) [-615.522] (-617.441) (-617.369) * (-616.204) (-620.670) (-616.856) [-616.648] -- 0:00:40
344000 -- (-617.819) (-619.537) (-618.496) [-617.943] * (-617.536) (-617.693) [-619.120] (-618.176) -- 0:00:40
344500 -- (-620.429) [-620.231] (-615.728) (-618.189) * (-619.209) (-617.182) [-615.553] (-617.380) -- 0:00:39
345000 -- [-617.146] (-621.792) (-621.978) (-618.626) * (-618.254) [-621.814] (-616.898) (-619.887) -- 0:00:39
Average standard deviation of split frequencies: 0.015138
345500 -- (-616.015) [-617.499] (-619.869) (-616.323) * [-618.023] (-617.300) (-616.112) (-617.704) -- 0:00:39
346000 -- [-618.090] (-618.268) (-616.040) (-618.835) * (-617.962) (-620.999) (-620.748) [-617.395] -- 0:00:39
346500 -- [-616.581] (-616.917) (-618.341) (-616.442) * (-616.566) (-616.262) [-618.369] (-616.769) -- 0:00:39
347000 -- (-616.735) (-616.436) [-616.167] (-618.098) * (-617.084) (-617.226) (-618.419) [-616.200] -- 0:00:39
347500 -- (-617.420) (-616.783) [-618.674] (-620.574) * [-618.443] (-617.521) (-615.626) (-617.791) -- 0:00:39
348000 -- [-616.320] (-620.003) (-617.114) (-618.007) * (-618.276) [-619.020] (-616.368) (-618.373) -- 0:00:39
348500 -- (-615.803) (-619.204) (-624.917) [-617.726] * (-616.712) (-617.127) [-616.070] (-617.329) -- 0:00:39
349000 -- (-615.423) (-621.840) (-619.204) [-620.045] * (-617.437) (-619.024) [-619.625] (-617.499) -- 0:00:39
349500 -- (-616.842) (-620.244) [-620.396] (-619.420) * (-621.541) (-620.524) (-623.294) [-616.028] -- 0:00:39
350000 -- [-617.172] (-622.682) (-618.398) (-616.930) * (-620.826) [-618.685] (-625.431) (-615.753) -- 0:00:39
Average standard deviation of split frequencies: 0.014115
350500 -- [-617.559] (-621.801) (-619.674) (-619.071) * [-623.280] (-617.477) (-616.884) (-615.678) -- 0:00:38
351000 -- (-617.936) [-618.675] (-620.499) (-617.400) * [-616.910] (-617.259) (-617.974) (-619.166) -- 0:00:38
351500 -- (-618.569) (-617.050) (-619.465) [-618.102] * (-616.883) (-620.274) (-616.781) [-618.035] -- 0:00:38
352000 -- (-616.970) [-619.945] (-621.573) (-616.150) * (-616.237) (-617.691) [-618.779] (-617.781) -- 0:00:38
352500 -- (-616.361) (-617.723) (-622.360) [-615.977] * (-616.949) (-617.484) (-619.392) [-616.293] -- 0:00:38
353000 -- (-616.772) [-618.607] (-617.671) (-616.936) * (-615.808) [-618.257] (-616.702) (-617.095) -- 0:00:38
353500 -- (-618.950) [-618.026] (-616.587) (-616.288) * [-621.257] (-616.695) (-619.050) (-621.704) -- 0:00:38
354000 -- (-617.556) (-616.760) (-618.616) [-621.442] * (-619.993) (-617.436) [-616.066] (-615.599) -- 0:00:38
354500 -- (-617.778) [-617.718] (-622.802) (-618.231) * (-618.668) [-615.811] (-616.490) (-617.154) -- 0:00:40
355000 -- (-617.817) (-617.040) [-617.079] (-617.786) * (-617.469) (-618.507) [-617.211] (-618.168) -- 0:00:39
Average standard deviation of split frequencies: 0.013830
355500 -- [-615.843] (-616.872) (-618.606) (-618.569) * (-619.273) [-617.851] (-616.793) (-616.127) -- 0:00:39
356000 -- (-615.309) (-616.697) (-617.547) [-618.664] * (-623.336) [-618.334] (-617.767) (-618.533) -- 0:00:39
356500 -- (-616.302) (-618.566) (-622.778) [-620.018] * [-621.106] (-617.904) (-616.650) (-620.956) -- 0:00:39
357000 -- [-617.264] (-620.548) (-616.110) (-621.010) * (-618.029) [-616.527] (-616.767) (-619.088) -- 0:00:39
357500 -- (-615.755) [-618.113] (-618.377) (-615.942) * (-618.627) (-618.529) (-618.346) [-616.416] -- 0:00:39
358000 -- (-622.569) [-617.025] (-618.589) (-615.862) * (-618.528) (-616.527) (-616.735) [-616.678] -- 0:00:39
358500 -- (-619.317) (-616.773) (-622.823) [-618.819] * (-616.526) (-617.322) (-616.125) [-620.113] -- 0:00:39
359000 -- [-617.121] (-617.733) (-616.758) (-617.646) * (-617.589) [-616.801] (-618.391) (-621.613) -- 0:00:39
359500 -- [-616.245] (-617.276) (-616.922) (-617.596) * (-616.361) (-617.346) [-618.841] (-616.690) -- 0:00:39
360000 -- (-617.999) (-617.267) [-620.437] (-625.690) * (-617.492) (-617.574) (-620.011) [-619.892] -- 0:00:39
Average standard deviation of split frequencies: 0.013002
360500 -- (-617.890) (-617.244) (-617.244) [-622.007] * (-618.513) (-616.423) (-617.513) [-617.017] -- 0:00:39
361000 -- (-617.594) (-617.061) [-618.073] (-620.357) * (-617.521) (-616.414) (-618.502) [-615.940] -- 0:00:38
361500 -- (-617.774) [-615.884] (-616.085) (-616.122) * (-617.306) [-615.671] (-616.060) (-615.875) -- 0:00:38
362000 -- (-619.703) [-616.520] (-617.861) (-616.121) * [-616.768] (-618.361) (-615.927) (-616.869) -- 0:00:38
362500 -- (-616.541) (-619.323) (-617.801) [-619.037] * (-617.891) (-616.914) (-617.068) [-616.695] -- 0:00:38
363000 -- (-622.647) [-622.216] (-615.415) (-617.644) * [-618.833] (-616.902) (-616.787) (-617.467) -- 0:00:38
363500 -- (-619.255) [-617.403] (-618.860) (-616.055) * (-618.720) [-616.311] (-628.433) (-618.566) -- 0:00:38
364000 -- [-618.285] (-618.545) (-617.755) (-617.368) * (-618.568) (-621.203) [-619.054] (-617.687) -- 0:00:38
364500 -- (-619.690) [-616.578] (-618.093) (-615.836) * (-619.549) [-617.846] (-616.779) (-615.814) -- 0:00:38
365000 -- (-616.728) [-617.399] (-616.730) (-618.286) * (-619.595) [-616.173] (-616.683) (-619.547) -- 0:00:38
Average standard deviation of split frequencies: 0.013151
365500 -- (-618.030) (-617.292) [-617.059] (-616.326) * [-619.400] (-616.587) (-619.746) (-619.305) -- 0:00:38
366000 -- (-617.760) (-616.633) (-619.755) [-616.306] * (-617.443) (-617.047) (-619.434) [-617.756] -- 0:00:38
366500 -- (-619.526) (-616.596) (-622.961) [-615.774] * (-617.954) [-616.874] (-616.864) (-621.685) -- 0:00:38
367000 -- (-622.760) (-617.643) (-619.447) [-616.481] * (-618.449) (-618.453) [-617.098] (-618.736) -- 0:00:37
367500 -- (-621.385) (-618.673) [-616.970] (-616.840) * (-617.226) (-616.790) [-616.814] (-619.701) -- 0:00:37
368000 -- [-617.032] (-617.609) (-616.242) (-617.788) * [-617.762] (-618.805) (-617.475) (-620.337) -- 0:00:37
368500 -- [-616.760] (-623.886) (-617.119) (-618.681) * [-616.711] (-616.718) (-616.941) (-617.909) -- 0:00:37
369000 -- (-617.668) (-615.929) (-616.996) [-615.909] * [-616.846] (-618.539) (-618.545) (-617.133) -- 0:00:37
369500 -- (-617.847) [-616.184] (-616.706) (-619.028) * (-617.338) [-617.549] (-616.047) (-617.697) -- 0:00:37
370000 -- (-619.285) [-616.402] (-621.511) (-617.227) * (-618.271) [-618.502] (-615.913) (-620.320) -- 0:00:37
Average standard deviation of split frequencies: 0.014190
370500 -- [-616.690] (-617.077) (-618.679) (-618.753) * (-617.149) (-620.455) [-615.748] (-616.971) -- 0:00:37
371000 -- (-616.958) (-617.576) (-623.304) [-616.267] * (-618.578) (-616.748) [-618.486] (-617.454) -- 0:00:38
371500 -- (-618.473) (-617.602) (-619.336) [-619.585] * [-615.273] (-618.115) (-617.169) (-619.348) -- 0:00:38
372000 -- (-629.178) (-616.983) (-619.363) [-618.222] * (-615.906) [-616.487] (-616.793) (-619.754) -- 0:00:38
372500 -- (-626.095) (-618.239) (-617.409) [-616.184] * (-615.637) (-616.645) (-616.040) [-617.738] -- 0:00:38
373000 -- (-619.323) (-618.643) (-625.565) [-617.689] * (-618.153) [-622.413] (-617.297) (-615.760) -- 0:00:38
373500 -- [-616.468] (-625.918) (-621.515) (-619.703) * (-616.295) [-621.174] (-618.936) (-616.714) -- 0:00:38
374000 -- (-616.279) (-621.374) (-622.002) [-617.172] * (-616.847) (-621.370) [-617.356] (-618.986) -- 0:00:38
374500 -- [-617.067] (-625.262) (-618.909) (-617.344) * (-616.345) [-616.145] (-621.769) (-616.646) -- 0:00:38
375000 -- (-617.373) [-622.610] (-617.281) (-617.181) * (-619.070) (-618.033) [-616.065] (-615.885) -- 0:00:38
Average standard deviation of split frequencies: 0.013923
375500 -- (-620.146) (-620.590) (-615.728) [-618.413] * (-620.456) [-624.551] (-619.235) (-615.384) -- 0:00:38
376000 -- (-617.836) (-616.255) (-618.020) [-616.841] * (-620.273) [-620.125] (-615.981) (-615.324) -- 0:00:38
376500 -- (-617.639) (-616.010) [-615.573] (-617.804) * [-617.394] (-621.438) (-616.829) (-617.408) -- 0:00:38
377000 -- (-616.860) (-618.655) [-617.295] (-621.659) * [-618.503] (-618.396) (-616.570) (-615.624) -- 0:00:38
377500 -- (-615.353) (-616.781) [-618.879] (-620.900) * (-620.017) [-616.383] (-616.927) (-616.055) -- 0:00:37
378000 -- [-616.136] (-617.846) (-619.230) (-617.450) * (-619.079) (-619.421) [-617.713] (-617.338) -- 0:00:37
378500 -- (-616.879) [-616.698] (-618.319) (-625.935) * (-618.499) [-617.002] (-616.520) (-617.582) -- 0:00:37
379000 -- (-616.427) [-616.884] (-618.493) (-618.637) * (-616.759) (-617.322) (-619.340) [-616.292] -- 0:00:37
379500 -- (-619.054) (-618.762) (-617.801) [-619.044] * (-616.564) (-616.069) [-618.768] (-619.685) -- 0:00:37
380000 -- (-621.793) (-621.326) (-616.616) [-618.133] * (-616.472) (-621.667) [-617.025] (-617.376) -- 0:00:37
Average standard deviation of split frequencies: 0.012905
380500 -- (-617.708) (-615.912) [-618.380] (-618.113) * (-616.070) (-619.963) [-617.684] (-616.934) -- 0:00:37
381000 -- (-617.285) [-615.473] (-616.375) (-617.138) * (-617.832) [-616.659] (-622.678) (-618.174) -- 0:00:37
381500 -- (-618.089) [-619.960] (-616.582) (-616.002) * (-618.700) (-617.838) [-615.645] (-616.228) -- 0:00:37
382000 -- [-620.230] (-616.682) (-616.551) (-616.722) * (-617.544) [-617.487] (-616.726) (-617.438) -- 0:00:37
382500 -- (-619.829) (-616.919) [-620.521] (-617.341) * [-616.837] (-616.905) (-618.546) (-617.365) -- 0:00:37
383000 -- (-620.935) (-617.830) [-617.700] (-616.750) * (-616.815) (-615.484) [-615.815] (-618.732) -- 0:00:37
383500 -- [-618.658] (-617.528) (-617.144) (-622.208) * (-617.908) [-617.840] (-618.756) (-620.217) -- 0:00:36
384000 -- (-616.621) [-618.066] (-620.854) (-616.502) * (-619.789) (-617.860) [-615.905] (-617.690) -- 0:00:36
384500 -- (-617.734) (-617.726) [-616.991] (-617.627) * (-619.899) [-617.891] (-615.827) (-617.741) -- 0:00:36
385000 -- (-618.169) (-621.168) (-618.022) [-625.762] * (-617.174) (-615.762) (-619.122) [-615.872] -- 0:00:36
Average standard deviation of split frequencies: 0.012470
385500 -- (-618.216) [-619.137] (-618.158) (-615.952) * (-616.654) (-615.876) [-617.153] (-618.913) -- 0:00:36
386000 -- (-617.477) (-616.902) [-621.296] (-616.246) * [-620.307] (-616.993) (-615.592) (-615.615) -- 0:00:36
386500 -- (-615.970) (-616.749) (-622.284) [-617.265] * (-618.077) (-616.483) [-618.669] (-617.407) -- 0:00:36
387000 -- [-618.805] (-622.189) (-620.844) (-616.529) * (-617.080) (-615.960) (-619.195) [-617.433] -- 0:00:36
387500 -- [-622.186] (-619.557) (-617.633) (-615.805) * (-617.292) (-615.697) [-616.958] (-617.401) -- 0:00:36
388000 -- [-622.667] (-618.146) (-621.594) (-617.002) * (-618.490) (-618.620) (-616.622) [-618.410] -- 0:00:37
388500 -- [-619.007] (-619.896) (-619.059) (-620.309) * (-618.136) [-617.610] (-616.821) (-616.285) -- 0:00:37
389000 -- (-617.336) [-619.592] (-624.029) (-617.919) * (-617.147) (-617.675) (-616.724) [-616.378] -- 0:00:37
389500 -- (-616.434) (-621.096) (-619.371) [-616.060] * [-615.475] (-618.122) (-616.721) (-616.633) -- 0:00:37
390000 -- (-617.125) [-618.537] (-620.060) (-616.609) * [-617.617] (-617.620) (-617.134) (-618.950) -- 0:00:37
Average standard deviation of split frequencies: 0.014125
390500 -- (-619.274) (-616.857) [-619.308] (-617.539) * (-618.000) [-618.110] (-617.110) (-619.581) -- 0:00:37
391000 -- (-619.385) [-618.725] (-617.347) (-620.010) * (-616.568) [-615.915] (-619.682) (-619.455) -- 0:00:37
391500 -- [-616.830] (-618.653) (-620.181) (-615.965) * (-617.340) (-620.329) (-615.485) [-621.366] -- 0:00:37
392000 -- (-619.973) (-617.961) (-617.157) [-617.898] * (-619.465) [-617.134] (-616.566) (-620.764) -- 0:00:37
392500 -- (-616.223) [-618.033] (-617.659) (-618.823) * [-619.702] (-617.918) (-620.050) (-616.028) -- 0:00:37
393000 -- (-617.419) (-618.768) (-620.977) [-618.338] * [-617.808] (-618.089) (-616.916) (-620.225) -- 0:00:37
393500 -- (-617.649) [-616.595] (-619.328) (-618.895) * [-621.866] (-617.147) (-618.361) (-619.403) -- 0:00:36
394000 -- [-618.412] (-617.812) (-617.505) (-617.378) * (-619.809) [-619.685] (-621.391) (-617.962) -- 0:00:36
394500 -- [-616.116] (-619.855) (-617.026) (-616.794) * (-620.352) (-620.038) [-619.402] (-617.963) -- 0:00:36
395000 -- (-616.444) [-617.969] (-618.092) (-616.196) * (-619.010) [-618.879] (-618.939) (-616.661) -- 0:00:36
Average standard deviation of split frequencies: 0.013025
395500 -- (-616.217) (-619.001) (-619.858) [-616.314] * [-617.689] (-619.535) (-623.325) (-616.790) -- 0:00:36
396000 -- (-618.354) (-620.256) [-616.142] (-616.472) * [-617.011] (-618.447) (-621.008) (-618.441) -- 0:00:36
396500 -- (-616.303) [-618.875] (-616.875) (-618.965) * (-621.866) [-619.198] (-618.700) (-618.746) -- 0:00:36
397000 -- (-616.867) [-620.207] (-616.964) (-621.195) * [-617.421] (-618.661) (-617.216) (-617.309) -- 0:00:36
397500 -- (-616.585) (-616.967) [-615.756] (-617.744) * [-619.486] (-618.339) (-619.189) (-616.555) -- 0:00:36
398000 -- (-619.384) (-620.186) [-615.890] (-623.521) * [-616.477] (-618.056) (-617.345) (-617.496) -- 0:00:36
398500 -- (-616.995) (-617.572) [-616.632] (-617.596) * [-617.140] (-620.166) (-616.981) (-621.325) -- 0:00:36
399000 -- [-620.854] (-619.865) (-616.244) (-616.948) * [-616.434] (-616.020) (-616.487) (-618.088) -- 0:00:36
399500 -- (-618.379) [-619.995] (-617.625) (-618.428) * (-619.665) [-618.992] (-617.762) (-616.735) -- 0:00:36
400000 -- (-616.040) (-620.464) [-618.620] (-617.350) * (-619.218) [-615.839] (-617.450) (-618.687) -- 0:00:36
Average standard deviation of split frequencies: 0.014119
400500 -- (-618.674) [-616.909] (-616.001) (-619.420) * [-615.357] (-615.955) (-616.973) (-621.511) -- 0:00:35
401000 -- (-618.167) [-617.536] (-617.917) (-617.367) * (-615.374) (-618.235) [-620.411] (-616.287) -- 0:00:35
401500 -- (-617.532) (-619.460) [-616.547] (-622.552) * (-616.409) [-616.079] (-617.858) (-619.728) -- 0:00:35
402000 -- (-618.299) (-616.835) (-620.900) [-618.995] * [-615.446] (-617.286) (-617.096) (-617.391) -- 0:00:35
402500 -- [-616.801] (-616.103) (-619.267) (-617.550) * [-616.553] (-616.857) (-620.915) (-616.402) -- 0:00:35
403000 -- (-616.391) [-617.732] (-619.502) (-618.366) * (-616.560) (-617.678) [-617.062] (-617.807) -- 0:00:35
403500 -- [-617.919] (-620.861) (-623.325) (-618.992) * (-617.766) [-615.992] (-619.935) (-621.521) -- 0:00:35
404000 -- (-618.694) (-618.821) [-619.245] (-620.564) * [-618.371] (-616.115) (-615.668) (-620.474) -- 0:00:35
404500 -- [-618.632] (-618.161) (-619.189) (-616.906) * [-618.771] (-617.663) (-615.834) (-615.810) -- 0:00:36
405000 -- [-617.644] (-619.750) (-618.378) (-622.015) * [-617.552] (-618.918) (-617.012) (-617.451) -- 0:00:36
Average standard deviation of split frequencies: 0.013250
405500 -- (-618.287) [-616.375] (-616.536) (-618.965) * (-616.520) (-621.604) (-618.626) [-618.577] -- 0:00:36
406000 -- (-620.190) [-618.680] (-617.063) (-616.955) * (-619.971) [-621.708] (-617.701) (-616.756) -- 0:00:36
406500 -- [-615.880] (-616.103) (-618.280) (-616.645) * [-618.957] (-617.868) (-617.773) (-621.299) -- 0:00:36
407000 -- (-616.116) [-619.603] (-617.134) (-618.686) * (-616.781) (-617.149) [-618.209] (-621.627) -- 0:00:36
407500 -- (-616.714) [-618.490] (-619.784) (-617.856) * (-615.957) [-615.279] (-626.082) (-620.189) -- 0:00:36
408000 -- (-616.564) (-616.887) [-617.840] (-617.570) * [-617.174] (-615.662) (-618.869) (-618.432) -- 0:00:36
408500 -- (-616.682) (-618.849) [-616.201] (-619.390) * (-618.033) (-619.831) (-621.401) [-618.120] -- 0:00:36
409000 -- (-616.551) (-619.815) (-617.996) [-621.157] * (-617.144) (-619.895) (-619.175) [-618.486] -- 0:00:36
409500 -- [-617.323] (-616.197) (-617.694) (-616.971) * (-616.966) (-616.578) [-617.241] (-617.200) -- 0:00:36
410000 -- (-622.274) (-615.824) [-617.007] (-617.197) * (-621.823) [-616.593] (-620.760) (-617.321) -- 0:00:35
Average standard deviation of split frequencies: 0.014134
410500 -- (-618.469) (-617.762) [-617.518] (-616.007) * (-619.576) [-615.727] (-617.012) (-619.955) -- 0:00:35
411000 -- (-616.814) (-619.035) (-618.195) [-616.359] * (-617.797) [-617.879] (-617.697) (-616.985) -- 0:00:35
411500 -- (-616.517) (-617.837) [-618.102] (-617.813) * [-616.890] (-622.214) (-617.657) (-616.107) -- 0:00:35
412000 -- [-617.669] (-617.756) (-618.538) (-616.464) * (-622.513) (-626.563) (-615.774) [-618.332] -- 0:00:35
412500 -- (-616.772) (-617.394) [-618.712] (-617.606) * (-621.721) (-622.057) [-618.519] (-617.380) -- 0:00:35
413000 -- [-618.182] (-620.072) (-620.910) (-621.278) * [-616.636] (-619.980) (-617.486) (-617.966) -- 0:00:35
413500 -- [-617.730] (-619.058) (-616.561) (-619.993) * (-615.630) (-618.051) [-620.064] (-618.765) -- 0:00:35
414000 -- (-617.599) [-618.141] (-616.505) (-617.507) * (-616.286) [-618.081] (-619.650) (-617.647) -- 0:00:35
414500 -- (-616.497) (-616.714) (-615.820) [-621.555] * (-616.943) [-615.926] (-620.106) (-617.755) -- 0:00:35
415000 -- (-616.027) [-615.780] (-619.185) (-618.011) * [-617.102] (-618.533) (-620.014) (-617.650) -- 0:00:35
Average standard deviation of split frequencies: 0.013386
415500 -- (-618.815) [-616.167] (-616.282) (-617.327) * [-616.949] (-617.163) (-619.909) (-618.373) -- 0:00:35
416000 -- (-617.983) [-615.538] (-623.475) (-618.148) * (-617.134) (-621.105) [-618.600] (-619.307) -- 0:00:35
416500 -- (-618.367) (-617.596) [-616.608] (-617.050) * [-617.445] (-619.804) (-624.971) (-619.115) -- 0:00:35
417000 -- (-616.951) (-616.814) [-616.622] (-616.290) * (-618.238) (-620.625) (-617.252) [-617.480] -- 0:00:34
417500 -- (-615.579) (-616.250) [-616.768] (-620.600) * [-618.797] (-617.831) (-616.680) (-616.985) -- 0:00:34
418000 -- (-616.378) (-615.982) (-617.373) [-617.560] * (-618.304) (-617.084) [-616.367] (-617.412) -- 0:00:34
418500 -- (-616.341) (-616.006) (-617.239) [-616.875] * [-616.716] (-618.995) (-617.603) (-618.894) -- 0:00:34
419000 -- (-617.262) (-618.410) (-621.986) [-616.343] * (-616.238) (-619.716) [-619.247] (-619.541) -- 0:00:34
419500 -- (-615.812) [-616.808] (-617.489) (-616.501) * (-616.152) (-616.419) (-619.319) [-618.079] -- 0:00:34
420000 -- (-616.061) (-619.215) (-617.552) [-617.049] * (-615.538) (-618.266) (-616.017) [-619.295] -- 0:00:34
Average standard deviation of split frequencies: 0.012986
420500 -- (-618.402) (-619.559) (-616.808) [-622.346] * [-619.205] (-618.342) (-619.333) (-623.059) -- 0:00:34
421000 -- (-619.184) [-617.725] (-616.448) (-617.667) * (-616.674) [-616.949] (-616.771) (-620.769) -- 0:00:34
421500 -- (-617.535) (-616.924) (-616.179) [-616.631] * (-620.293) (-621.036) [-617.342] (-618.257) -- 0:00:35
422000 -- (-617.908) [-616.649] (-617.230) (-615.557) * (-619.381) (-618.328) (-617.830) [-616.718] -- 0:00:35
422500 -- [-616.019] (-625.710) (-619.223) (-624.586) * (-616.010) (-619.781) (-617.013) [-619.576] -- 0:00:35
423000 -- [-616.406] (-628.424) (-618.494) (-618.144) * (-617.048) (-619.705) [-617.470] (-616.046) -- 0:00:35
423500 -- [-617.171] (-617.873) (-619.628) (-620.090) * (-616.347) (-616.984) (-622.373) [-616.462] -- 0:00:35
424000 -- (-617.266) (-622.419) (-622.079) [-617.897] * [-615.896] (-616.221) (-622.628) (-625.944) -- 0:00:35
424500 -- [-620.540] (-618.340) (-615.720) (-617.008) * (-621.037) [-617.993] (-618.250) (-617.478) -- 0:00:35
425000 -- (-621.776) (-618.769) [-617.943] (-615.929) * (-620.903) (-618.270) (-617.508) [-616.288] -- 0:00:35
Average standard deviation of split frequencies: 0.012758
425500 -- [-621.114] (-618.550) (-615.759) (-616.514) * (-617.930) (-615.995) (-615.816) [-616.115] -- 0:00:35
426000 -- (-615.976) (-618.074) (-617.286) [-618.515] * (-616.736) (-616.264) (-615.842) [-615.275] -- 0:00:35
426500 -- (-617.260) (-617.537) (-615.896) [-619.142] * (-619.707) (-616.934) (-619.611) [-617.152] -- 0:00:34
427000 -- [-616.350] (-618.108) (-619.761) (-619.839) * (-624.749) (-620.040) (-617.934) [-618.707] -- 0:00:34
427500 -- (-619.079) (-619.357) [-615.966] (-617.343) * [-617.047] (-617.042) (-616.004) (-617.391) -- 0:00:34
428000 -- (-619.782) (-619.841) (-618.563) [-617.310] * (-619.874) [-616.412] (-615.901) (-619.354) -- 0:00:34
428500 -- (-617.515) (-623.179) [-618.972] (-615.935) * (-619.042) [-618.270] (-617.301) (-616.688) -- 0:00:34
429000 -- (-616.945) (-616.359) (-616.140) [-616.085] * (-617.857) (-621.543) [-615.878] (-615.719) -- 0:00:34
429500 -- (-618.201) (-621.516) [-616.328] (-618.735) * (-624.743) [-617.157] (-615.535) (-618.726) -- 0:00:34
430000 -- [-622.586] (-615.816) (-617.789) (-619.961) * [-618.003] (-616.036) (-618.311) (-617.740) -- 0:00:34
Average standard deviation of split frequencies: 0.012749
430500 -- (-619.285) (-616.326) [-616.588] (-615.519) * (-618.781) (-618.104) (-616.398) [-618.659] -- 0:00:34
431000 -- (-619.409) [-615.994] (-617.015) (-616.881) * (-616.749) [-615.741] (-620.143) (-618.748) -- 0:00:34
431500 -- (-617.701) (-617.228) [-616.208] (-616.640) * (-616.331) [-617.156] (-616.764) (-616.562) -- 0:00:34
432000 -- [-617.813] (-620.974) (-617.818) (-616.779) * (-617.960) (-616.620) (-618.410) [-618.587] -- 0:00:34
432500 -- (-619.218) [-617.062] (-616.499) (-616.299) * (-617.140) [-615.853] (-621.119) (-615.794) -- 0:00:34
433000 -- (-617.021) (-616.831) (-615.606) [-616.203] * [-620.194] (-616.937) (-617.526) (-618.437) -- 0:00:34
433500 -- (-615.788) [-616.087] (-625.322) (-618.614) * [-615.768] (-619.787) (-617.932) (-617.196) -- 0:00:33
434000 -- (-616.239) (-616.213) [-616.310] (-615.630) * (-615.977) [-617.720] (-618.294) (-616.270) -- 0:00:33
434500 -- [-618.471] (-620.345) (-619.475) (-617.069) * (-616.805) [-618.982] (-617.024) (-616.503) -- 0:00:33
435000 -- (-620.514) (-616.431) (-619.154) [-620.082] * (-618.305) (-617.608) [-616.746] (-619.865) -- 0:00:33
Average standard deviation of split frequencies: 0.012338
435500 -- (-619.067) (-619.855) [-617.374] (-617.447) * (-618.705) [-627.361] (-615.986) (-617.931) -- 0:00:33
436000 -- (-617.687) [-617.812] (-616.879) (-615.498) * (-616.880) (-618.533) [-615.571] (-618.041) -- 0:00:33
436500 -- (-617.586) (-620.047) (-618.633) [-615.642] * [-618.340] (-618.880) (-617.390) (-620.506) -- 0:00:33
437000 -- (-618.603) (-618.034) (-617.257) [-616.426] * (-619.256) (-618.721) (-616.869) [-617.448] -- 0:00:33
437500 -- (-616.244) (-618.699) (-617.129) [-616.021] * (-618.116) (-619.075) [-616.539] (-620.932) -- 0:00:33
438000 -- (-615.609) [-615.995] (-617.596) (-618.676) * (-617.146) (-619.900) (-616.016) [-619.522] -- 0:00:34
438500 -- (-621.705) [-616.864] (-619.683) (-617.395) * [-615.700] (-620.380) (-621.252) (-617.810) -- 0:00:34
439000 -- [-620.334] (-616.075) (-616.432) (-615.751) * (-618.830) (-619.608) (-617.973) [-616.885] -- 0:00:34
439500 -- [-618.319] (-615.670) (-616.527) (-615.751) * (-616.667) (-620.110) (-615.917) [-619.866] -- 0:00:34
440000 -- (-617.558) (-616.868) [-615.829] (-617.507) * (-618.984) (-616.161) [-618.792] (-617.317) -- 0:00:34
Average standard deviation of split frequencies: 0.011453
440500 -- (-616.482) (-615.918) (-616.472) [-615.953] * (-617.368) (-615.918) [-617.295] (-617.046) -- 0:00:34
441000 -- (-616.281) (-616.576) [-617.958] (-617.060) * (-617.946) (-617.072) (-617.847) [-618.435] -- 0:00:34
441500 -- (-616.727) (-616.268) [-621.471] (-619.194) * (-616.019) [-618.406] (-616.395) (-617.247) -- 0:00:34
442000 -- (-619.103) (-616.035) (-620.177) [-617.590] * [-616.571] (-616.511) (-616.944) (-616.430) -- 0:00:34
442500 -- (-619.673) [-615.783] (-618.945) (-617.234) * (-621.743) [-617.678] (-617.108) (-615.789) -- 0:00:34
443000 -- (-623.107) [-617.139] (-618.508) (-615.824) * (-620.375) [-619.703] (-617.725) (-619.072) -- 0:00:33
443500 -- (-616.933) [-617.751] (-621.129) (-615.672) * [-617.971] (-618.039) (-620.200) (-617.003) -- 0:00:33
444000 -- (-617.093) (-620.213) (-619.299) [-617.012] * (-620.865) (-615.781) (-620.876) [-619.165] -- 0:00:33
444500 -- (-619.127) (-620.509) (-618.155) [-618.554] * (-618.230) (-620.676) [-620.181] (-617.024) -- 0:00:33
445000 -- (-616.072) [-616.938] (-618.335) (-619.718) * [-616.234] (-626.048) (-620.859) (-618.523) -- 0:00:33
Average standard deviation of split frequencies: 0.012373
445500 -- (-616.032) [-616.201] (-615.650) (-617.237) * (-618.336) (-617.270) (-617.153) [-617.384] -- 0:00:33
446000 -- (-620.144) (-619.567) (-620.922) [-615.865] * (-617.315) [-616.408] (-617.527) (-619.111) -- 0:00:33
446500 -- (-620.940) (-618.900) (-617.330) [-615.593] * (-619.899) [-616.859] (-617.124) (-617.752) -- 0:00:33
447000 -- (-619.077) (-618.043) (-620.653) [-619.766] * [-616.453] (-616.186) (-615.758) (-617.376) -- 0:00:33
447500 -- [-616.026] (-617.496) (-617.062) (-616.408) * [-616.153] (-615.969) (-618.779) (-620.508) -- 0:00:33
448000 -- (-616.151) (-617.873) [-616.959] (-616.564) * (-616.910) [-620.536] (-616.659) (-616.899) -- 0:00:33
448500 -- (-619.016) (-616.886) [-616.051] (-616.124) * (-616.572) (-617.864) [-619.342] (-617.051) -- 0:00:33
449000 -- [-622.120] (-617.623) (-618.527) (-616.166) * (-618.953) [-617.757] (-617.404) (-616.964) -- 0:00:33
449500 -- (-617.087) (-615.582) [-619.833] (-617.777) * (-618.041) (-616.860) (-619.793) [-615.863] -- 0:00:33
450000 -- (-620.551) [-615.841] (-617.430) (-616.749) * (-618.981) (-616.251) (-616.026) [-616.212] -- 0:00:33
Average standard deviation of split frequencies: 0.011998
450500 -- [-616.978] (-619.374) (-616.614) (-617.172) * [-617.193] (-616.846) (-615.843) (-617.896) -- 0:00:32
451000 -- (-620.521) (-617.963) [-624.424] (-616.902) * (-621.706) [-616.691] (-616.519) (-619.571) -- 0:00:32
451500 -- (-620.196) (-618.706) [-616.129] (-618.465) * (-617.476) (-616.319) (-620.060) [-616.822] -- 0:00:32
452000 -- (-615.524) [-617.377] (-620.656) (-616.204) * (-619.888) (-615.931) [-615.912] (-617.361) -- 0:00:32
452500 -- (-618.007) (-616.988) (-620.062) [-619.019] * [-617.005] (-618.502) (-618.121) (-618.516) -- 0:00:32
453000 -- [-617.781] (-617.639) (-620.751) (-616.642) * (-618.009) (-619.347) [-624.265] (-618.332) -- 0:00:32
453500 -- [-620.725] (-617.681) (-616.552) (-618.457) * (-619.288) (-618.720) [-621.010] (-617.679) -- 0:00:32
454000 -- (-616.922) (-617.054) [-616.357] (-616.584) * [-617.209] (-620.733) (-618.483) (-619.336) -- 0:00:32
454500 -- [-616.929] (-617.533) (-618.370) (-619.626) * (-616.359) [-621.131] (-619.167) (-621.023) -- 0:00:32
455000 -- [-615.411] (-619.433) (-619.727) (-616.602) * (-617.183) (-620.228) (-618.949) [-616.731] -- 0:00:33
Average standard deviation of split frequencies: 0.012709
455500 -- [-615.783] (-621.119) (-616.023) (-618.126) * (-619.555) (-618.151) [-619.000] (-619.209) -- 0:00:33
456000 -- [-615.968] (-616.930) (-616.918) (-617.505) * [-617.311] (-617.918) (-619.110) (-619.124) -- 0:00:33
456500 -- (-620.340) (-617.912) (-616.353) [-618.307] * (-617.321) (-617.185) (-622.066) [-617.162] -- 0:00:33
457000 -- (-619.044) [-617.513] (-617.463) (-618.854) * [-617.369] (-616.669) (-618.689) (-617.668) -- 0:00:33
457500 -- [-616.663] (-618.375) (-619.953) (-622.508) * (-619.096) (-616.008) (-616.404) [-617.682] -- 0:00:33
458000 -- (-616.634) [-616.360] (-618.885) (-619.022) * (-620.089) (-616.628) [-617.063] (-619.360) -- 0:00:33
458500 -- (-618.721) (-616.097) (-617.160) [-617.385] * (-619.159) (-617.948) (-617.136) [-616.310] -- 0:00:33
459000 -- (-618.473) (-619.983) [-617.578] (-617.396) * [-619.280] (-619.786) (-620.137) (-616.126) -- 0:00:33
459500 -- [-618.930] (-617.229) (-620.126) (-617.886) * (-618.247) (-623.858) (-618.408) [-615.779] -- 0:00:32
460000 -- (-618.358) (-617.539) (-616.966) [-618.142] * (-616.460) (-616.896) [-616.058] (-617.196) -- 0:00:32
Average standard deviation of split frequencies: 0.012882
460500 -- (-619.639) (-616.980) [-616.958] (-617.791) * (-618.149) [-617.245] (-616.413) (-616.449) -- 0:00:32
461000 -- (-617.545) (-617.027) (-616.555) [-616.561] * (-621.514) [-618.714] (-617.806) (-617.283) -- 0:00:32
461500 -- (-616.546) (-617.069) (-619.849) [-616.079] * [-619.363] (-618.238) (-618.983) (-618.373) -- 0:00:32
462000 -- (-620.930) (-616.035) [-615.627] (-617.370) * [-617.797] (-619.066) (-618.298) (-618.662) -- 0:00:32
462500 -- (-616.835) (-617.639) [-618.737] (-618.045) * [-615.554] (-615.714) (-616.773) (-616.743) -- 0:00:32
463000 -- (-615.768) (-617.861) [-622.875] (-623.055) * (-619.615) (-615.827) [-616.218] (-615.690) -- 0:00:32
463500 -- [-615.593] (-617.513) (-619.729) (-619.477) * (-618.917) [-616.706] (-615.955) (-618.993) -- 0:00:32
464000 -- [-619.121] (-619.717) (-617.282) (-616.610) * (-620.027) (-616.405) [-617.309] (-615.508) -- 0:00:32
464500 -- (-616.006) (-618.305) [-617.399] (-618.505) * [-617.258] (-616.778) (-617.152) (-620.353) -- 0:00:32
465000 -- [-616.003] (-617.594) (-617.865) (-616.568) * (-617.443) [-615.893] (-617.587) (-620.566) -- 0:00:32
Average standard deviation of split frequencies: 0.013032
465500 -- [-616.964] (-616.548) (-616.243) (-623.101) * (-622.170) [-618.344] (-620.205) (-616.720) -- 0:00:32
466000 -- (-615.842) (-616.874) [-616.977] (-617.775) * (-616.752) (-616.351) (-615.407) [-615.433] -- 0:00:32
466500 -- (-620.691) [-617.505] (-616.855) (-618.613) * (-619.914) [-616.475] (-616.980) (-616.652) -- 0:00:32
467000 -- (-616.997) [-615.435] (-616.034) (-618.563) * (-618.989) (-618.044) [-623.838] (-618.394) -- 0:00:31
467500 -- (-616.706) (-617.118) (-619.270) [-620.718] * (-620.634) [-618.604] (-621.606) (-618.080) -- 0:00:31
468000 -- (-620.762) [-617.375] (-616.692) (-615.898) * [-619.807] (-618.947) (-618.495) (-616.990) -- 0:00:31
468500 -- [-620.651] (-618.181) (-616.833) (-619.786) * (-621.425) (-617.842) [-618.050] (-622.273) -- 0:00:31
469000 -- [-617.963] (-621.107) (-617.266) (-617.627) * (-617.863) [-617.600] (-617.048) (-617.610) -- 0:00:31
469500 -- (-616.736) (-620.524) (-619.183) [-616.279] * (-622.362) [-618.370] (-617.188) (-618.518) -- 0:00:31
470000 -- (-616.773) [-616.363] (-615.743) (-617.250) * [-617.974] (-617.032) (-616.222) (-617.342) -- 0:00:31
Average standard deviation of split frequencies: 0.013433
470500 -- (-619.174) (-616.641) [-616.694] (-618.799) * (-617.821) [-615.975] (-617.039) (-617.541) -- 0:00:31
471000 -- (-617.927) [-617.064] (-616.457) (-616.810) * (-616.401) (-616.918) [-617.747] (-617.284) -- 0:00:31
471500 -- (-615.300) (-616.627) (-617.789) [-616.510] * [-620.167] (-615.644) (-617.278) (-618.126) -- 0:00:32
472000 -- (-618.005) (-617.458) (-619.112) [-621.568] * (-618.871) [-617.376] (-617.265) (-617.218) -- 0:00:32
472500 -- [-619.441] (-618.190) (-619.499) (-618.334) * [-616.166] (-616.286) (-616.992) (-617.177) -- 0:00:32
473000 -- [-616.334] (-619.398) (-617.158) (-623.341) * (-617.687) [-616.790] (-617.133) (-619.003) -- 0:00:32
473500 -- (-616.980) [-616.673] (-616.932) (-622.573) * (-617.324) [-622.240] (-616.248) (-617.715) -- 0:00:32
474000 -- (-616.681) (-617.933) [-618.473] (-617.697) * (-615.944) (-616.426) [-618.336] (-619.504) -- 0:00:32
474500 -- (-615.992) [-618.641] (-618.410) (-620.421) * (-616.133) (-621.288) [-619.305] (-617.761) -- 0:00:32
475000 -- (-619.663) [-617.333] (-618.827) (-620.022) * [-617.176] (-619.092) (-616.711) (-621.564) -- 0:00:32
Average standard deviation of split frequencies: 0.012758
475500 -- (-617.559) (-619.772) [-618.626] (-619.679) * (-617.742) [-618.170] (-617.339) (-621.504) -- 0:00:31
476000 -- (-621.723) (-616.284) [-615.925] (-618.739) * (-618.294) (-619.077) (-617.095) [-616.526] -- 0:00:31
476500 -- (-620.471) [-616.421] (-618.533) (-617.716) * (-617.391) (-617.564) (-618.111) [-617.119] -- 0:00:31
477000 -- (-617.195) [-616.789] (-621.441) (-618.399) * [-621.241] (-616.715) (-620.415) (-616.720) -- 0:00:31
477500 -- [-617.738] (-618.121) (-617.689) (-616.458) * (-617.496) (-618.298) (-620.635) [-615.490] -- 0:00:31
478000 -- (-622.335) [-616.402] (-616.511) (-615.364) * [-616.133] (-616.216) (-621.731) (-616.883) -- 0:00:31
478500 -- (-621.946) [-616.208] (-618.507) (-617.628) * (-620.657) [-616.667] (-618.321) (-617.464) -- 0:00:31
479000 -- (-618.923) [-615.937] (-620.832) (-615.645) * [-619.436] (-618.962) (-616.755) (-620.075) -- 0:00:31
479500 -- (-615.984) [-615.819] (-620.606) (-619.418) * (-616.609) (-615.505) [-623.215] (-617.970) -- 0:00:31
480000 -- [-619.565] (-619.138) (-616.151) (-616.739) * [-616.941] (-617.925) (-620.127) (-619.535) -- 0:00:31
Average standard deviation of split frequencies: 0.012634
480500 -- (-617.563) [-616.267] (-616.786) (-623.529) * [-617.437] (-619.713) (-618.968) (-623.373) -- 0:00:31
481000 -- [-616.629] (-617.484) (-618.779) (-620.497) * [-619.610] (-619.305) (-618.068) (-619.026) -- 0:00:31
481500 -- (-619.700) (-619.534) (-618.198) [-622.232] * [-619.196] (-617.168) (-621.484) (-616.707) -- 0:00:31
482000 -- (-616.690) (-616.980) (-620.148) [-618.018] * (-622.188) (-620.481) [-618.116] (-625.789) -- 0:00:31
482500 -- [-619.248] (-615.543) (-616.513) (-621.314) * (-616.713) (-617.255) (-616.851) [-619.456] -- 0:00:31
483000 -- (-618.832) [-618.364] (-619.584) (-619.911) * (-620.877) (-617.901) [-618.245] (-616.224) -- 0:00:31
483500 -- (-621.772) [-617.221] (-618.981) (-616.770) * (-618.794) [-617.023] (-617.020) (-621.071) -- 0:00:30
484000 -- (-616.118) (-617.666) [-617.141] (-618.110) * [-615.711] (-616.727) (-616.150) (-616.848) -- 0:00:30
484500 -- (-616.337) [-618.494] (-617.304) (-617.961) * (-616.083) [-618.318] (-616.229) (-622.049) -- 0:00:30
485000 -- (-615.826) [-616.289] (-617.443) (-618.456) * (-616.811) (-617.216) [-616.988] (-618.628) -- 0:00:30
Average standard deviation of split frequencies: 0.012781
485500 -- [-616.995] (-616.140) (-617.976) (-621.153) * (-621.878) (-618.187) (-618.234) [-617.198] -- 0:00:30
486000 -- (-621.314) [-616.330] (-618.862) (-619.010) * [-615.764] (-618.058) (-619.741) (-617.005) -- 0:00:30
486500 -- (-620.026) (-619.658) (-618.213) [-616.402] * (-616.520) [-617.597] (-618.149) (-619.368) -- 0:00:30
487000 -- (-616.337) [-618.402] (-617.412) (-616.649) * [-616.189] (-617.415) (-617.857) (-621.359) -- 0:00:30
487500 -- (-615.455) (-618.830) (-617.037) [-615.835] * (-619.554) (-616.517) (-616.215) [-620.582] -- 0:00:30
488000 -- (-616.773) (-616.867) [-617.305] (-619.207) * (-617.482) (-617.128) [-616.416] (-619.801) -- 0:00:30
488500 -- (-618.728) (-615.551) (-615.859) [-617.377] * (-619.304) (-617.635) [-615.714] (-616.413) -- 0:00:31
489000 -- (-616.499) (-618.331) (-616.804) [-617.232] * (-617.804) (-619.661) (-617.325) [-617.647] -- 0:00:31
489500 -- (-617.009) [-620.463] (-616.379) (-618.908) * [-618.103] (-618.268) (-616.226) (-620.160) -- 0:00:31
490000 -- [-615.806] (-620.059) (-616.256) (-618.409) * (-617.862) [-617.048] (-615.953) (-617.725) -- 0:00:31
Average standard deviation of split frequencies: 0.012772
490500 -- (-616.869) (-618.917) (-616.481) [-619.089] * [-616.908] (-615.775) (-617.518) (-615.201) -- 0:00:31
491000 -- [-616.683] (-618.744) (-617.114) (-616.872) * (-617.915) (-615.731) (-616.674) [-615.556] -- 0:00:31
491500 -- [-615.998] (-618.247) (-617.135) (-621.530) * (-618.379) (-617.738) [-618.627] (-616.895) -- 0:00:31
492000 -- (-616.228) (-617.679) [-618.632] (-617.567) * [-619.192] (-617.407) (-618.476) (-615.768) -- 0:00:30
492500 -- (-617.560) [-616.892] (-615.960) (-616.866) * (-618.298) (-618.239) (-619.027) [-616.090] -- 0:00:30
493000 -- (-617.260) [-616.900] (-615.922) (-618.861) * (-616.185) (-619.344) (-618.210) [-616.090] -- 0:00:30
493500 -- (-618.242) [-616.663] (-619.696) (-619.780) * [-616.126] (-617.939) (-616.070) (-616.196) -- 0:00:30
494000 -- [-615.736] (-618.224) (-617.330) (-621.671) * [-615.496] (-618.062) (-621.957) (-619.037) -- 0:00:30
494500 -- (-617.826) (-616.789) (-617.526) [-616.014] * (-615.532) [-618.329] (-619.363) (-617.233) -- 0:00:30
495000 -- (-616.293) (-617.436) [-618.400] (-616.191) * (-619.123) (-616.694) [-618.179] (-615.822) -- 0:00:30
Average standard deviation of split frequencies: 0.012299
495500 -- (-617.131) (-616.239) [-615.682] (-617.410) * (-618.903) (-616.848) [-617.152] (-616.081) -- 0:00:30
496000 -- (-617.525) (-615.899) [-617.660] (-617.765) * (-618.195) (-615.699) [-617.455] (-616.924) -- 0:00:30
496500 -- (-618.557) [-618.375] (-618.126) (-621.434) * (-617.202) [-616.283] (-618.096) (-617.626) -- 0:00:30
497000 -- [-621.244] (-616.991) (-616.296) (-619.973) * (-617.076) (-618.701) (-619.953) [-617.229] -- 0:00:30
497500 -- (-620.247) [-618.083] (-615.696) (-616.630) * (-622.187) (-619.336) [-618.115] (-616.382) -- 0:00:30
498000 -- [-615.866] (-616.834) (-618.055) (-616.333) * (-617.473) (-616.813) (-617.258) [-619.838] -- 0:00:30
498500 -- (-615.769) (-617.103) [-617.724] (-616.097) * (-616.586) (-619.017) [-617.878] (-617.134) -- 0:00:30
499000 -- [-615.743] (-616.247) (-617.024) (-615.330) * (-617.208) [-622.247] (-617.516) (-615.711) -- 0:00:30
499500 -- (-615.200) [-617.142] (-616.650) (-615.998) * [-616.495] (-620.331) (-616.217) (-616.435) -- 0:00:30
500000 -- (-620.563) (-617.597) (-616.889) [-615.525] * (-620.043) [-616.210] (-617.023) (-617.927) -- 0:00:30
Average standard deviation of split frequencies: 0.011652
500500 -- (-617.858) [-617.031] (-617.988) (-615.984) * [-619.322] (-619.666) (-617.187) (-619.030) -- 0:00:29
501000 -- (-618.944) [-616.013] (-617.672) (-618.972) * (-617.870) (-620.863) [-616.512] (-621.086) -- 0:00:29
501500 -- (-616.158) (-616.705) [-617.475] (-617.894) * [-617.371] (-617.523) (-618.449) (-620.875) -- 0:00:29
502000 -- (-619.001) (-618.079) (-616.512) [-615.690] * (-615.928) [-616.131] (-618.097) (-617.977) -- 0:00:29
502500 -- [-617.697] (-617.854) (-617.636) (-620.427) * (-618.540) (-617.024) (-616.025) [-616.981] -- 0:00:29
503000 -- (-616.419) (-618.330) [-616.997] (-618.452) * (-619.754) (-616.971) [-618.890] (-616.133) -- 0:00:29
503500 -- (-617.409) (-620.575) (-616.239) [-619.574] * (-618.549) (-617.555) [-621.465] (-616.957) -- 0:00:29
504000 -- (-617.449) (-615.965) [-617.444] (-617.064) * (-619.262) (-618.338) (-617.259) [-617.322] -- 0:00:29
504500 -- (-615.963) [-619.998] (-618.369) (-617.246) * [-617.568] (-617.047) (-618.116) (-619.885) -- 0:00:29
505000 -- [-617.820] (-616.718) (-618.088) (-617.238) * (-617.111) (-616.724) [-616.311] (-619.933) -- 0:00:30
Average standard deviation of split frequencies: 0.011878
505500 -- (-619.987) [-616.318] (-617.749) (-619.044) * (-616.283) (-618.406) (-620.280) [-615.633] -- 0:00:30
506000 -- [-618.069] (-618.341) (-615.358) (-620.847) * (-617.052) (-618.505) [-617.871] (-616.219) -- 0:00:30
506500 -- (-616.927) [-617.531] (-616.844) (-619.030) * [-616.621] (-616.419) (-616.448) (-616.181) -- 0:00:30
507000 -- [-620.485] (-619.480) (-618.304) (-617.207) * (-619.166) (-617.236) (-616.094) [-619.174] -- 0:00:30
507500 -- (-618.323) [-618.743] (-619.106) (-616.707) * (-616.556) (-616.652) (-617.398) [-618.425] -- 0:00:30
508000 -- (-616.491) (-617.814) (-622.280) [-617.065] * [-616.658] (-618.490) (-619.742) (-616.213) -- 0:00:30
508500 -- (-615.808) (-620.392) [-620.346] (-616.263) * [-617.904] (-617.963) (-618.984) (-616.222) -- 0:00:29
509000 -- (-617.956) (-621.155) [-620.968] (-617.558) * [-618.040] (-617.976) (-618.483) (-617.322) -- 0:00:29
509500 -- (-615.910) (-624.663) [-619.638] (-616.390) * (-616.002) (-621.298) (-617.256) [-618.296] -- 0:00:29
510000 -- [-617.880] (-620.461) (-617.101) (-616.558) * (-618.434) (-615.832) (-618.708) [-618.823] -- 0:00:29
Average standard deviation of split frequencies: 0.011250
510500 -- (-619.978) (-618.962) [-616.722] (-619.820) * [-617.726] (-615.417) (-616.673) (-620.420) -- 0:00:29
511000 -- (-621.311) [-619.036] (-617.010) (-619.703) * (-618.683) (-616.574) (-616.336) [-621.737] -- 0:00:29
511500 -- (-619.292) [-615.677] (-616.843) (-618.854) * [-617.412] (-617.774) (-617.113) (-616.443) -- 0:00:29
512000 -- [-616.383] (-616.718) (-617.704) (-616.024) * [-617.335] (-618.057) (-615.630) (-615.760) -- 0:00:29
512500 -- (-619.582) (-619.911) (-616.446) [-615.857] * (-620.395) (-619.399) (-617.521) [-616.239] -- 0:00:29
513000 -- (-618.969) (-616.063) (-618.779) [-617.577] * [-618.120] (-626.589) (-616.990) (-618.941) -- 0:00:29
513500 -- [-617.090] (-620.988) (-619.328) (-616.932) * (-617.802) [-616.697] (-616.942) (-616.954) -- 0:00:29
514000 -- (-615.839) [-620.942] (-619.801) (-618.118) * (-616.013) (-616.114) (-620.691) [-615.790] -- 0:00:29
514500 -- (-619.243) (-619.877) (-616.605) [-617.137] * [-615.600] (-621.245) (-617.414) (-617.689) -- 0:00:29
515000 -- (-617.652) (-618.315) (-615.460) [-618.184] * (-615.971) [-616.922] (-619.689) (-617.328) -- 0:00:29
Average standard deviation of split frequencies: 0.011077
515500 -- (-619.570) (-617.559) (-618.212) [-617.043] * (-615.790) [-616.871] (-615.671) (-619.785) -- 0:00:29
516000 -- [-617.681] (-620.514) (-619.765) (-620.631) * (-618.845) (-617.110) (-617.563) [-617.881] -- 0:00:29
516500 -- [-615.817] (-618.194) (-623.399) (-617.746) * [-618.738] (-617.966) (-617.919) (-620.491) -- 0:00:29
517000 -- (-616.070) (-617.342) (-618.307) [-618.633] * (-617.091) (-615.988) (-616.979) [-616.841] -- 0:00:28
517500 -- [-616.017] (-619.579) (-617.914) (-622.001) * (-616.090) (-615.941) (-619.637) [-616.921] -- 0:00:28
518000 -- (-617.152) [-619.574] (-616.594) (-619.104) * (-618.393) [-617.030] (-622.832) (-618.713) -- 0:00:28
518500 -- (-618.896) (-624.588) (-617.071) [-619.418] * (-616.707) (-619.791) [-618.814] (-616.069) -- 0:00:28
519000 -- (-618.882) (-625.308) (-617.094) [-616.333] * (-619.307) (-618.409) (-619.239) [-617.269] -- 0:00:28
519500 -- [-619.104] (-616.262) (-617.918) (-617.810) * [-616.511] (-622.883) (-620.778) (-616.678) -- 0:00:28
520000 -- [-616.568] (-621.756) (-617.472) (-615.589) * (-618.318) (-616.253) (-617.772) [-618.413] -- 0:00:28
Average standard deviation of split frequencies: 0.010921
520500 -- (-617.234) (-618.694) (-619.689) [-616.052] * [-618.846] (-619.097) (-621.516) (-620.332) -- 0:00:28
521000 -- [-619.176] (-621.542) (-618.870) (-618.039) * (-618.898) (-618.860) (-620.171) [-618.222] -- 0:00:28
521500 -- (-616.091) [-617.279] (-620.024) (-615.851) * [-616.198] (-621.815) (-618.045) (-622.376) -- 0:00:28
522000 -- [-617.877] (-616.298) (-618.742) (-617.057) * (-616.488) (-616.919) [-618.644] (-615.750) -- 0:00:29
522500 -- (-617.687) (-617.376) (-616.553) [-615.641] * (-616.303) (-619.878) [-617.891] (-615.912) -- 0:00:29
523000 -- (-617.772) [-617.636] (-617.537) (-618.225) * (-617.474) [-617.659] (-618.397) (-619.635) -- 0:00:29
523500 -- (-615.671) (-616.293) [-616.865] (-617.157) * (-621.692) (-618.919) (-618.550) [-618.948] -- 0:00:29
524000 -- (-616.162) (-617.357) (-617.368) [-618.410] * (-627.741) [-617.329] (-618.241) (-618.807) -- 0:00:29
524500 -- [-616.381] (-616.227) (-620.178) (-618.288) * (-619.988) (-616.694) (-618.330) [-619.654] -- 0:00:29
525000 -- [-616.133] (-618.308) (-617.244) (-619.126) * [-615.948] (-616.405) (-617.734) (-615.963) -- 0:00:28
Average standard deviation of split frequencies: 0.011035
525500 -- [-616.154] (-617.378) (-622.638) (-616.365) * (-616.218) (-616.810) [-615.843] (-616.536) -- 0:00:28
526000 -- (-617.065) (-616.919) [-617.147] (-617.375) * [-617.158] (-616.427) (-615.985) (-620.470) -- 0:00:28
526500 -- [-620.450] (-617.988) (-619.128) (-620.372) * (-619.336) [-615.643] (-616.820) (-615.901) -- 0:00:28
527000 -- [-622.147] (-620.839) (-617.714) (-618.764) * (-617.602) [-616.043] (-616.077) (-615.320) -- 0:00:28
527500 -- (-621.234) (-620.285) (-617.794) [-618.587] * (-620.128) [-617.702] (-623.831) (-616.976) -- 0:00:28
528000 -- (-618.523) (-619.253) [-617.083] (-619.159) * (-620.078) (-617.472) (-616.969) [-617.102] -- 0:00:28
528500 -- (-619.051) (-619.728) (-616.156) [-617.217] * (-621.834) (-618.104) [-621.115] (-617.655) -- 0:00:28
529000 -- [-616.236] (-617.257) (-616.971) (-617.194) * (-621.874) [-619.702] (-616.663) (-619.048) -- 0:00:28
529500 -- (-616.789) (-617.142) (-615.267) [-619.317] * (-616.562) (-617.790) [-618.221] (-619.292) -- 0:00:28
530000 -- (-620.000) (-616.963) [-615.609] (-619.599) * (-617.424) [-616.675] (-616.254) (-621.940) -- 0:00:28
Average standard deviation of split frequencies: 0.011271
530500 -- (-618.383) [-617.730] (-616.894) (-619.488) * [-618.157] (-620.551) (-616.854) (-617.906) -- 0:00:28
531000 -- [-616.363] (-617.163) (-616.510) (-618.999) * (-616.443) (-615.889) [-617.289] (-616.198) -- 0:00:28
531500 -- (-619.971) [-615.543] (-618.766) (-615.636) * (-617.654) [-617.489] (-618.732) (-617.230) -- 0:00:28
532000 -- (-618.010) (-616.856) (-616.616) [-618.795] * [-617.556] (-618.684) (-618.670) (-619.761) -- 0:00:28
532500 -- (-616.610) [-617.397] (-622.076) (-616.433) * (-616.717) (-620.441) (-616.836) [-616.180] -- 0:00:28
533000 -- (-619.008) (-618.574) [-615.882] (-617.645) * (-618.530) [-617.220] (-617.187) (-618.459) -- 0:00:28
533500 -- (-617.213) (-617.340) [-616.227] (-619.375) * (-618.461) (-618.439) [-616.095] (-616.155) -- 0:00:27
534000 -- (-619.086) (-619.389) [-617.815] (-617.119) * (-619.704) (-617.030) [-617.703] (-615.711) -- 0:00:27
534500 -- (-619.632) (-615.818) (-617.208) [-617.114] * [-618.909] (-619.128) (-619.176) (-615.520) -- 0:00:27
535000 -- (-616.774) [-616.023] (-619.439) (-617.596) * (-618.166) (-618.945) (-619.785) [-616.073] -- 0:00:27
Average standard deviation of split frequencies: 0.011158
535500 -- (-618.919) [-616.845] (-617.896) (-617.044) * [-618.892] (-616.464) (-621.756) (-616.591) -- 0:00:27
536000 -- (-617.629) (-619.901) (-617.828) [-618.252] * [-616.306] (-617.353) (-623.356) (-618.830) -- 0:00:27
536500 -- (-617.129) (-619.476) [-617.227] (-617.270) * (-617.235) [-616.916] (-620.521) (-620.555) -- 0:00:27
537000 -- [-620.016] (-620.769) (-617.557) (-616.481) * (-618.884) (-617.372) [-618.951] (-615.988) -- 0:00:27
537500 -- (-615.887) [-618.318] (-616.361) (-617.732) * [-618.052] (-616.390) (-617.301) (-616.434) -- 0:00:27
538000 -- (-617.877) [-619.226] (-617.402) (-618.159) * (-619.307) (-616.603) [-620.394] (-620.199) -- 0:00:27
538500 -- (-618.342) [-619.930] (-618.105) (-616.809) * [-618.869] (-616.460) (-617.059) (-620.358) -- 0:00:27
539000 -- (-616.232) [-616.685] (-616.895) (-618.894) * (-619.106) (-617.194) [-618.166] (-618.196) -- 0:00:28
539500 -- (-622.930) [-618.131] (-618.557) (-619.310) * (-618.430) (-618.414) (-617.005) [-621.180] -- 0:00:28
540000 -- (-617.265) (-617.054) (-619.248) [-622.275] * (-615.789) [-616.840] (-615.506) (-617.292) -- 0:00:28
Average standard deviation of split frequencies: 0.010626
540500 -- (-623.704) (-617.177) (-617.288) [-619.232] * (-617.563) (-616.592) [-616.385] (-617.998) -- 0:00:28
541000 -- [-616.654] (-618.792) (-620.011) (-616.309) * (-616.323) [-619.195] (-617.871) (-618.310) -- 0:00:27
541500 -- [-617.157] (-616.758) (-616.946) (-618.070) * (-621.343) (-617.996) (-617.461) [-616.321] -- 0:00:27
542000 -- (-617.004) [-617.980] (-616.894) (-619.354) * [-618.317] (-616.014) (-615.908) (-617.054) -- 0:00:27
542500 -- (-619.231) (-616.437) (-616.029) [-619.217] * (-620.215) (-616.564) [-615.620] (-617.376) -- 0:00:27
543000 -- (-617.717) (-618.129) [-616.119] (-620.946) * (-616.422) (-617.599) (-615.548) [-617.022] -- 0:00:27
543500 -- [-618.239] (-618.043) (-617.462) (-621.241) * (-620.542) [-616.651] (-619.148) (-619.633) -- 0:00:27
544000 -- (-618.037) (-617.464) [-617.945] (-617.000) * (-618.487) [-616.843] (-620.177) (-616.151) -- 0:00:27
544500 -- (-618.953) [-617.843] (-617.176) (-617.611) * (-618.829) (-616.087) [-616.156] (-617.274) -- 0:00:27
545000 -- (-617.545) (-617.263) [-615.826] (-619.217) * (-618.962) (-616.277) (-619.786) [-615.770] -- 0:00:27
Average standard deviation of split frequencies: 0.010145
545500 -- (-617.393) (-616.410) [-618.966] (-618.854) * (-618.299) [-616.314] (-621.233) (-616.920) -- 0:00:27
546000 -- [-616.739] (-618.886) (-622.783) (-619.755) * (-617.316) (-618.310) [-616.652] (-618.392) -- 0:00:27
546500 -- (-616.582) (-617.056) (-619.794) [-618.160] * [-619.822] (-620.907) (-620.821) (-616.869) -- 0:00:27
547000 -- [-617.328] (-618.738) (-619.014) (-616.289) * (-616.195) (-617.060) [-617.020] (-615.676) -- 0:00:27
547500 -- [-616.220] (-618.867) (-620.574) (-617.144) * (-621.809) (-620.896) [-616.794] (-615.682) -- 0:00:27
548000 -- [-617.246] (-617.956) (-619.000) (-617.420) * (-619.855) (-617.742) (-616.093) [-617.160] -- 0:00:27
548500 -- [-618.300] (-622.396) (-616.962) (-617.133) * (-617.096) (-619.100) (-617.177) [-617.350] -- 0:00:27
549000 -- (-618.090) (-618.863) [-617.627] (-621.026) * [-617.823] (-615.474) (-620.177) (-618.650) -- 0:00:27
549500 -- [-617.197] (-618.724) (-621.151) (-618.684) * (-618.764) (-621.572) [-619.072] (-620.151) -- 0:00:27
550000 -- [-621.300] (-619.854) (-617.183) (-619.045) * (-616.595) (-616.106) (-619.458) [-618.181] -- 0:00:27
Average standard deviation of split frequencies: 0.010433
550500 -- (-617.408) [-618.851] (-617.512) (-620.308) * [-616.552] (-616.768) (-617.751) (-617.663) -- 0:00:26
551000 -- (-619.712) (-617.025) [-616.239] (-622.440) * (-616.658) [-616.117] (-617.480) (-619.961) -- 0:00:26
551500 -- (-616.228) (-617.198) [-619.366] (-619.139) * (-621.693) (-617.892) (-617.353) [-617.457] -- 0:00:26
552000 -- [-616.231] (-617.810) (-617.162) (-619.775) * (-625.824) (-619.530) (-620.609) [-620.974] -- 0:00:26
552500 -- [-617.806] (-615.754) (-616.340) (-622.334) * [-616.661] (-617.209) (-621.438) (-621.345) -- 0:00:26
553000 -- [-617.303] (-617.929) (-616.855) (-615.783) * (-616.410) (-615.898) (-620.763) [-617.185] -- 0:00:26
553500 -- [-615.891] (-616.777) (-620.414) (-615.791) * (-617.512) (-617.727) (-619.926) [-617.647] -- 0:00:26
554000 -- (-618.695) (-616.681) [-617.651] (-617.674) * (-615.865) [-618.045] (-619.586) (-616.222) -- 0:00:26
554500 -- [-617.249] (-618.746) (-617.199) (-617.527) * (-615.846) (-618.641) (-617.550) [-616.977] -- 0:00:26
555000 -- (-622.198) (-617.780) [-618.812] (-616.453) * (-618.648) (-618.302) [-615.848] (-623.428) -- 0:00:26
Average standard deviation of split frequencies: 0.010492
555500 -- [-616.876] (-616.431) (-617.420) (-620.003) * [-618.816] (-621.887) (-615.723) (-618.861) -- 0:00:27
556000 -- (-616.869) (-623.958) (-616.628) [-618.708] * (-616.985) [-617.569] (-619.732) (-618.646) -- 0:00:27
556500 -- [-618.444] (-619.252) (-617.359) (-620.105) * (-616.640) (-616.623) (-616.642) [-616.357] -- 0:00:27
557000 -- (-619.543) [-620.016] (-618.889) (-623.429) * (-616.704) (-619.298) [-616.636] (-616.362) -- 0:00:27
557500 -- [-616.965] (-617.855) (-616.599) (-616.240) * (-620.837) (-615.899) [-615.991] (-619.016) -- 0:00:26
558000 -- [-615.772] (-616.503) (-617.832) (-618.061) * (-615.987) (-620.241) (-616.868) [-618.224] -- 0:00:26
558500 -- [-615.880] (-617.739) (-619.654) (-618.634) * (-619.309) (-617.288) (-618.543) [-617.877] -- 0:00:26
559000 -- (-623.016) [-616.087] (-622.537) (-617.932) * (-618.452) (-619.216) [-615.498] (-618.430) -- 0:00:26
559500 -- [-620.982] (-616.947) (-621.303) (-616.066) * [-618.999] (-618.186) (-617.262) (-618.696) -- 0:00:26
560000 -- [-617.288] (-620.731) (-616.831) (-617.691) * (-618.421) (-615.575) (-618.292) [-618.016] -- 0:00:26
Average standard deviation of split frequencies: 0.010352
560500 -- (-618.063) (-619.061) [-618.132] (-619.662) * [-617.582] (-617.300) (-618.825) (-617.814) -- 0:00:26
561000 -- [-618.332] (-616.826) (-616.619) (-617.161) * (-618.571) (-620.630) [-619.418] (-619.041) -- 0:00:26
561500 -- (-618.928) (-617.263) (-616.169) [-615.717] * (-618.048) (-618.778) [-618.136] (-616.749) -- 0:00:26
562000 -- (-616.335) [-618.041] (-619.316) (-616.972) * [-616.626] (-619.366) (-616.650) (-617.317) -- 0:00:26
562500 -- (-618.665) (-619.449) (-623.777) [-618.180] * (-616.330) (-617.902) (-617.805) [-617.629] -- 0:00:26
563000 -- (-623.371) [-618.445] (-618.869) (-619.003) * (-616.860) [-617.532] (-615.564) (-616.890) -- 0:00:26
563500 -- (-618.785) (-617.615) [-617.358] (-617.471) * (-619.736) (-616.448) [-616.604] (-618.037) -- 0:00:26
564000 -- (-618.463) (-619.609) [-617.298] (-617.594) * (-615.939) [-615.978] (-616.318) (-618.114) -- 0:00:26
564500 -- (-616.433) (-616.875) [-616.165] (-615.948) * (-616.566) (-618.456) (-617.974) [-620.092] -- 0:00:26
565000 -- (-619.411) [-616.876] (-615.893) (-616.339) * (-621.191) (-616.366) [-615.651] (-618.533) -- 0:00:26
Average standard deviation of split frequencies: 0.010411
565500 -- [-615.994] (-621.168) (-618.081) (-615.324) * (-620.516) (-615.628) (-618.707) [-620.108] -- 0:00:26
566000 -- (-615.813) [-617.646] (-615.802) (-615.807) * [-615.694] (-617.864) (-619.958) (-619.704) -- 0:00:26
566500 -- (-617.404) [-617.505] (-620.019) (-616.178) * (-616.377) [-619.032] (-616.211) (-620.027) -- 0:00:26
567000 -- [-618.600] (-616.808) (-617.034) (-616.099) * (-617.087) (-616.101) [-617.007] (-618.849) -- 0:00:25
567500 -- (-615.522) (-617.695) (-618.641) [-617.140] * (-618.373) (-615.928) [-618.643] (-621.596) -- 0:00:25
568000 -- [-615.674] (-618.007) (-616.673) (-617.337) * [-618.934] (-616.204) (-615.779) (-617.515) -- 0:00:25
568500 -- [-615.674] (-616.102) (-617.396) (-617.186) * [-617.323] (-616.889) (-615.922) (-617.693) -- 0:00:25
569000 -- (-618.356) (-619.226) [-615.804] (-618.127) * (-618.633) (-617.924) (-616.418) [-616.978] -- 0:00:25
569500 -- [-617.542] (-618.616) (-618.030) (-616.222) * [-619.906] (-617.891) (-617.061) (-618.091) -- 0:00:25
570000 -- [-619.406] (-618.748) (-617.891) (-620.638) * (-619.264) [-617.761] (-619.920) (-622.451) -- 0:00:25
Average standard deviation of split frequencies: 0.010629
570500 -- (-617.397) (-617.298) [-615.843] (-619.548) * [-615.808] (-616.380) (-618.008) (-620.064) -- 0:00:25
571000 -- [-617.329] (-619.657) (-617.227) (-617.139) * (-618.709) (-615.839) [-616.097] (-620.229) -- 0:00:25
571500 -- (-618.085) (-616.960) (-617.366) [-617.726] * (-619.270) [-617.262] (-616.661) (-618.339) -- 0:00:25
572000 -- (-618.481) [-616.017] (-617.399) (-619.802) * (-617.097) (-618.865) [-617.027] (-619.428) -- 0:00:26
572500 -- (-621.669) (-619.141) [-618.506] (-620.085) * (-616.450) (-617.707) [-618.633] (-629.975) -- 0:00:26
573000 -- (-618.694) (-620.357) [-615.743] (-619.696) * [-616.423] (-621.935) (-618.492) (-617.971) -- 0:00:26
573500 -- (-620.775) [-616.886] (-618.692) (-617.466) * (-617.841) (-618.289) (-617.428) [-616.666] -- 0:00:26
574000 -- (-617.465) [-616.022] (-620.639) (-617.327) * [-617.113] (-620.813) (-620.942) (-618.261) -- 0:00:25
574500 -- (-617.481) (-616.425) (-618.926) [-622.263] * (-618.344) (-617.786) (-621.156) [-617.330] -- 0:00:25
575000 -- [-619.958] (-625.840) (-618.309) (-619.605) * (-617.599) [-618.502] (-618.406) (-618.935) -- 0:00:25
Average standard deviation of split frequencies: 0.010748
575500 -- [-617.073] (-620.082) (-619.939) (-620.540) * (-619.217) [-616.979] (-618.506) (-617.235) -- 0:00:25
576000 -- [-617.431] (-616.501) (-618.038) (-617.008) * (-619.582) (-616.807) [-617.184] (-621.995) -- 0:00:25
576500 -- (-616.184) (-615.932) [-619.652] (-615.594) * (-619.495) [-619.225] (-619.941) (-617.034) -- 0:00:25
577000 -- (-617.011) (-615.508) (-626.130) [-615.553] * (-617.396) [-619.545] (-617.456) (-622.331) -- 0:00:25
577500 -- (-618.918) (-618.180) [-622.945] (-616.112) * (-619.915) (-616.649) (-617.275) [-618.812] -- 0:00:25
578000 -- (-616.113) [-616.710] (-616.168) (-615.410) * (-615.905) [-617.239] (-616.500) (-618.593) -- 0:00:25
578500 -- [-616.529] (-616.356) (-618.317) (-617.839) * (-618.067) (-617.964) (-617.308) [-619.339] -- 0:00:25
579000 -- (-615.992) [-617.795] (-617.309) (-617.676) * (-618.311) (-618.358) (-616.567) [-617.921] -- 0:00:25
579500 -- [-621.530] (-616.481) (-617.682) (-617.733) * (-617.598) [-616.319] (-617.602) (-618.074) -- 0:00:25
580000 -- [-618.446] (-615.554) (-618.157) (-617.249) * [-615.782] (-615.573) (-618.132) (-620.251) -- 0:00:25
Average standard deviation of split frequencies: 0.011257
580500 -- [-620.847] (-618.402) (-621.651) (-618.576) * [-617.028] (-623.838) (-616.106) (-618.710) -- 0:00:25
581000 -- (-617.207) (-616.465) [-616.480] (-617.030) * (-618.634) (-622.990) [-617.819] (-616.807) -- 0:00:25
581500 -- [-616.785] (-615.743) (-618.036) (-616.756) * (-616.675) (-620.320) (-620.873) [-619.482] -- 0:00:25
582000 -- (-617.534) (-616.565) (-622.064) [-617.449] * [-616.790] (-617.300) (-617.706) (-618.709) -- 0:00:25
582500 -- (-618.217) (-620.570) [-619.079] (-619.008) * (-618.474) (-618.972) [-617.048] (-617.327) -- 0:00:25
583000 -- [-616.435] (-621.669) (-618.587) (-615.770) * (-620.961) [-619.151] (-618.312) (-615.360) -- 0:00:25
583500 -- (-620.261) (-618.058) (-616.030) [-616.341] * (-618.171) [-616.306] (-621.333) (-615.382) -- 0:00:24
584000 -- [-615.276] (-618.272) (-622.824) (-619.878) * [-618.299] (-617.108) (-619.155) (-616.707) -- 0:00:24
584500 -- [-619.981] (-621.437) (-619.406) (-618.982) * (-618.883) [-616.959] (-616.665) (-619.099) -- 0:00:24
585000 -- (-618.809) (-620.829) (-618.306) [-616.371] * [-615.864] (-617.716) (-618.422) (-620.376) -- 0:00:24
Average standard deviation of split frequencies: 0.011530
585500 -- [-619.510] (-620.163) (-618.564) (-616.390) * [-618.859] (-627.001) (-615.745) (-616.122) -- 0:00:24
586000 -- (-616.611) [-619.521] (-621.124) (-617.182) * (-619.776) (-625.938) [-618.902] (-620.161) -- 0:00:24
586500 -- (-616.666) (-615.776) (-616.454) [-617.435] * [-618.597] (-616.456) (-616.423) (-621.256) -- 0:00:24
587000 -- (-620.207) (-619.612) [-617.470] (-618.211) * [-617.099] (-615.816) (-617.547) (-618.158) -- 0:00:24
587500 -- (-617.884) [-618.025] (-617.687) (-618.947) * (-619.786) [-616.763] (-617.353) (-619.299) -- 0:00:24
588000 -- (-618.945) [-616.096] (-616.593) (-616.912) * (-622.132) [-616.453] (-617.022) (-617.105) -- 0:00:24
588500 -- [-618.646] (-617.681) (-616.400) (-615.926) * [-618.090] (-620.065) (-617.488) (-617.675) -- 0:00:24
589000 -- (-617.747) [-619.571] (-617.374) (-617.619) * (-618.921) [-617.566] (-620.211) (-617.986) -- 0:00:25
589500 -- [-618.363] (-616.796) (-619.604) (-619.965) * (-618.562) (-617.970) (-618.424) [-619.149] -- 0:00:25
590000 -- (-619.244) (-621.955) (-619.904) [-622.352] * (-618.968) [-619.767] (-620.842) (-616.745) -- 0:00:25
Average standard deviation of split frequencies: 0.011173
590500 -- [-615.836] (-618.744) (-616.590) (-618.973) * (-618.953) [-616.398] (-616.775) (-615.969) -- 0:00:24
591000 -- (-616.957) (-619.343) (-620.694) [-619.662] * (-618.886) (-616.837) [-615.903] (-619.969) -- 0:00:24
591500 -- (-617.917) (-618.027) [-617.484] (-617.264) * (-623.783) (-616.240) [-617.782] (-619.093) -- 0:00:24
592000 -- (-617.648) (-616.356) [-617.027] (-619.340) * (-618.179) (-617.958) (-617.788) [-616.805] -- 0:00:24
592500 -- [-617.940] (-618.302) (-616.475) (-616.023) * (-618.295) (-617.207) [-618.318] (-618.165) -- 0:00:24
593000 -- (-617.759) [-618.119] (-617.370) (-620.115) * [-618.103] (-616.504) (-616.334) (-616.732) -- 0:00:24
593500 -- (-617.278) (-616.342) [-616.313] (-619.636) * [-615.568] (-617.305) (-616.683) (-617.441) -- 0:00:24
594000 -- (-620.519) [-616.345] (-620.263) (-617.463) * (-615.888) [-617.161] (-616.706) (-619.157) -- 0:00:24
594500 -- (-615.552) (-615.389) [-616.966] (-616.966) * [-617.442] (-617.427) (-616.834) (-616.648) -- 0:00:24
595000 -- (-615.522) (-617.618) [-617.039] (-617.581) * (-621.369) (-616.774) [-618.748] (-617.086) -- 0:00:24
Average standard deviation of split frequencies: 0.011126
595500 -- (-617.197) [-620.453] (-615.671) (-617.089) * (-616.053) (-618.093) [-616.985] (-615.864) -- 0:00:24
596000 -- (-618.049) [-620.828] (-616.038) (-618.624) * (-616.639) (-616.992) [-617.479] (-616.029) -- 0:00:24
596500 -- [-617.175] (-615.719) (-617.025) (-618.130) * (-616.960) (-615.914) (-618.055) [-616.487] -- 0:00:24
597000 -- (-618.700) (-616.533) [-616.927] (-617.727) * [-618.843] (-616.342) (-615.778) (-617.249) -- 0:00:24
597500 -- (-618.259) (-621.210) [-619.204] (-618.891) * (-618.228) [-617.695] (-618.625) (-619.635) -- 0:00:24
598000 -- (-620.648) [-617.623] (-616.601) (-619.517) * (-616.852) [-617.396] (-616.673) (-616.469) -- 0:00:24
598500 -- [-617.587] (-618.739) (-616.389) (-623.209) * (-618.450) (-620.886) (-616.510) [-616.667] -- 0:00:24
599000 -- (-616.767) [-619.973] (-618.569) (-624.491) * [-616.976] (-618.926) (-618.094) (-619.037) -- 0:00:24
599500 -- (-616.512) (-620.153) (-618.262) [-617.978] * (-617.677) [-618.484] (-618.259) (-616.272) -- 0:00:24
600000 -- (-622.449) [-622.226] (-615.898) (-617.214) * (-619.302) (-617.123) (-617.424) [-616.276] -- 0:00:24
Average standard deviation of split frequencies: 0.010307
600500 -- (-620.428) (-618.420) (-615.616) [-619.257] * (-621.017) [-617.477] (-615.599) (-617.956) -- 0:00:23
601000 -- (-616.665) [-616.583] (-623.998) (-617.467) * [-618.783] (-616.703) (-619.061) (-617.263) -- 0:00:23
601500 -- (-618.722) (-616.946) (-615.657) [-617.203] * (-619.207) (-617.762) (-617.138) [-617.111] -- 0:00:23
602000 -- (-619.060) (-618.241) [-617.215] (-618.178) * (-618.578) (-619.352) [-617.157] (-617.250) -- 0:00:23
602500 -- (-616.555) (-618.858) [-618.512] (-616.744) * [-618.066] (-619.387) (-617.972) (-616.592) -- 0:00:23
603000 -- [-619.313] (-617.672) (-617.487) (-621.679) * (-616.985) [-617.231] (-617.168) (-619.326) -- 0:00:23
603500 -- [-618.015] (-617.360) (-616.405) (-616.336) * (-620.842) [-620.190] (-615.787) (-617.877) -- 0:00:23
604000 -- (-618.580) (-619.627) [-616.362] (-617.550) * (-619.990) (-616.849) (-615.554) [-617.913] -- 0:00:23
604500 -- (-616.450) (-617.061) (-617.038) [-615.386] * (-619.775) (-616.932) (-616.933) [-616.367] -- 0:00:23
605000 -- (-618.996) (-619.288) [-617.451] (-615.897) * (-617.411) (-616.193) (-616.597) [-618.443] -- 0:00:23
Average standard deviation of split frequencies: 0.009853
605500 -- (-616.249) (-620.476) (-616.485) [-615.973] * (-617.673) [-617.376] (-618.784) (-621.828) -- 0:00:24
606000 -- [-617.110] (-619.869) (-615.849) (-616.685) * (-617.294) (-618.410) [-617.382] (-617.431) -- 0:00:24
606500 -- (-621.831) (-618.523) [-615.859] (-617.280) * [-617.798] (-618.149) (-617.120) (-616.561) -- 0:00:24
607000 -- (-617.541) (-616.953) [-617.929] (-616.383) * (-616.857) (-617.990) [-616.062] (-616.461) -- 0:00:23
607500 -- (-617.314) (-616.498) (-617.642) [-618.319] * [-616.467] (-617.579) (-618.193) (-619.818) -- 0:00:23
608000 -- [-616.825] (-616.544) (-617.613) (-618.747) * (-618.447) (-619.797) [-616.097] (-616.614) -- 0:00:23
608500 -- (-616.340) (-619.282) [-616.614] (-620.417) * (-617.538) (-618.193) (-617.630) [-618.460] -- 0:00:23
609000 -- [-616.235] (-618.585) (-616.131) (-616.692) * (-617.883) [-617.594] (-615.723) (-623.705) -- 0:00:23
609500 -- (-617.354) (-616.066) [-616.847] (-618.920) * (-618.756) (-616.740) [-615.648] (-617.266) -- 0:00:23
610000 -- (-616.987) (-618.032) [-618.336] (-624.398) * (-617.601) (-615.617) [-616.201] (-620.587) -- 0:00:23
Average standard deviation of split frequencies: 0.009675
610500 -- (-616.161) (-620.207) (-617.427) [-618.098] * (-622.221) (-616.164) (-616.809) [-617.411] -- 0:00:23
611000 -- (-617.680) (-619.631) (-616.120) [-623.227] * (-618.722) [-617.596] (-615.891) (-616.346) -- 0:00:23
611500 -- [-616.675] (-619.084) (-616.022) (-619.136) * (-618.676) (-617.159) [-616.289] (-616.570) -- 0:00:23
612000 -- (-615.698) (-617.998) (-615.871) [-620.637] * (-620.265) [-616.737] (-616.898) (-618.282) -- 0:00:23
612500 -- (-616.540) (-620.276) [-618.100] (-620.974) * [-622.142] (-615.788) (-616.582) (-617.444) -- 0:00:23
613000 -- (-617.604) [-617.154] (-619.690) (-616.711) * [-622.413] (-619.669) (-617.381) (-615.902) -- 0:00:23
613500 -- [-616.835] (-616.211) (-619.609) (-616.871) * (-617.575) (-617.760) (-615.757) [-619.079] -- 0:00:23
614000 -- (-617.922) (-616.204) (-621.000) [-618.351] * (-619.064) (-618.250) (-620.139) [-617.659] -- 0:00:23
614500 -- (-616.978) (-616.846) [-620.036] (-619.285) * [-617.983] (-620.479) (-617.928) (-617.004) -- 0:00:23
615000 -- (-616.794) (-619.509) (-619.527) [-617.675] * (-615.950) (-615.732) [-617.253] (-617.757) -- 0:00:23
Average standard deviation of split frequencies: 0.009693
615500 -- [-616.334] (-615.961) (-615.358) (-618.056) * (-617.130) (-619.791) [-617.067] (-617.436) -- 0:00:23
616000 -- (-616.553) (-617.333) [-617.059] (-615.969) * (-617.291) [-617.575] (-615.998) (-617.529) -- 0:00:23
616500 -- (-616.232) [-618.228] (-617.631) (-618.620) * (-617.380) [-619.048] (-617.811) (-617.571) -- 0:00:23
617000 -- (-616.613) [-615.254] (-618.976) (-616.047) * [-617.982] (-615.676) (-620.040) (-616.982) -- 0:00:22
617500 -- (-617.577) (-616.551) [-618.907] (-617.182) * (-616.916) (-617.797) (-620.140) [-615.962] -- 0:00:22
618000 -- (-616.684) [-617.388] (-618.648) (-617.779) * (-617.814) (-616.499) (-617.575) [-615.936] -- 0:00:22
618500 -- (-618.090) (-617.650) (-618.272) [-615.793] * (-615.843) [-615.950] (-622.902) (-616.445) -- 0:00:22
619000 -- [-617.655] (-617.680) (-625.870) (-623.354) * [-615.977] (-617.925) (-621.318) (-616.108) -- 0:00:22
619500 -- (-616.620) (-619.377) [-620.121] (-619.856) * (-619.399) [-620.125] (-616.657) (-621.967) -- 0:00:22
620000 -- (-616.423) [-619.196] (-616.359) (-618.518) * (-622.735) [-616.173] (-615.738) (-616.921) -- 0:00:22
Average standard deviation of split frequencies: 0.008608
620500 -- (-618.029) (-617.083) (-617.180) [-615.900] * (-624.100) [-616.799] (-616.374) (-616.288) -- 0:00:22
621000 -- (-617.617) [-615.416] (-617.138) (-619.386) * (-615.712) [-617.589] (-617.348) (-621.417) -- 0:00:22
621500 -- (-618.729) (-615.993) [-616.516] (-615.255) * (-615.516) (-617.316) [-619.173] (-619.019) -- 0:00:22
622000 -- (-616.227) (-622.202) (-620.627) [-618.161] * (-617.375) (-616.739) [-620.114] (-616.678) -- 0:00:22
622500 -- (-615.652) (-619.249) [-618.119] (-617.424) * (-616.263) (-616.354) [-618.765] (-620.661) -- 0:00:23
623000 -- [-617.215] (-619.019) (-617.491) (-621.592) * (-620.239) [-616.588] (-616.344) (-617.879) -- 0:00:22
623500 -- [-615.957] (-620.141) (-618.037) (-620.599) * (-617.129) (-619.528) (-615.780) [-618.846] -- 0:00:22
624000 -- [-617.977] (-618.427) (-618.134) (-620.411) * [-616.497] (-615.931) (-620.564) (-618.397) -- 0:00:22
624500 -- [-618.744] (-616.576) (-617.021) (-616.600) * (-618.120) (-616.721) (-616.986) [-616.603] -- 0:00:22
625000 -- (-616.668) (-618.225) [-618.016] (-618.045) * (-616.234) (-617.904) [-616.596] (-618.541) -- 0:00:22
Average standard deviation of split frequencies: 0.008986
625500 -- (-620.393) [-616.850] (-621.727) (-618.882) * (-621.497) (-621.483) [-616.504] (-622.604) -- 0:00:22
626000 -- [-617.914] (-617.697) (-616.004) (-619.341) * [-618.288] (-619.112) (-617.215) (-624.694) -- 0:00:22
626500 -- [-619.596] (-616.725) (-619.074) (-621.154) * (-619.084) [-619.344] (-618.624) (-617.937) -- 0:00:22
627000 -- (-616.986) [-616.758] (-617.242) (-617.383) * (-620.761) (-617.612) (-616.314) [-620.178] -- 0:00:22
627500 -- (-616.735) (-617.056) (-618.743) [-616.730] * (-621.410) (-616.822) (-617.428) [-619.726] -- 0:00:22
628000 -- (-616.477) [-616.917] (-619.601) (-617.735) * (-621.279) [-616.944] (-616.839) (-617.867) -- 0:00:22
628500 -- (-616.664) [-617.648] (-617.670) (-616.937) * (-616.829) (-616.232) [-617.175] (-618.298) -- 0:00:22
629000 -- [-619.814] (-619.549) (-616.827) (-616.139) * (-616.638) [-617.857] (-617.735) (-616.102) -- 0:00:22
629500 -- (-619.039) [-619.759] (-616.416) (-616.592) * (-616.888) (-617.841) [-618.010] (-616.062) -- 0:00:22
630000 -- (-618.424) (-616.097) [-616.507] (-617.932) * [-616.793] (-619.952) (-615.346) (-616.663) -- 0:00:22
Average standard deviation of split frequencies: 0.008571
630500 -- (-619.482) (-618.500) [-619.232] (-617.139) * (-617.157) (-617.166) (-616.999) [-616.304] -- 0:00:22
631000 -- [-622.786] (-617.428) (-616.909) (-619.359) * (-617.119) (-617.337) [-616.886] (-619.045) -- 0:00:22
631500 -- (-618.203) (-617.052) [-616.723] (-618.956) * (-617.153) [-620.689] (-617.867) (-619.675) -- 0:00:22
632000 -- [-616.799] (-617.965) (-616.623) (-615.938) * [-616.265] (-619.803) (-617.357) (-617.542) -- 0:00:22
632500 -- (-618.504) (-617.115) (-618.608) [-616.029] * (-616.946) (-616.694) [-618.358] (-617.271) -- 0:00:22
633000 -- [-619.180] (-618.632) (-619.423) (-616.598) * (-617.824) (-621.147) [-616.119] (-619.752) -- 0:00:22
633500 -- (-619.911) (-615.885) (-616.358) [-615.673] * (-617.673) (-617.602) (-618.841) [-616.786] -- 0:00:21
634000 -- (-621.794) [-615.595] (-617.078) (-615.785) * [-615.547] (-615.844) (-617.048) (-619.270) -- 0:00:21
634500 -- (-617.679) [-615.876] (-618.512) (-615.738) * [-622.309] (-615.324) (-616.081) (-617.301) -- 0:00:21
635000 -- (-617.620) (-617.278) [-617.976] (-616.054) * (-617.966) (-621.489) (-616.133) [-616.144] -- 0:00:21
Average standard deviation of split frequencies: 0.008845
635500 -- (-618.172) (-616.147) (-616.545) [-617.449] * (-616.717) (-620.906) [-617.337] (-617.975) -- 0:00:21
636000 -- [-616.778] (-616.801) (-616.707) (-616.851) * [-616.339] (-616.380) (-615.369) (-617.322) -- 0:00:21
636500 -- (-617.696) [-616.204] (-617.553) (-615.826) * (-615.531) [-619.471] (-615.877) (-616.695) -- 0:00:21
637000 -- (-619.056) (-619.411) [-617.911] (-617.309) * [-618.115] (-616.031) (-616.091) (-618.944) -- 0:00:21
637500 -- [-618.730] (-620.359) (-618.069) (-617.331) * (-616.492) [-615.741] (-618.804) (-618.630) -- 0:00:21
638000 -- (-618.848) (-615.608) (-616.944) [-617.244] * (-616.358) (-616.023) [-617.426] (-618.944) -- 0:00:21
638500 -- [-622.724] (-616.802) (-616.657) (-615.874) * [-616.921] (-616.659) (-617.074) (-616.874) -- 0:00:21
639000 -- (-620.715) (-617.294) (-616.284) [-615.861] * [-617.250] (-620.170) (-617.946) (-617.126) -- 0:00:22
639500 -- (-621.914) (-617.637) (-615.622) [-616.271] * (-616.503) (-615.684) (-618.780) [-617.294] -- 0:00:21
640000 -- (-617.217) (-620.106) (-617.899) [-618.190] * (-616.172) (-617.671) (-618.188) [-618.369] -- 0:00:21
Average standard deviation of split frequencies: 0.008584
640500 -- (-619.443) [-617.503] (-615.904) (-618.782) * (-617.684) (-615.973) [-616.746] (-616.916) -- 0:00:21
641000 -- (-616.786) [-618.024] (-618.838) (-618.659) * (-617.105) (-617.539) (-617.555) [-620.138] -- 0:00:21
641500 -- (-615.274) (-619.649) [-618.008] (-621.936) * (-616.491) (-619.507) (-618.332) [-618.020] -- 0:00:21
642000 -- (-619.575) [-616.641] (-616.912) (-621.471) * (-617.662) [-618.070] (-616.788) (-616.840) -- 0:00:21
642500 -- (-617.251) [-617.386] (-619.263) (-623.475) * (-621.016) [-617.886] (-617.794) (-617.284) -- 0:00:21
643000 -- [-617.833] (-616.996) (-616.890) (-621.449) * (-617.342) (-617.280) [-616.400] (-617.075) -- 0:00:21
643500 -- (-617.895) (-617.479) [-617.117] (-621.156) * (-622.173) [-617.372] (-616.525) (-617.116) -- 0:00:21
644000 -- (-619.378) [-616.958] (-617.442) (-620.862) * (-619.792) (-621.307) [-617.334] (-617.091) -- 0:00:21
644500 -- [-617.513] (-616.659) (-616.634) (-618.605) * (-616.657) (-616.985) [-616.945] (-615.444) -- 0:00:21
645000 -- (-617.361) (-616.682) [-616.211] (-617.412) * (-617.541) [-617.107] (-618.245) (-617.569) -- 0:00:21
Average standard deviation of split frequencies: 0.008611
645500 -- (-617.633) (-615.647) (-618.614) [-617.869] * (-617.457) (-621.922) (-617.436) [-616.556] -- 0:00:21
646000 -- (-617.312) [-618.248] (-619.245) (-617.862) * (-616.571) (-617.730) (-616.621) [-616.740] -- 0:00:21
646500 -- (-618.133) (-619.732) [-617.247] (-617.964) * [-617.974] (-618.420) (-616.696) (-617.387) -- 0:00:21
647000 -- (-618.040) (-617.293) [-615.964] (-617.923) * (-625.850) (-617.912) [-617.751] (-617.070) -- 0:00:21
647500 -- [-617.878] (-617.827) (-617.079) (-617.946) * (-616.340) [-616.947] (-620.458) (-616.992) -- 0:00:21
648000 -- (-619.918) [-615.898] (-615.876) (-616.911) * (-616.992) [-617.583] (-622.317) (-617.972) -- 0:00:21
648500 -- [-616.651] (-617.196) (-621.427) (-616.213) * (-618.735) (-616.506) (-617.037) [-617.000] -- 0:00:21
649000 -- (-616.854) [-615.467] (-616.364) (-615.516) * [-616.494] (-619.709) (-620.327) (-618.993) -- 0:00:21
649500 -- (-618.494) (-617.996) (-616.989) [-615.677] * (-618.756) [-618.245] (-622.897) (-616.259) -- 0:00:21
650000 -- (-626.794) (-618.370) [-617.374] (-617.343) * (-618.445) (-616.235) [-618.377] (-615.962) -- 0:00:21
Average standard deviation of split frequencies: 0.007680
650500 -- [-618.090] (-616.274) (-619.141) (-617.655) * (-618.210) [-617.530] (-615.966) (-617.408) -- 0:00:20
651000 -- (-624.872) [-615.662] (-617.087) (-616.314) * [-618.111] (-619.788) (-619.336) (-616.836) -- 0:00:20
651500 -- (-616.584) (-616.738) [-617.285] (-615.599) * (-617.154) [-616.884] (-618.030) (-619.300) -- 0:00:20
652000 -- (-618.577) (-618.327) (-618.347) [-616.416] * (-616.612) (-618.343) [-616.661] (-617.448) -- 0:00:20
652500 -- (-617.756) (-617.740) (-616.618) [-616.017] * (-618.136) [-616.725] (-616.619) (-615.768) -- 0:00:20
653000 -- (-619.228) (-620.709) (-616.476) [-616.362] * (-617.417) (-618.383) [-617.979] (-616.115) -- 0:00:20
653500 -- (-617.497) (-619.474) (-615.832) [-615.870] * (-617.126) (-616.502) (-616.769) [-615.935] -- 0:00:20
654000 -- (-616.676) [-617.088] (-617.129) (-618.808) * (-618.114) (-617.425) [-624.724] (-619.394) -- 0:00:20
654500 -- (-617.412) (-618.237) [-616.064] (-618.434) * (-617.171) [-618.361] (-617.548) (-617.352) -- 0:00:20
655000 -- (-616.376) (-617.898) (-616.660) [-616.600] * (-617.568) [-616.871] (-617.311) (-616.760) -- 0:00:20
Average standard deviation of split frequencies: 0.007282
655500 -- (-618.340) (-617.066) [-615.752] (-616.837) * [-619.377] (-616.973) (-618.211) (-616.923) -- 0:00:20
656000 -- (-618.233) [-617.385] (-620.540) (-623.300) * (-621.807) (-616.439) (-619.488) [-616.449] -- 0:00:20
656500 -- [-616.161] (-619.658) (-619.806) (-617.138) * (-615.639) [-616.766] (-616.625) (-617.534) -- 0:00:20
657000 -- (-616.108) (-618.874) (-616.304) [-616.426] * [-616.256] (-619.899) (-617.007) (-618.414) -- 0:00:20
657500 -- (-616.281) [-619.117] (-620.237) (-616.867) * [-617.177] (-618.619) (-617.613) (-618.647) -- 0:00:20
658000 -- (-617.764) [-618.226] (-619.159) (-616.267) * (-618.956) (-620.184) [-616.601] (-617.986) -- 0:00:20
658500 -- (-615.552) (-622.632) (-621.306) [-618.345] * [-617.039] (-616.218) (-620.189) (-620.061) -- 0:00:20
659000 -- [-615.827] (-619.021) (-618.773) (-617.230) * (-617.390) (-618.392) (-618.113) [-619.300] -- 0:00:20
659500 -- (-618.101) [-617.633] (-617.191) (-618.189) * (-620.626) (-617.398) [-617.116] (-617.778) -- 0:00:20
660000 -- (-615.916) [-618.717] (-618.568) (-617.251) * (-617.354) (-616.554) (-616.778) [-616.891] -- 0:00:20
Average standard deviation of split frequencies: 0.007421
660500 -- (-616.486) (-621.193) (-618.751) [-624.272] * [-620.758] (-617.701) (-620.429) (-616.068) -- 0:00:20
661000 -- (-616.191) (-618.977) [-621.153] (-616.787) * (-617.348) (-616.124) [-620.576] (-620.564) -- 0:00:20
661500 -- (-625.884) (-620.455) [-616.734] (-619.870) * [-618.392] (-615.959) (-616.879) (-618.953) -- 0:00:20
662000 -- (-618.146) (-617.471) (-617.305) [-620.840] * [-616.046] (-617.401) (-617.064) (-616.811) -- 0:00:20
662500 -- [-616.018] (-615.535) (-617.086) (-616.497) * (-618.588) (-620.332) [-621.900] (-618.957) -- 0:00:20
663000 -- (-621.634) [-616.863] (-618.056) (-619.871) * (-619.383) (-622.230) (-616.861) [-615.888] -- 0:00:20
663500 -- (-624.151) [-618.627] (-617.380) (-616.554) * (-616.675) (-622.877) [-620.233] (-619.030) -- 0:00:20
664000 -- (-620.808) (-616.736) (-618.336) [-618.257] * (-618.141) (-616.028) [-617.606] (-619.337) -- 0:00:20
664500 -- [-622.119] (-618.749) (-619.674) (-619.345) * (-624.416) [-620.583] (-617.856) (-616.791) -- 0:00:20
665000 -- (-616.656) (-615.681) [-621.151] (-616.790) * (-618.742) [-617.269] (-619.786) (-617.023) -- 0:00:20
Average standard deviation of split frequencies: 0.007456
665500 -- (-615.494) (-618.536) [-618.750] (-618.853) * (-617.366) (-617.168) (-616.935) [-616.405] -- 0:00:20
666000 -- (-616.497) (-616.924) [-618.029] (-617.559) * (-620.505) [-616.702] (-619.798) (-618.059) -- 0:00:20
666500 -- (-616.786) (-617.799) [-619.705] (-621.214) * [-619.389] (-617.008) (-616.927) (-616.328) -- 0:00:20
667000 -- (-620.880) [-617.570] (-620.229) (-616.321) * (-616.913) (-621.391) (-619.934) [-616.197] -- 0:00:19
667500 -- (-616.350) (-617.296) (-617.591) [-616.628] * (-622.573) (-615.748) (-616.910) [-617.018] -- 0:00:19
668000 -- [-617.311] (-617.132) (-618.941) (-618.583) * [-616.531] (-616.255) (-619.860) (-616.929) -- 0:00:19
668500 -- (-618.288) (-622.213) (-616.495) [-617.402] * (-619.928) (-618.455) [-620.606] (-616.818) -- 0:00:19
669000 -- (-615.770) (-618.462) (-617.209) [-616.820] * (-618.820) (-619.126) [-620.944] (-620.104) -- 0:00:19
669500 -- (-617.558) (-616.307) (-618.417) [-619.600] * (-618.936) (-618.235) (-623.474) [-619.778] -- 0:00:19
670000 -- [-617.873] (-617.930) (-618.305) (-618.851) * (-616.881) (-621.297) [-616.945] (-617.685) -- 0:00:19
Average standard deviation of split frequencies: 0.007779
670500 -- (-617.067) (-616.885) (-621.963) [-618.147] * (-617.594) (-622.794) (-616.074) [-619.017] -- 0:00:19
671000 -- (-617.434) [-617.426] (-617.328) (-624.083) * (-618.297) [-617.536] (-615.745) (-622.585) -- 0:00:19
671500 -- (-621.372) (-619.497) [-619.414] (-618.355) * (-620.499) (-618.275) (-617.359) [-617.003] -- 0:00:19
672000 -- (-618.396) (-616.009) [-619.053] (-619.427) * (-617.382) (-615.787) (-618.128) [-616.287] -- 0:00:19
672500 -- (-621.406) [-618.291] (-620.336) (-619.757) * [-619.731] (-617.563) (-619.167) (-619.371) -- 0:00:19
673000 -- (-617.802) [-617.339] (-616.689) (-617.503) * [-620.788] (-616.199) (-617.529) (-615.869) -- 0:00:19
673500 -- (-620.255) (-619.658) (-616.402) [-617.079] * (-620.312) (-617.578) (-617.634) [-615.720] -- 0:00:19
674000 -- (-617.032) (-617.136) (-616.340) [-615.978] * (-619.738) (-617.248) (-617.091) [-615.727] -- 0:00:19
674500 -- (-616.448) (-616.900) (-617.921) [-616.814] * (-622.888) [-620.227] (-622.157) (-616.775) -- 0:00:19
675000 -- (-616.930) [-617.142] (-617.880) (-618.288) * [-616.275] (-617.736) (-618.384) (-616.544) -- 0:00:19
Average standard deviation of split frequencies: 0.007810
675500 -- (-617.854) [-615.748] (-618.709) (-620.528) * (-616.753) (-617.673) [-616.156] (-616.578) -- 0:00:19
676000 -- (-619.136) (-616.441) (-618.241) [-617.561] * (-617.734) (-619.568) (-616.156) [-619.740] -- 0:00:19
676500 -- (-619.326) (-616.387) (-616.369) [-617.384] * (-618.374) [-617.998] (-617.203) (-620.251) -- 0:00:19
677000 -- [-618.323] (-617.204) (-617.461) (-616.062) * (-616.355) [-616.021] (-617.452) (-619.839) -- 0:00:19
677500 -- [-616.795] (-618.679) (-615.401) (-618.593) * (-617.470) (-618.329) [-617.185] (-618.209) -- 0:00:19
678000 -- (-617.120) [-619.817] (-617.115) (-617.835) * (-618.603) (-617.281) (-617.035) [-615.995] -- 0:00:19
678500 -- (-616.876) [-616.736] (-618.972) (-616.066) * (-622.533) [-618.264] (-615.315) (-617.267) -- 0:00:19
679000 -- (-618.970) (-617.514) [-616.566] (-616.865) * [-617.980] (-617.967) (-618.461) (-618.658) -- 0:00:19
679500 -- (-619.729) (-616.231) (-616.819) [-618.816] * (-620.444) [-617.852] (-617.204) (-615.945) -- 0:00:19
680000 -- (-615.848) (-616.851) [-616.701] (-624.355) * (-619.208) [-616.729] (-616.514) (-617.245) -- 0:00:19
Average standard deviation of split frequencies: 0.008218
680500 -- (-618.529) (-618.311) (-617.373) [-616.646] * (-617.093) (-615.651) (-616.300) [-616.291] -- 0:00:19
681000 -- [-616.580] (-619.466) (-616.012) (-618.064) * (-617.848) (-617.919) (-615.772) [-616.480] -- 0:00:19
681500 -- (-618.145) [-616.526] (-619.290) (-618.106) * [-617.185] (-617.400) (-616.554) (-620.223) -- 0:00:19
682000 -- (-616.255) (-616.452) [-618.568] (-616.812) * [-615.605] (-617.717) (-616.816) (-623.468) -- 0:00:19
682500 -- (-616.209) (-618.918) (-616.441) [-617.199] * (-615.690) (-617.219) (-618.584) [-616.830] -- 0:00:19
683000 -- (-619.301) (-618.704) (-616.637) [-618.720] * (-616.358) (-616.955) (-616.846) [-618.691] -- 0:00:19
683500 -- (-617.439) (-617.933) [-617.726] (-618.956) * (-617.769) (-616.682) [-620.074] (-617.671) -- 0:00:18
684000 -- (-616.773) (-618.250) (-617.349) [-620.575] * (-617.557) [-616.557] (-615.762) (-616.408) -- 0:00:18
684500 -- (-618.607) (-618.112) [-618.617] (-617.271) * (-616.937) (-616.337) (-617.350) [-616.556] -- 0:00:18
685000 -- (-621.427) (-617.733) (-619.499) [-618.533] * (-617.189) [-617.210] (-618.740) (-620.043) -- 0:00:18
Average standard deviation of split frequencies: 0.008613
685500 -- (-616.901) [-622.253] (-616.101) (-617.979) * (-617.567) (-621.556) (-618.056) [-619.073] -- 0:00:18
686000 -- (-617.317) (-618.928) [-616.353] (-619.101) * (-618.527) (-617.695) [-617.581] (-619.137) -- 0:00:18
686500 -- (-618.564) [-615.322] (-615.613) (-619.444) * (-620.356) (-618.307) [-618.531] (-622.219) -- 0:00:18
687000 -- (-616.579) (-617.888) (-618.037) [-616.742] * (-618.842) [-617.455] (-617.015) (-617.144) -- 0:00:18
687500 -- [-616.734] (-619.968) (-618.150) (-618.478) * (-621.920) (-616.555) (-617.279) [-619.970] -- 0:00:18
688000 -- (-617.624) (-616.086) (-617.421) [-617.349] * (-615.461) (-618.995) (-617.426) [-618.255] -- 0:00:18
688500 -- (-617.831) [-617.806] (-616.718) (-620.955) * (-616.417) (-620.751) [-617.671] (-618.339) -- 0:00:18
689000 -- (-620.610) (-617.594) (-619.465) [-618.025] * [-616.202] (-619.435) (-616.648) (-618.409) -- 0:00:18
689500 -- (-619.966) [-619.655] (-617.956) (-622.132) * (-616.742) [-616.692] (-616.829) (-619.931) -- 0:00:18
690000 -- (-618.237) (-618.412) [-619.717] (-619.187) * (-621.228) (-619.513) (-616.583) [-617.148] -- 0:00:18
Average standard deviation of split frequencies: 0.008372
690500 -- [-619.857] (-616.331) (-622.815) (-617.090) * (-618.446) [-616.569] (-617.524) (-618.760) -- 0:00:18
691000 -- (-618.270) [-616.122] (-618.149) (-617.041) * [-620.481] (-617.846) (-616.616) (-618.490) -- 0:00:18
691500 -- [-617.312] (-620.132) (-618.207) (-619.072) * [-616.853] (-619.015) (-620.989) (-618.790) -- 0:00:18
692000 -- (-618.784) [-618.589] (-616.264) (-615.546) * (-615.256) (-619.101) [-618.876] (-617.325) -- 0:00:18
692500 -- (-622.156) (-619.552) [-616.485] (-618.086) * (-619.052) (-617.221) (-616.030) [-617.296] -- 0:00:18
693000 -- (-617.593) [-616.693] (-615.975) (-623.519) * [-619.278] (-618.659) (-618.872) (-618.790) -- 0:00:18
693500 -- (-619.348) [-620.134] (-619.470) (-617.373) * (-617.855) (-620.195) [-615.199] (-617.825) -- 0:00:18
694000 -- (-617.428) (-616.425) (-620.741) [-617.473] * [-616.348] (-619.928) (-617.971) (-617.574) -- 0:00:18
694500 -- [-616.399] (-624.359) (-616.455) (-616.749) * (-615.723) (-616.390) [-617.329] (-617.240) -- 0:00:18
695000 -- (-617.039) (-616.975) (-618.499) [-617.564] * (-615.667) (-621.189) [-617.567] (-617.414) -- 0:00:18
Average standard deviation of split frequencies: 0.007857
695500 -- (-617.805) (-616.760) (-617.343) [-617.380] * (-616.638) (-617.859) (-619.141) [-616.345] -- 0:00:18
696000 -- (-617.014) [-617.498] (-616.448) (-618.446) * [-621.976] (-619.183) (-617.027) (-617.864) -- 0:00:18
696500 -- (-616.459) (-618.479) [-616.672] (-618.161) * (-617.577) (-621.930) [-616.389] (-616.123) -- 0:00:18
697000 -- (-616.616) (-620.183) (-619.055) [-615.970] * (-623.607) [-617.309] (-618.177) (-617.283) -- 0:00:18
697500 -- (-616.349) (-620.887) (-618.255) [-615.728] * [-616.312] (-617.227) (-623.516) (-616.665) -- 0:00:18
698000 -- (-617.297) (-617.545) [-615.788] (-618.665) * (-616.682) (-616.588) [-617.000] (-617.288) -- 0:00:18
698500 -- (-616.024) (-621.999) (-618.904) [-616.676] * (-615.784) (-616.813) (-616.537) [-616.805] -- 0:00:18
699000 -- [-616.599] (-621.049) (-616.387) (-619.848) * [-616.894] (-617.487) (-617.333) (-620.511) -- 0:00:18
699500 -- (-621.128) (-618.069) (-617.767) [-617.005] * (-617.181) (-622.697) (-616.518) [-617.538] -- 0:00:18
700000 -- (-620.107) (-616.050) (-617.835) [-616.586] * [-615.978] (-620.165) (-617.057) (-616.572) -- 0:00:18
Average standard deviation of split frequencies: 0.008118
700500 -- (-618.219) (-617.373) (-615.777) [-616.091] * [-615.551] (-617.825) (-616.264) (-616.677) -- 0:00:17
701000 -- [-617.688] (-618.871) (-619.949) (-616.457) * (-617.865) [-617.380] (-615.623) (-618.592) -- 0:00:17
701500 -- (-618.243) (-621.007) [-617.442] (-616.417) * (-618.321) [-618.641] (-617.800) (-618.032) -- 0:00:17
702000 -- [-615.450] (-619.258) (-617.468) (-616.146) * (-617.489) (-618.847) (-617.760) [-616.992] -- 0:00:17
702500 -- (-617.265) [-618.667] (-617.095) (-618.297) * (-617.680) [-617.277] (-618.022) (-616.693) -- 0:00:17
703000 -- (-619.995) [-617.086] (-618.720) (-618.559) * (-623.763) [-618.840] (-618.348) (-616.923) -- 0:00:17
703500 -- (-620.032) (-616.619) (-618.477) [-618.662] * [-618.410] (-616.665) (-620.380) (-620.788) -- 0:00:17
704000 -- (-618.501) [-617.103] (-619.507) (-619.209) * (-619.302) (-616.883) [-620.096] (-619.718) -- 0:00:17
704500 -- (-617.889) (-617.312) (-616.915) [-618.002] * (-617.053) (-616.579) [-621.299] (-617.008) -- 0:00:17
705000 -- (-616.585) [-618.484] (-618.255) (-616.740) * (-616.910) [-616.668] (-619.704) (-620.223) -- 0:00:17
Average standard deviation of split frequencies: 0.007790
705500 -- [-617.771] (-618.305) (-619.518) (-619.642) * [-618.725] (-620.874) (-615.915) (-616.710) -- 0:00:17
706000 -- (-620.527) (-622.121) [-616.325] (-617.636) * (-619.940) (-616.881) (-615.966) [-616.053] -- 0:00:17
706500 -- (-618.089) [-619.284] (-616.356) (-617.746) * (-617.669) (-621.253) (-622.680) [-618.535] -- 0:00:17
707000 -- (-616.062) (-618.320) [-616.023] (-617.467) * (-616.698) (-618.086) [-623.633] (-616.621) -- 0:00:17
707500 -- [-616.960] (-618.365) (-618.475) (-615.266) * [-621.872] (-617.654) (-618.327) (-617.043) -- 0:00:17
708000 -- [-616.827] (-621.397) (-621.616) (-616.393) * (-619.514) (-618.933) (-618.833) [-615.899] -- 0:00:17
708500 -- [-617.123] (-618.026) (-618.275) (-620.023) * (-618.194) (-616.638) [-619.457] (-619.875) -- 0:00:17
709000 -- [-618.577] (-619.227) (-616.469) (-618.071) * (-616.818) (-617.207) (-618.149) [-615.431] -- 0:00:17
709500 -- (-618.188) (-618.453) [-617.823] (-618.275) * [-616.207] (-617.938) (-616.704) (-618.832) -- 0:00:17
710000 -- [-617.649] (-622.382) (-619.542) (-619.832) * (-617.021) [-617.319] (-620.126) (-618.118) -- 0:00:17
Average standard deviation of split frequencies: 0.007518
710500 -- (-617.663) (-617.852) [-620.086] (-621.243) * (-619.262) (-616.480) [-617.734] (-619.483) -- 0:00:17
711000 -- (-617.644) (-616.067) (-618.401) [-616.131] * (-617.173) (-616.751) (-620.101) [-619.318] -- 0:00:17
711500 -- (-615.561) (-616.174) [-620.215] (-618.978) * (-618.505) [-617.844] (-617.034) (-616.905) -- 0:00:17
712000 -- [-618.754] (-623.594) (-618.083) (-621.209) * (-616.671) (-620.735) (-617.632) [-617.324] -- 0:00:17
712500 -- (-620.845) (-616.102) [-615.637] (-619.552) * [-617.130] (-617.282) (-618.736) (-615.826) -- 0:00:17
713000 -- (-619.300) [-619.201] (-619.531) (-618.359) * [-616.494] (-616.979) (-616.937) (-617.928) -- 0:00:17
713500 -- [-618.288] (-616.107) (-624.383) (-618.092) * (-617.631) [-617.494] (-617.859) (-616.294) -- 0:00:17
714000 -- [-616.711] (-615.678) (-617.319) (-618.172) * (-620.422) (-621.416) [-620.207] (-617.863) -- 0:00:17
714500 -- (-621.850) [-616.566] (-616.967) (-617.174) * (-621.273) (-616.778) [-617.928] (-617.143) -- 0:00:17
715000 -- (-617.457) (-618.915) (-618.206) [-618.469] * (-617.337) [-617.130] (-617.972) (-616.754) -- 0:00:17
Average standard deviation of split frequencies: 0.007769
715500 -- [-617.858] (-619.198) (-618.587) (-617.835) * (-616.798) (-616.175) (-616.076) [-616.290] -- 0:00:17
716000 -- (-619.579) [-621.866] (-617.945) (-618.619) * (-617.430) (-618.384) (-616.746) [-616.358] -- 0:00:17
716500 -- (-618.480) (-618.622) [-616.368] (-618.821) * (-617.412) (-618.013) [-616.468] (-617.014) -- 0:00:17
717000 -- (-615.760) [-616.943] (-620.705) (-619.122) * (-619.862) [-618.476] (-616.523) (-617.040) -- 0:00:16
717500 -- (-616.856) (-616.623) (-617.416) [-617.905] * (-617.787) (-616.369) (-619.805) [-616.906] -- 0:00:16
718000 -- (-620.697) [-618.048] (-619.322) (-617.744) * [-617.425] (-621.222) (-616.923) (-619.240) -- 0:00:16
718500 -- [-616.854] (-616.684) (-615.851) (-617.248) * (-616.487) [-618.802] (-616.140) (-619.049) -- 0:00:16
719000 -- (-617.347) (-617.217) [-616.463] (-617.167) * (-618.298) (-620.764) (-617.884) [-615.898] -- 0:00:16
719500 -- (-615.894) (-615.338) (-615.789) [-617.077] * (-618.837) (-617.824) [-615.971] (-616.742) -- 0:00:16
720000 -- (-615.880) [-623.202] (-618.085) (-617.659) * (-615.941) [-617.412] (-616.437) (-615.741) -- 0:00:16
Average standard deviation of split frequencies: 0.007239
720500 -- (-617.064) [-622.040] (-620.585) (-617.810) * [-615.774] (-617.370) (-615.937) (-616.061) -- 0:00:16
721000 -- (-617.237) (-617.308) [-616.174] (-618.957) * (-618.562) [-616.187] (-616.205) (-621.077) -- 0:00:16
721500 -- (-616.699) (-615.994) (-616.423) [-615.819] * (-617.252) (-623.657) (-620.464) [-620.530] -- 0:00:16
722000 -- (-616.627) (-619.405) (-616.356) [-618.340] * (-616.415) (-615.754) [-617.287] (-618.438) -- 0:00:16
722500 -- (-618.149) (-618.027) [-616.425] (-617.500) * [-618.489] (-616.116) (-618.246) (-620.181) -- 0:00:16
723000 -- (-617.418) [-616.733] (-616.010) (-616.677) * (-619.901) (-617.008) [-623.586] (-622.771) -- 0:00:16
723500 -- (-616.598) (-615.745) [-620.767] (-615.386) * (-617.250) (-617.395) (-616.017) [-616.324] -- 0:00:16
724000 -- (-615.656) (-615.818) (-618.111) [-616.380] * (-618.140) (-615.800) [-616.022] (-618.144) -- 0:00:16
724500 -- (-616.658) (-616.865) (-616.710) [-619.333] * (-615.936) [-619.422] (-615.971) (-619.179) -- 0:00:16
725000 -- (-616.555) (-618.672) (-616.936) [-618.792] * (-616.167) (-617.670) (-618.955) [-618.016] -- 0:00:16
Average standard deviation of split frequencies: 0.007532
725500 -- [-618.907] (-617.969) (-617.378) (-620.931) * (-616.233) (-616.978) [-616.783] (-618.100) -- 0:00:16
726000 -- [-616.087] (-617.971) (-616.244) (-620.122) * (-618.197) [-617.166] (-617.818) (-617.188) -- 0:00:16
726500 -- (-616.495) [-619.363] (-615.703) (-621.566) * [-618.897] (-622.160) (-616.550) (-619.325) -- 0:00:16
727000 -- [-616.318] (-617.042) (-618.899) (-615.885) * (-618.454) (-626.457) [-618.668] (-622.311) -- 0:00:16
727500 -- (-616.526) (-620.020) (-618.436) [-616.168] * [-617.754] (-627.471) (-617.370) (-617.527) -- 0:00:16
728000 -- [-615.716] (-620.460) (-620.228) (-615.822) * (-618.627) (-627.159) (-617.668) [-616.699] -- 0:00:16
728500 -- (-617.196) [-621.446] (-618.937) (-620.428) * (-617.993) (-626.452) [-619.869] (-616.465) -- 0:00:16
729000 -- (-616.619) (-617.787) [-616.113] (-618.458) * (-624.172) (-617.207) [-617.587] (-617.824) -- 0:00:16
729500 -- [-617.446] (-618.661) (-619.293) (-615.990) * (-617.380) [-616.648] (-617.191) (-616.377) -- 0:00:16
730000 -- [-618.209] (-617.956) (-624.637) (-620.215) * (-617.163) [-619.208] (-617.433) (-620.505) -- 0:00:16
Average standard deviation of split frequencies: 0.007871
730500 -- (-618.700) (-617.777) (-618.596) [-615.871] * (-615.804) [-616.620] (-617.408) (-616.819) -- 0:00:16
731000 -- (-617.326) (-618.208) (-618.195) [-617.879] * (-618.174) (-618.778) (-618.431) [-616.364] -- 0:00:16
731500 -- (-616.668) [-618.568] (-617.668) (-616.841) * (-617.548) (-619.231) [-618.097] (-617.368) -- 0:00:16
732000 -- (-622.759) (-618.816) (-615.429) [-616.923] * [-617.341] (-616.290) (-616.426) (-618.979) -- 0:00:16
732500 -- [-617.308] (-617.153) (-615.558) (-617.031) * (-619.411) [-616.743] (-618.096) (-615.876) -- 0:00:16
733000 -- (-618.056) (-616.838) (-615.776) [-618.923] * (-618.858) (-615.802) [-617.590] (-617.521) -- 0:00:16
733500 -- (-616.153) [-615.786] (-618.981) (-616.396) * (-620.263) [-617.653] (-616.058) (-616.387) -- 0:00:15
734000 -- (-616.562) [-619.171] (-618.719) (-616.699) * (-616.821) (-616.107) (-620.388) [-617.045] -- 0:00:15
734500 -- [-618.001] (-618.284) (-622.494) (-615.454) * (-621.508) [-617.106] (-620.216) (-616.371) -- 0:00:15
735000 -- (-619.233) (-621.294) (-618.631) [-615.618] * (-620.006) (-616.071) [-618.486] (-615.824) -- 0:00:15
Average standard deviation of split frequencies: 0.007729
735500 -- (-618.944) [-617.747] (-618.006) (-616.020) * (-619.952) (-618.326) (-619.052) [-616.567] -- 0:00:15
736000 -- (-619.381) (-617.130) (-618.799) [-616.815] * [-616.931] (-616.308) (-619.747) (-615.698) -- 0:00:15
736500 -- (-616.848) [-617.243] (-618.719) (-616.511) * (-619.679) (-619.828) (-620.540) [-616.760] -- 0:00:15
737000 -- (-620.390) (-617.646) (-615.819) [-618.298] * (-619.708) (-619.141) [-617.924] (-623.655) -- 0:00:15
737500 -- [-616.856] (-621.548) (-616.474) (-618.831) * (-617.013) [-620.087] (-620.545) (-616.523) -- 0:00:15
738000 -- (-616.995) (-616.615) [-617.216] (-622.714) * [-616.933] (-619.994) (-617.909) (-619.222) -- 0:00:15
738500 -- [-620.782] (-617.545) (-620.981) (-619.962) * (-617.183) [-618.138] (-616.774) (-617.855) -- 0:00:15
739000 -- (-619.437) (-621.350) (-616.356) [-622.803] * (-616.122) (-617.073) [-619.328] (-618.016) -- 0:00:15
739500 -- (-618.538) (-620.062) [-615.439] (-619.757) * (-616.123) (-615.983) (-620.862) [-615.945] -- 0:00:15
740000 -- (-617.224) (-617.519) (-616.823) [-616.353] * (-617.048) [-616.449] (-619.407) (-622.268) -- 0:00:15
Average standard deviation of split frequencies: 0.007765
740500 -- (-618.232) (-618.713) (-615.775) [-618.348] * (-616.875) (-616.999) [-622.159] (-618.796) -- 0:00:15
741000 -- (-623.750) (-616.532) (-616.037) [-616.513] * (-619.231) [-616.993] (-618.859) (-618.002) -- 0:00:15
741500 -- (-616.258) [-618.050] (-620.959) (-619.913) * (-619.787) [-617.594] (-620.498) (-616.541) -- 0:00:15
742000 -- (-616.350) (-617.250) (-622.072) [-616.303] * (-616.905) (-621.186) (-616.693) [-619.984] -- 0:00:15
742500 -- (-616.959) (-615.823) (-618.748) [-616.065] * (-616.620) (-618.629) (-619.792) [-617.620] -- 0:00:15
743000 -- (-617.890) [-616.517] (-618.754) (-618.801) * (-617.611) [-618.183] (-618.714) (-618.723) -- 0:00:15
743500 -- (-616.572) (-618.826) (-618.476) [-618.127] * (-615.952) [-616.496] (-616.317) (-621.256) -- 0:00:15
744000 -- (-618.067) (-616.141) (-621.631) [-617.117] * (-616.087) (-618.524) [-619.830] (-618.608) -- 0:00:15
744500 -- (-620.543) (-617.361) (-616.623) [-616.129] * (-618.082) (-617.569) (-617.763) [-616.027] -- 0:00:15
745000 -- (-617.727) [-616.896] (-616.325) (-622.454) * (-617.465) (-617.792) (-615.977) [-619.601] -- 0:00:15
Average standard deviation of split frequencies: 0.007372
745500 -- (-618.589) (-617.141) (-616.126) [-617.657] * (-617.728) (-617.361) (-617.816) [-620.427] -- 0:00:15
746000 -- [-616.148] (-616.616) (-617.215) (-620.196) * (-617.234) [-617.459] (-616.690) (-618.383) -- 0:00:15
746500 -- (-616.539) (-617.999) [-618.205] (-616.517) * [-615.972] (-616.408) (-617.262) (-616.605) -- 0:00:15
747000 -- (-620.941) [-615.595] (-617.313) (-617.661) * (-615.594) [-621.064] (-618.163) (-617.436) -- 0:00:15
747500 -- (-619.925) (-617.635) [-615.797] (-619.409) * (-617.007) (-617.731) [-616.338] (-617.917) -- 0:00:15
748000 -- (-617.173) [-616.421] (-620.233) (-628.854) * (-619.838) (-618.072) [-621.420] (-619.008) -- 0:00:15
748500 -- (-618.523) [-616.490] (-618.043) (-621.182) * (-616.867) (-616.597) (-616.112) [-615.978] -- 0:00:15
749000 -- (-617.024) [-617.153] (-618.647) (-621.139) * (-625.071) (-619.992) [-618.430] (-617.214) -- 0:00:15
749500 -- (-617.244) [-616.971] (-619.151) (-618.229) * (-616.141) (-618.064) [-619.785] (-621.736) -- 0:00:15
750000 -- (-618.825) (-620.032) (-616.928) [-618.258] * [-615.822] (-616.671) (-618.290) (-618.736) -- 0:00:15
Average standard deviation of split frequencies: 0.007201
750500 -- (-617.428) (-621.920) [-616.444] (-623.495) * (-616.779) (-620.422) [-621.349] (-617.691) -- 0:00:14
751000 -- (-619.350) [-623.900] (-616.151) (-619.136) * (-618.633) (-616.651) [-618.502] (-619.323) -- 0:00:14
751500 -- [-616.818] (-623.899) (-617.772) (-617.417) * [-618.172] (-621.103) (-616.913) (-618.441) -- 0:00:14
752000 -- (-616.741) (-618.393) [-616.904] (-617.223) * (-615.914) (-621.571) [-618.380] (-616.717) -- 0:00:14
752500 -- [-616.906] (-616.888) (-616.128) (-617.023) * (-617.597) (-617.060) (-616.269) [-616.994] -- 0:00:14
753000 -- (-616.056) (-618.009) (-616.259) [-616.349] * (-617.591) (-627.239) [-616.765] (-616.356) -- 0:00:14
753500 -- (-616.560) (-617.639) (-617.062) [-616.544] * (-618.313) [-619.743] (-616.438) (-618.124) -- 0:00:14
754000 -- (-616.173) (-617.789) [-618.018] (-616.517) * (-621.331) [-617.728] (-616.690) (-619.727) -- 0:00:14
754500 -- (-617.469) [-622.874] (-615.526) (-618.721) * (-618.972) (-619.565) (-616.684) [-618.239] -- 0:00:14
755000 -- [-618.796] (-618.703) (-619.935) (-620.419) * [-615.771] (-615.633) (-618.498) (-619.993) -- 0:00:14
Average standard deviation of split frequencies: 0.007025
755500 -- (-616.610) (-616.587) [-619.617] (-624.648) * [-617.243] (-616.545) (-620.561) (-617.413) -- 0:00:14
756000 -- [-616.848] (-620.702) (-617.336) (-620.386) * (-618.213) [-617.036] (-624.491) (-623.308) -- 0:00:14
756500 -- (-618.506) [-618.051] (-619.281) (-618.818) * (-617.400) [-616.951] (-617.538) (-618.443) -- 0:00:14
757000 -- (-619.838) (-620.332) [-619.576] (-616.793) * (-619.943) (-619.903) (-617.917) [-615.699] -- 0:00:14
757500 -- (-617.788) (-620.108) [-615.678] (-620.120) * (-618.122) (-621.633) (-616.449) [-617.694] -- 0:00:14
758000 -- (-621.353) (-617.483) (-617.930) [-618.557] * (-617.228) [-616.223] (-616.018) (-617.031) -- 0:00:14
758500 -- (-619.736) (-619.855) [-618.844] (-617.018) * (-620.476) [-620.128] (-616.380) (-618.130) -- 0:00:14
759000 -- (-616.965) (-617.598) (-617.544) [-617.073] * (-617.382) (-620.764) (-618.522) [-617.518] -- 0:00:14
759500 -- [-616.521] (-616.336) (-618.696) (-616.534) * (-616.860) [-618.600] (-617.010) (-616.973) -- 0:00:14
760000 -- (-618.424) (-619.801) (-617.157) [-617.644] * [-616.550] (-616.816) (-622.731) (-619.019) -- 0:00:14
Average standard deviation of split frequencies: 0.007271
760500 -- [-619.360] (-619.333) (-615.885) (-618.036) * (-617.452) (-619.246) (-621.489) [-620.151] -- 0:00:14
761000 -- (-617.285) (-617.703) [-616.022] (-617.285) * (-618.979) [-615.652] (-619.040) (-617.224) -- 0:00:14
761500 -- (-615.969) [-618.097] (-617.743) (-615.312) * [-617.546] (-616.389) (-618.456) (-617.882) -- 0:00:14
762000 -- [-616.767] (-625.715) (-616.354) (-616.045) * (-619.531) (-616.837) (-617.685) [-616.872] -- 0:00:14
762500 -- (-616.230) [-623.112] (-622.521) (-616.430) * (-622.051) (-619.707) (-617.485) [-616.535] -- 0:00:14
763000 -- [-617.157] (-617.014) (-617.603) (-617.261) * (-617.865) (-618.246) (-617.355) [-616.865] -- 0:00:14
763500 -- (-617.205) (-616.662) [-618.992] (-617.043) * (-618.654) [-616.630] (-616.494) (-616.172) -- 0:00:14
764000 -- (-618.880) (-616.925) [-617.966] (-615.657) * (-621.380) [-617.056] (-617.932) (-616.712) -- 0:00:14
764500 -- (-624.455) (-618.809) [-616.590] (-617.339) * (-622.692) (-616.025) (-617.996) [-617.662] -- 0:00:14
765000 -- (-618.840) (-618.387) [-618.431] (-620.438) * [-618.394] (-617.594) (-617.884) (-617.389) -- 0:00:14
Average standard deviation of split frequencies: 0.007016
765500 -- (-618.076) [-616.984] (-620.333) (-618.191) * (-622.001) (-624.686) [-616.828] (-623.964) -- 0:00:14
766000 -- (-617.947) (-618.005) (-619.693) [-615.543] * (-620.216) (-617.422) [-616.124] (-616.271) -- 0:00:14
766500 -- (-620.612) (-617.872) (-617.095) [-618.366] * [-618.211] (-617.036) (-617.988) (-618.740) -- 0:00:14
767000 -- (-617.905) (-618.370) [-615.718] (-620.597) * [-617.921] (-617.329) (-620.606) (-620.252) -- 0:00:13
767500 -- (-619.424) (-619.861) [-617.432] (-617.057) * [-621.741] (-617.783) (-620.552) (-617.405) -- 0:00:13
768000 -- (-619.842) (-619.878) [-618.319] (-618.102) * (-619.836) [-617.852] (-615.339) (-619.127) -- 0:00:13
768500 -- (-618.382) [-616.343] (-621.761) (-620.216) * (-615.992) (-619.081) [-615.318] (-617.797) -- 0:00:13
769000 -- (-616.135) (-616.353) (-618.561) [-616.584] * [-617.132] (-618.422) (-615.362) (-616.656) -- 0:00:13
769500 -- (-616.500) (-616.006) [-617.185] (-618.984) * (-617.122) (-617.136) (-616.290) [-618.167] -- 0:00:13
770000 -- (-615.436) (-615.550) (-616.382) [-621.321] * (-617.718) [-616.121] (-618.918) (-619.666) -- 0:00:13
Average standard deviation of split frequencies: 0.007299
770500 -- (-616.342) [-615.998] (-618.035) (-617.045) * [-618.672] (-616.397) (-619.861) (-617.854) -- 0:00:13
771000 -- (-618.798) (-620.792) (-617.958) [-617.446] * (-621.248) (-619.530) (-619.143) [-616.551] -- 0:00:13
771500 -- (-619.713) (-620.398) (-623.233) [-617.679] * (-621.314) (-616.370) [-617.866] (-620.888) -- 0:00:13
772000 -- [-617.724] (-619.031) (-622.541) (-617.934) * (-621.023) [-620.111] (-620.622) (-617.213) -- 0:00:13
772500 -- (-617.410) (-623.677) (-617.153) [-618.673] * (-618.250) [-616.392] (-618.485) (-618.401) -- 0:00:13
773000 -- (-615.886) [-618.751] (-615.879) (-622.241) * (-616.692) (-617.033) [-616.622] (-619.905) -- 0:00:13
773500 -- [-615.779] (-617.843) (-617.889) (-620.270) * (-616.599) (-617.363) [-616.695] (-620.539) -- 0:00:13
774000 -- (-617.158) [-623.320] (-616.370) (-620.441) * (-616.986) (-618.752) (-618.096) [-617.378] -- 0:00:13
774500 -- (-616.563) [-617.411] (-617.244) (-615.925) * [-616.386] (-616.952) (-619.164) (-620.156) -- 0:00:13
775000 -- (-617.980) [-615.539] (-619.653) (-616.885) * [-618.914] (-620.539) (-616.770) (-619.257) -- 0:00:13
Average standard deviation of split frequencies: 0.007249
775500 -- [-615.496] (-616.800) (-620.818) (-617.286) * (-621.798) (-624.535) (-617.916) [-618.054] -- 0:00:13
776000 -- (-616.095) (-616.247) (-618.533) [-617.254] * [-615.381] (-622.001) (-616.233) (-619.277) -- 0:00:13
776500 -- (-620.573) [-616.599] (-618.548) (-617.605) * (-616.362) (-616.759) [-619.811] (-616.382) -- 0:00:13
777000 -- [-617.840] (-618.925) (-617.718) (-617.000) * (-617.244) (-618.283) [-617.155] (-617.569) -- 0:00:13
777500 -- (-619.743) (-617.901) (-623.813) [-617.720] * (-616.354) [-617.220] (-616.978) (-617.821) -- 0:00:13
778000 -- (-617.291) (-617.531) (-616.608) [-617.513] * (-616.435) [-616.780] (-616.561) (-616.080) -- 0:00:13
778500 -- (-617.444) (-616.727) [-617.249] (-617.902) * (-616.045) [-617.053] (-615.674) (-615.821) -- 0:00:13
779000 -- (-617.340) [-619.929] (-617.545) (-620.700) * [-617.597] (-619.513) (-618.235) (-618.051) -- 0:00:13
779500 -- [-616.553] (-615.793) (-619.523) (-618.053) * (-616.993) [-615.836] (-618.301) (-618.220) -- 0:00:13
780000 -- (-616.225) (-616.390) (-625.869) [-616.265] * (-618.525) [-616.755] (-616.449) (-616.703) -- 0:00:13
Average standard deviation of split frequencies: 0.007327
780500 -- (-619.501) [-616.737] (-622.994) (-619.128) * (-620.648) (-616.542) [-616.235] (-616.359) -- 0:00:13
781000 -- (-621.503) (-619.354) [-628.237] (-619.595) * (-617.534) (-616.514) (-616.245) [-620.445] -- 0:00:13
781500 -- (-619.294) [-618.061] (-622.608) (-616.960) * (-617.202) [-616.140] (-616.760) (-618.464) -- 0:00:13
782000 -- [-616.606] (-618.638) (-624.506) (-619.089) * [-615.987] (-617.410) (-619.900) (-616.180) -- 0:00:13
782500 -- (-618.820) (-618.048) (-619.241) [-618.805] * [-617.276] (-621.962) (-620.192) (-616.257) -- 0:00:13
783000 -- (-616.968) [-617.600] (-615.583) (-616.460) * (-617.448) [-618.627] (-616.413) (-618.980) -- 0:00:13
783500 -- (-618.769) [-619.534] (-618.736) (-619.251) * (-616.216) (-620.040) (-617.998) [-616.171] -- 0:00:12
784000 -- [-617.220] (-617.633) (-616.566) (-616.648) * (-617.739) (-616.622) (-616.227) [-615.978] -- 0:00:12
784500 -- (-617.092) [-617.092] (-617.350) (-619.045) * (-622.768) (-618.521) [-615.504] (-617.469) -- 0:00:12
785000 -- (-620.253) (-620.321) [-618.264] (-616.959) * (-619.452) (-622.076) [-619.849] (-617.646) -- 0:00:12
Average standard deviation of split frequencies: 0.006957
785500 -- (-617.538) [-618.190] (-619.022) (-617.255) * (-617.229) [-616.359] (-619.228) (-617.893) -- 0:00:12
786000 -- (-617.466) [-617.505] (-617.603) (-615.550) * (-620.161) (-616.283) (-623.355) [-623.412] -- 0:00:12
786500 -- (-621.387) (-617.058) (-620.065) [-618.072] * (-620.195) (-616.408) (-617.818) [-617.623] -- 0:00:12
787000 -- (-623.930) (-618.204) (-621.121) [-619.288] * (-617.342) [-615.923] (-617.624) (-620.010) -- 0:00:12
787500 -- (-617.382) (-616.623) [-616.916] (-616.812) * (-619.482) (-616.523) (-617.737) [-616.816] -- 0:00:12
788000 -- [-619.412] (-616.340) (-620.008) (-616.833) * [-618.927] (-619.846) (-618.719) (-622.087) -- 0:00:12
788500 -- (-616.528) [-616.428] (-618.861) (-618.035) * (-619.868) [-616.326] (-622.302) (-616.711) -- 0:00:12
789000 -- (-615.756) [-615.822] (-615.768) (-617.870) * (-620.191) (-616.626) [-620.301] (-617.588) -- 0:00:12
789500 -- (-616.338) (-616.485) [-617.045] (-618.086) * (-618.113) (-618.268) (-621.738) [-619.583] -- 0:00:12
790000 -- [-619.141] (-616.260) (-617.467) (-617.289) * (-618.151) [-615.471] (-618.759) (-617.579) -- 0:00:12
Average standard deviation of split frequencies: 0.006479
790500 -- (-618.377) (-618.832) (-617.109) [-619.996] * (-616.750) [-615.829] (-619.113) (-616.635) -- 0:00:12
791000 -- (-621.340) (-616.859) [-616.858] (-619.344) * (-619.459) (-617.604) [-618.669] (-617.166) -- 0:00:12
791500 -- (-617.068) (-620.510) (-617.675) [-619.100] * (-615.691) [-617.079] (-618.181) (-615.797) -- 0:00:12
792000 -- (-620.724) (-617.321) [-617.103] (-618.924) * (-620.204) (-616.864) (-617.275) [-617.859] -- 0:00:12
792500 -- (-618.332) (-619.749) (-620.018) [-618.993] * (-620.484) (-617.047) [-615.830] (-617.413) -- 0:00:12
793000 -- (-616.945) (-619.307) [-620.244] (-617.370) * (-624.893) (-616.688) [-616.632] (-618.087) -- 0:00:12
793500 -- [-617.623] (-618.377) (-622.127) (-620.372) * (-618.914) [-616.454] (-616.654) (-618.049) -- 0:00:12
794000 -- (-619.812) (-620.604) (-617.790) [-617.211] * (-616.778) (-617.189) [-617.962] (-616.576) -- 0:00:12
794500 -- (-616.814) [-616.903] (-620.194) (-617.364) * (-619.473) (-617.195) [-616.616] (-617.500) -- 0:00:12
795000 -- (-616.665) (-617.063) (-619.604) [-615.572] * (-619.257) (-618.975) [-617.661] (-624.499) -- 0:00:12
Average standard deviation of split frequencies: 0.006633
795500 -- (-616.591) (-616.696) [-617.090] (-617.239) * (-621.511) [-619.053] (-616.873) (-615.968) -- 0:00:12
796000 -- (-616.090) (-620.293) (-617.278) [-618.259] * (-621.821) (-618.630) [-616.526] (-616.648) -- 0:00:12
796500 -- (-616.089) (-620.511) [-622.290] (-619.532) * (-617.708) [-619.427] (-618.478) (-617.615) -- 0:00:12
797000 -- (-616.642) (-616.303) (-622.897) [-619.143] * [-616.166] (-617.576) (-620.610) (-618.636) -- 0:00:12
797500 -- (-617.196) (-622.191) (-618.812) [-618.242] * (-618.375) (-615.974) (-620.939) [-622.296] -- 0:00:12
798000 -- (-617.272) [-617.311] (-617.621) (-619.940) * (-617.062) [-616.666] (-616.819) (-621.519) -- 0:00:12
798500 -- (-615.477) (-619.574) [-620.374] (-617.193) * (-621.509) [-616.915] (-615.665) (-617.759) -- 0:00:12
799000 -- [-617.351] (-619.738) (-619.679) (-621.870) * (-616.345) [-615.855] (-615.559) (-619.560) -- 0:00:12
799500 -- (-621.583) (-620.977) [-618.805] (-617.212) * [-616.261] (-621.631) (-616.033) (-617.696) -- 0:00:12
800000 -- [-620.740] (-619.374) (-617.119) (-617.411) * (-615.674) [-616.578] (-615.825) (-617.194) -- 0:00:12
Average standard deviation of split frequencies: 0.006987
800500 -- [-616.856] (-619.413) (-618.872) (-621.276) * (-617.665) (-616.508) (-619.512) [-616.141] -- 0:00:11
801000 -- [-616.729] (-619.158) (-619.327) (-616.517) * [-617.410] (-616.961) (-618.438) (-616.136) -- 0:00:11
801500 -- (-616.887) (-616.372) [-615.901] (-616.307) * (-617.331) [-617.727] (-616.880) (-616.403) -- 0:00:11
802000 -- (-617.420) (-618.762) (-618.166) [-616.332] * [-615.876] (-617.322) (-617.364) (-615.891) -- 0:00:11
802500 -- [-616.360] (-619.069) (-616.935) (-617.083) * [-616.900] (-616.899) (-617.391) (-616.424) -- 0:00:11
803000 -- [-617.487] (-618.863) (-615.909) (-617.776) * (-615.565) [-616.161] (-621.344) (-617.546) -- 0:00:11
803500 -- [-620.366] (-623.104) (-616.531) (-620.108) * (-616.443) [-616.204] (-618.831) (-617.905) -- 0:00:11
804000 -- (-617.130) (-619.336) [-617.970] (-617.662) * (-615.710) (-617.092) [-618.497] (-616.307) -- 0:00:11
804500 -- (-617.020) (-619.522) [-617.718] (-618.788) * (-616.490) [-615.991] (-617.615) (-620.210) -- 0:00:11
805000 -- [-616.184] (-619.122) (-619.552) (-618.260) * (-617.920) (-616.511) [-615.557] (-621.870) -- 0:00:11
Average standard deviation of split frequencies: 0.006940
805500 -- [-617.091] (-621.331) (-618.435) (-619.133) * (-617.058) (-616.380) (-616.972) [-622.181] -- 0:00:11
806000 -- (-617.236) (-624.998) [-615.625] (-618.528) * (-619.770) [-616.133] (-616.852) (-616.783) -- 0:00:11
806500 -- (-616.816) (-617.086) (-617.656) [-620.904] * (-616.522) [-619.709] (-616.209) (-616.783) -- 0:00:11
807000 -- (-618.984) (-616.718) [-620.613] (-628.329) * (-617.166) [-617.151] (-618.544) (-617.870) -- 0:00:11
807500 -- (-618.075) [-616.350] (-617.781) (-620.940) * (-618.046) (-621.961) [-619.560] (-617.695) -- 0:00:11
808000 -- (-617.741) [-617.919] (-617.983) (-622.380) * (-617.658) (-616.791) [-619.081] (-616.546) -- 0:00:11
808500 -- [-616.726] (-616.479) (-616.899) (-622.297) * [-621.716] (-617.673) (-619.026) (-616.620) -- 0:00:11
809000 -- (-616.563) (-622.329) (-615.949) [-619.347] * (-619.076) [-616.317] (-616.959) (-618.650) -- 0:00:11
809500 -- (-621.002) [-615.984] (-615.992) (-620.653) * [-615.951] (-616.171) (-616.964) (-619.575) -- 0:00:11
810000 -- (-623.415) (-622.372) (-619.009) [-618.527] * (-616.300) [-618.072] (-618.123) (-620.791) -- 0:00:11
Average standard deviation of split frequencies: 0.006784
810500 -- (-619.965) (-617.359) (-623.621) [-616.266] * [-620.904] (-618.311) (-618.562) (-619.177) -- 0:00:11
811000 -- [-620.537] (-616.337) (-619.730) (-617.134) * (-620.524) (-616.722) (-615.749) [-619.501] -- 0:00:11
811500 -- [-618.656] (-616.670) (-617.279) (-618.302) * (-617.893) (-618.191) [-615.513] (-616.202) -- 0:00:11
812000 -- (-620.996) [-616.441] (-616.582) (-617.662) * [-620.786] (-618.950) (-619.460) (-616.129) -- 0:00:11
812500 -- (-620.160) (-617.620) [-615.886] (-623.464) * (-619.348) [-616.225] (-618.741) (-616.036) -- 0:00:11
813000 -- (-618.446) [-616.837] (-616.160) (-620.721) * (-619.518) [-618.870] (-618.932) (-615.815) -- 0:00:11
813500 -- (-617.992) (-617.701) (-617.151) [-616.264] * (-619.983) (-617.349) [-616.457] (-617.043) -- 0:00:11
814000 -- (-617.035) (-616.949) [-617.860] (-617.570) * (-615.514) (-616.390) [-616.086] (-618.464) -- 0:00:11
814500 -- (-616.335) (-617.990) [-617.508] (-617.659) * (-615.685) [-618.432] (-617.257) (-617.279) -- 0:00:11
815000 -- (-618.533) (-621.554) (-620.688) [-616.123] * (-615.424) (-616.427) [-616.275] (-617.444) -- 0:00:11
Average standard deviation of split frequencies: 0.006470
815500 -- (-624.629) [-615.614] (-627.198) (-615.958) * (-617.180) (-616.259) [-617.247] (-625.385) -- 0:00:11
816000 -- (-617.838) [-615.324] (-617.422) (-615.679) * (-616.427) (-615.279) [-617.130] (-616.299) -- 0:00:11
816500 -- (-616.084) (-617.911) [-616.912] (-618.517) * (-616.961) [-617.043] (-621.206) (-617.373) -- 0:00:11
817000 -- (-616.545) (-617.380) [-621.265] (-621.162) * (-617.354) (-617.982) [-616.868] (-619.776) -- 0:00:10
817500 -- (-616.467) (-620.087) [-617.536] (-615.606) * (-615.923) (-618.166) (-616.114) [-616.747] -- 0:00:10
818000 -- (-615.666) (-622.029) [-617.385] (-617.657) * (-617.155) (-616.540) (-616.714) [-617.786] -- 0:00:10
818500 -- [-616.608] (-616.968) (-617.641) (-623.218) * (-620.462) (-616.679) (-619.900) [-616.594] -- 0:00:10
819000 -- (-618.406) [-616.640] (-623.300) (-620.107) * (-617.481) [-616.364] (-616.562) (-620.199) -- 0:00:10
819500 -- (-620.127) (-621.012) (-622.157) [-618.522] * (-620.146) [-621.183] (-620.303) (-617.371) -- 0:00:10
820000 -- (-616.167) [-617.207] (-616.325) (-616.567) * (-618.341) (-618.747) (-621.435) [-621.249] -- 0:00:10
Average standard deviation of split frequencies: 0.006319
820500 -- (-617.188) [-617.495] (-618.062) (-619.545) * [-617.771] (-616.502) (-620.389) (-618.302) -- 0:00:10
821000 -- (-617.254) [-620.648] (-619.226) (-616.617) * (-618.296) (-616.618) [-620.488] (-617.203) -- 0:00:10
821500 -- (-618.593) (-616.718) [-622.601] (-620.156) * (-619.733) (-616.103) [-616.870] (-616.822) -- 0:00:10
822000 -- (-616.657) [-616.319] (-619.714) (-620.823) * (-619.067) [-616.712] (-618.453) (-617.597) -- 0:00:10
822500 -- (-618.716) [-616.437] (-619.077) (-621.341) * (-619.166) (-618.314) [-617.279] (-619.413) -- 0:00:10
823000 -- (-620.581) [-616.724] (-620.480) (-619.416) * (-618.060) [-618.879] (-616.083) (-620.043) -- 0:00:10
823500 -- (-619.166) [-616.210] (-624.610) (-615.838) * (-619.234) (-617.363) (-615.939) [-619.166] -- 0:00:10
824000 -- (-620.318) (-616.707) [-622.361] (-617.750) * (-619.586) (-619.182) [-616.065] (-615.852) -- 0:00:10
824500 -- (-618.138) [-616.497] (-619.928) (-616.819) * [-617.580] (-619.668) (-615.877) (-618.728) -- 0:00:10
825000 -- (-615.912) [-617.813] (-617.887) (-616.398) * (-622.376) (-620.296) [-615.701] (-617.010) -- 0:00:10
Average standard deviation of split frequencies: 0.006544
825500 -- (-619.505) [-618.676] (-616.167) (-617.798) * (-618.749) (-616.033) (-616.579) [-618.277] -- 0:00:10
826000 -- (-618.180) [-619.857] (-625.082) (-617.032) * (-616.873) (-617.005) [-617.773] (-616.855) -- 0:00:10
826500 -- [-617.085] (-620.661) (-619.658) (-616.661) * (-619.863) (-616.251) (-617.327) [-616.664] -- 0:00:10
827000 -- [-619.835] (-616.674) (-620.209) (-616.764) * (-617.941) [-617.363] (-616.995) (-616.075) -- 0:00:10
827500 -- (-617.975) (-621.079) [-620.253] (-622.897) * (-616.543) [-620.436] (-618.979) (-619.835) -- 0:00:10
828000 -- (-618.122) (-621.275) [-616.875] (-618.194) * (-621.739) (-620.144) [-618.264] (-618.298) -- 0:00:10
828500 -- (-618.148) (-616.769) (-618.376) [-616.545] * (-617.941) (-619.264) [-619.370] (-617.210) -- 0:00:10
829000 -- (-616.942) (-616.948) (-618.388) [-617.432] * [-616.487] (-619.994) (-616.744) (-617.671) -- 0:00:10
829500 -- (-617.243) (-617.704) (-618.110) [-618.035] * [-617.186] (-621.033) (-619.102) (-616.873) -- 0:00:10
830000 -- (-617.456) [-616.856] (-616.764) (-618.514) * (-616.826) [-619.090] (-618.351) (-615.423) -- 0:00:10
Average standard deviation of split frequencies: 0.006772
830500 -- (-617.681) (-618.162) [-618.462] (-617.291) * (-617.725) (-616.339) [-616.899] (-616.837) -- 0:00:10
831000 -- (-617.241) (-618.192) [-616.324] (-618.447) * (-617.624) (-617.162) (-617.767) [-616.792] -- 0:00:10
831500 -- (-618.183) (-618.762) (-620.098) [-616.506] * (-618.805) [-617.304] (-619.034) (-616.338) -- 0:00:10
832000 -- [-619.609] (-616.711) (-617.218) (-617.975) * (-620.117) [-617.486] (-617.522) (-616.855) -- 0:00:10
832500 -- (-617.844) (-617.800) (-619.859) [-616.773] * (-620.237) [-615.649] (-616.517) (-616.625) -- 0:00:10
833000 -- (-619.626) (-616.837) [-622.414] (-617.873) * (-619.738) (-615.854) [-617.342] (-616.090) -- 0:00:10
833500 -- (-616.907) [-616.184] (-616.909) (-617.347) * (-619.072) [-615.550] (-617.788) (-617.331) -- 0:00:09
834000 -- (-617.644) (-618.698) (-617.241) [-615.898] * (-617.738) [-618.321] (-616.197) (-616.474) -- 0:00:09
834500 -- (-617.191) [-619.633] (-617.714) (-618.021) * (-618.457) [-616.575] (-616.344) (-616.248) -- 0:00:09
835000 -- (-616.939) (-617.786) [-618.550] (-618.101) * [-615.961] (-625.191) (-620.063) (-615.876) -- 0:00:09
Average standard deviation of split frequencies: 0.007067
835500 -- (-615.890) [-616.902] (-619.962) (-616.689) * (-620.038) [-619.157] (-617.646) (-618.630) -- 0:00:09
836000 -- (-619.098) (-616.040) (-616.973) [-616.781] * (-619.872) (-619.031) (-619.845) [-616.249] -- 0:00:09
836500 -- (-620.574) [-619.212] (-616.081) (-616.483) * (-617.332) [-619.982] (-617.078) (-618.514) -- 0:00:09
837000 -- (-619.291) (-619.462) (-618.275) [-617.845] * (-624.288) (-616.613) (-615.763) [-617.973] -- 0:00:09
837500 -- [-618.412] (-617.954) (-619.684) (-616.638) * (-615.344) (-617.268) (-615.967) [-617.232] -- 0:00:09
838000 -- (-617.086) (-619.858) [-618.091] (-619.858) * (-615.567) (-617.065) (-616.375) [-616.453] -- 0:00:09
838500 -- (-615.665) [-617.400] (-621.135) (-621.740) * [-616.389] (-615.973) (-615.322) (-615.345) -- 0:00:09
839000 -- (-618.027) (-617.666) [-619.722] (-619.348) * (-618.914) (-616.737) (-618.910) [-618.046] -- 0:00:09
839500 -- (-618.691) (-616.233) (-616.953) [-618.238] * (-617.325) (-615.698) [-619.176] (-620.244) -- 0:00:09
840000 -- (-617.315) (-616.266) (-619.586) [-617.622] * [-615.593] (-615.332) (-617.378) (-619.421) -- 0:00:09
Average standard deviation of split frequencies: 0.006879
840500 -- (-617.619) [-616.081] (-619.350) (-618.744) * (-617.521) [-615.943] (-618.322) (-620.125) -- 0:00:09
841000 -- (-617.976) (-615.426) [-619.086] (-620.336) * [-619.583] (-620.173) (-618.763) (-617.919) -- 0:00:09
841500 -- (-618.888) (-617.948) (-617.674) [-616.929] * (-616.738) [-617.000] (-617.484) (-619.246) -- 0:00:09
842000 -- (-619.240) [-617.744] (-617.880) (-616.262) * (-615.928) (-620.325) (-617.022) [-619.342] -- 0:00:09
842500 -- (-617.074) (-617.612) [-617.962] (-618.850) * [-616.086] (-616.182) (-617.700) (-617.227) -- 0:00:09
843000 -- (-618.852) (-616.546) (-616.874) [-621.444] * [-616.508] (-616.105) (-616.001) (-623.811) -- 0:00:09
843500 -- [-617.559] (-616.224) (-617.569) (-616.058) * (-617.369) (-616.457) [-617.639] (-621.473) -- 0:00:09
844000 -- (-617.847) (-616.575) [-619.638] (-616.892) * (-615.571) (-616.582) [-617.019] (-620.487) -- 0:00:09
844500 -- (-616.850) [-616.620] (-616.084) (-616.332) * (-619.067) (-618.422) [-617.291] (-616.282) -- 0:00:09
845000 -- (-619.153) (-616.845) (-616.086) [-617.096] * (-617.258) [-620.702] (-616.604) (-616.032) -- 0:00:09
Average standard deviation of split frequencies: 0.007021
845500 -- (-618.179) [-616.785] (-615.926) (-616.781) * (-618.649) (-619.345) (-616.956) [-616.999] -- 0:00:09
846000 -- (-618.884) (-617.965) [-617.708] (-618.267) * [-622.580] (-624.429) (-616.725) (-616.102) -- 0:00:09
846500 -- (-616.445) (-616.522) (-619.379) [-615.681] * [-618.351] (-620.711) (-616.330) (-615.458) -- 0:00:09
847000 -- (-616.641) (-616.594) (-623.412) [-616.262] * (-616.722) (-621.944) (-618.305) [-621.124] -- 0:00:09
847500 -- [-615.285] (-618.627) (-620.323) (-617.323) * (-618.633) (-619.415) [-620.516] (-617.192) -- 0:00:09
848000 -- [-615.742] (-617.532) (-622.784) (-618.436) * (-616.295) (-617.188) (-622.167) [-618.516] -- 0:00:09
848500 -- (-616.048) (-617.333) (-616.640) [-616.700] * (-619.365) [-615.626] (-618.380) (-621.161) -- 0:00:09
849000 -- (-617.311) (-616.995) [-616.649] (-616.989) * [-617.142] (-615.915) (-619.670) (-618.126) -- 0:00:09
849500 -- (-617.432) [-617.620] (-617.503) (-620.659) * (-620.502) [-615.935] (-620.319) (-615.834) -- 0:00:09
850000 -- (-617.182) (-617.926) (-616.301) [-619.849] * (-617.864) [-618.884] (-616.104) (-618.383) -- 0:00:09
Average standard deviation of split frequencies: 0.006835
850500 -- [-616.000] (-616.973) (-617.408) (-616.047) * [-615.497] (-619.625) (-616.576) (-616.033) -- 0:00:08
851000 -- [-616.437] (-617.677) (-617.507) (-619.421) * (-615.997) (-616.677) (-617.653) [-621.012] -- 0:00:08
851500 -- (-616.257) (-618.942) (-621.092) [-616.655] * (-616.312) (-616.260) (-619.239) [-618.569] -- 0:00:08
852000 -- (-618.358) (-618.136) [-619.788] (-617.803) * (-618.053) [-616.735] (-618.770) (-619.427) -- 0:00:08
852500 -- (-616.954) (-617.664) [-616.490] (-617.634) * (-620.285) (-616.748) [-617.643] (-620.451) -- 0:00:08
853000 -- (-616.217) (-618.697) [-620.087] (-616.599) * [-621.120] (-617.382) (-618.187) (-618.741) -- 0:00:08
853500 -- (-615.948) (-616.895) [-619.253] (-617.521) * (-617.593) [-618.430] (-615.894) (-616.217) -- 0:00:08
854000 -- [-617.649] (-619.648) (-616.946) (-617.389) * [-615.702] (-619.672) (-618.157) (-620.263) -- 0:00:08
854500 -- (-615.555) (-616.698) (-616.346) [-618.195] * (-616.356) [-618.470] (-617.895) (-617.732) -- 0:00:08
855000 -- (-619.027) (-617.902) [-615.287] (-616.053) * (-619.528) (-618.046) [-617.347] (-616.920) -- 0:00:08
Average standard deviation of split frequencies: 0.006976
855500 -- (-625.178) [-620.317] (-617.350) (-616.742) * (-618.271) (-617.571) [-618.526] (-616.416) -- 0:00:08
856000 -- (-621.998) (-617.116) [-616.793] (-619.038) * (-618.533) [-616.228] (-616.901) (-623.267) -- 0:00:08
856500 -- (-618.696) (-615.809) [-616.438] (-618.103) * (-617.624) (-620.215) (-617.129) [-618.491] -- 0:00:08
857000 -- (-617.395) (-615.832) [-618.307] (-616.487) * (-618.888) [-617.814] (-618.639) (-616.274) -- 0:00:08
857500 -- (-617.699) (-616.957) [-620.370] (-617.717) * (-617.416) (-616.772) [-617.762] (-617.598) -- 0:00:08
858000 -- (-616.247) [-617.499] (-625.846) (-616.957) * (-618.146) [-617.159] (-619.119) (-620.706) -- 0:00:08
858500 -- (-617.945) [-615.777] (-618.989) (-618.018) * (-618.806) [-619.572] (-619.241) (-618.269) -- 0:00:08
859000 -- (-615.971) (-615.513) [-619.261] (-619.001) * (-618.470) (-619.090) [-618.293] (-617.243) -- 0:00:08
859500 -- (-620.137) (-619.342) (-618.098) [-616.512] * (-615.891) [-617.400] (-616.793) (-617.687) -- 0:00:08
860000 -- (-615.874) (-618.038) (-617.840) [-616.773] * (-616.441) [-617.144] (-616.267) (-618.026) -- 0:00:08
Average standard deviation of split frequencies: 0.006719
860500 -- (-616.383) (-616.921) (-618.455) [-618.695] * [-619.533] (-619.258) (-616.114) (-617.190) -- 0:00:08
861000 -- (-616.623) (-617.165) (-620.058) [-617.195] * (-618.295) (-618.166) [-618.109] (-616.376) -- 0:00:08
861500 -- [-617.239] (-617.736) (-616.980) (-616.779) * (-616.142) (-616.240) [-616.771] (-619.141) -- 0:00:08
862000 -- (-618.461) [-616.522] (-616.436) (-617.361) * (-615.565) [-616.454] (-615.613) (-620.649) -- 0:00:08
862500 -- (-620.089) (-617.242) (-617.132) [-617.448] * (-617.013) (-615.785) [-615.844] (-618.500) -- 0:00:08
863000 -- (-618.434) [-617.691] (-621.544) (-620.088) * (-615.467) (-618.053) [-618.943] (-621.487) -- 0:00:08
863500 -- (-615.993) [-615.498] (-618.236) (-618.748) * (-616.101) (-619.722) [-618.284] (-620.123) -- 0:00:08
864000 -- [-617.772] (-619.316) (-618.211) (-616.934) * (-617.492) [-618.761] (-619.018) (-616.923) -- 0:00:08
864500 -- (-616.581) (-618.527) [-617.991] (-616.610) * (-616.037) [-621.137] (-618.257) (-617.649) -- 0:00:08
865000 -- [-617.317] (-621.833) (-616.495) (-616.793) * (-615.438) [-617.085] (-619.288) (-617.638) -- 0:00:08
Average standard deviation of split frequencies: 0.006859
865500 -- [-618.863] (-620.447) (-619.180) (-617.880) * [-616.654] (-617.418) (-618.569) (-616.681) -- 0:00:08
866000 -- (-619.062) [-616.775] (-618.666) (-619.847) * (-621.949) (-618.354) (-626.984) [-619.670] -- 0:00:08
866500 -- [-623.288] (-617.885) (-618.968) (-617.859) * (-616.780) [-619.651] (-618.432) (-618.176) -- 0:00:08
867000 -- (-620.703) (-616.253) (-616.860) [-617.078] * (-619.509) (-616.988) [-618.358] (-619.862) -- 0:00:07
867500 -- (-617.591) [-616.198] (-616.873) (-618.324) * [-617.464] (-616.678) (-615.959) (-619.936) -- 0:00:07
868000 -- (-616.183) (-616.015) [-618.144] (-617.621) * [-617.027] (-617.380) (-615.924) (-619.178) -- 0:00:07
868500 -- (-621.620) [-616.863] (-616.426) (-617.710) * (-617.033) [-618.741] (-617.684) (-618.063) -- 0:00:07
869000 -- (-620.802) [-617.040] (-622.243) (-618.958) * (-617.827) (-618.954) (-617.717) [-617.541] -- 0:00:07
869500 -- (-618.897) (-616.325) (-617.195) [-618.580] * (-617.721) (-617.054) [-617.275] (-616.174) -- 0:00:07
870000 -- (-616.893) (-619.850) [-617.087] (-624.295) * (-616.167) (-615.671) (-616.540) [-617.495] -- 0:00:07
Average standard deviation of split frequencies: 0.006100
870500 -- (-617.903) (-616.787) [-617.293] (-618.880) * (-615.964) (-619.157) [-616.624] (-617.833) -- 0:00:07
871000 -- [-616.994] (-618.313) (-620.125) (-616.613) * [-617.657] (-616.669) (-616.832) (-618.115) -- 0:00:07
871500 -- (-618.540) (-617.337) (-618.817) [-618.073] * (-618.051) (-622.611) [-616.124] (-617.061) -- 0:00:07
872000 -- (-619.188) (-617.941) (-618.261) [-618.087] * (-618.498) (-617.625) [-617.914] (-617.948) -- 0:00:07
872500 -- (-617.895) [-617.433] (-618.221) (-622.752) * (-619.943) (-616.848) [-615.873] (-620.585) -- 0:00:07
873000 -- (-619.932) (-617.522) [-618.082] (-617.003) * (-617.460) (-617.163) (-616.787) [-617.850] -- 0:00:07
873500 -- (-616.911) (-615.874) [-617.783] (-616.400) * [-618.815] (-618.857) (-618.424) (-620.713) -- 0:00:07
874000 -- (-619.950) [-616.678] (-618.114) (-616.481) * (-619.561) [-616.645] (-616.318) (-619.188) -- 0:00:07
874500 -- [-616.743] (-618.624) (-617.177) (-621.810) * [-615.920] (-616.245) (-617.277) (-618.756) -- 0:00:07
875000 -- [-617.966] (-623.505) (-616.250) (-622.686) * (-621.756) (-616.253) [-617.253] (-619.271) -- 0:00:07
Average standard deviation of split frequencies: 0.006314
875500 -- (-616.934) (-617.368) [-618.097] (-620.917) * (-616.361) [-619.281] (-617.989) (-616.277) -- 0:00:07
876000 -- (-615.680) (-616.324) [-616.940] (-617.081) * (-618.052) (-616.870) (-620.459) [-617.198] -- 0:00:07
876500 -- [-617.005] (-617.778) (-622.716) (-616.270) * (-622.621) (-616.679) [-617.152] (-616.796) -- 0:00:07
877000 -- (-617.910) (-616.539) (-624.159) [-615.916] * (-621.823) (-625.536) [-618.769] (-616.475) -- 0:00:07
877500 -- (-617.909) [-615.715] (-616.315) (-616.197) * (-620.069) [-616.591] (-620.621) (-617.770) -- 0:00:07
878000 -- (-616.907) [-616.515] (-617.216) (-620.482) * (-619.864) [-617.244] (-616.863) (-618.587) -- 0:00:07
878500 -- (-616.447) (-617.775) (-620.256) [-617.648] * [-618.502] (-616.698) (-616.845) (-619.045) -- 0:00:07
879000 -- (-615.492) (-625.622) (-617.382) [-619.507] * (-617.869) [-615.954] (-618.854) (-617.944) -- 0:00:07
879500 -- (-619.576) (-619.803) (-616.969) [-621.853] * (-622.885) [-616.142] (-616.765) (-621.486) -- 0:00:07
880000 -- (-616.563) [-616.961] (-617.758) (-624.296) * (-619.851) (-619.274) [-616.246] (-619.487) -- 0:00:07
Average standard deviation of split frequencies: 0.006388
880500 -- [-617.312] (-615.745) (-617.877) (-617.502) * (-619.607) [-616.687] (-617.256) (-617.351) -- 0:00:07
881000 -- (-617.336) (-615.903) [-615.913] (-618.233) * (-617.714) (-617.307) (-618.102) [-618.389] -- 0:00:07
881500 -- (-616.932) (-617.346) (-616.139) [-619.073] * (-618.776) (-617.541) (-618.818) [-616.939] -- 0:00:07
882000 -- (-617.005) (-620.123) [-622.529] (-618.528) * (-619.753) [-619.522] (-618.177) (-617.133) -- 0:00:07
882500 -- [-615.610] (-616.862) (-618.153) (-618.432) * (-620.563) [-622.505] (-619.144) (-617.938) -- 0:00:07
883000 -- (-620.888) (-618.188) [-620.522] (-618.544) * (-616.043) (-620.750) (-618.256) [-616.672] -- 0:00:07
883500 -- (-619.155) (-618.176) [-618.432] (-615.688) * (-618.126) (-619.720) (-619.393) [-616.474] -- 0:00:06
884000 -- (-618.378) [-616.728] (-616.705) (-622.093) * (-618.236) [-619.037] (-617.960) (-617.873) -- 0:00:06
884500 -- [-616.324] (-615.642) (-616.729) (-619.261) * (-616.378) [-618.352] (-617.333) (-617.580) -- 0:00:06
885000 -- (-617.303) (-615.301) (-616.796) [-618.573] * (-618.095) (-615.359) [-616.608] (-615.274) -- 0:00:06
Average standard deviation of split frequencies: 0.006633
885500 -- (-616.572) (-617.525) [-616.757] (-616.484) * [-618.723] (-615.814) (-619.975) (-620.026) -- 0:00:06
886000 -- (-617.122) (-615.822) (-617.089) [-616.097] * [-615.759] (-615.727) (-617.820) (-616.734) -- 0:00:06
886500 -- [-615.730] (-615.651) (-619.532) (-618.918) * (-616.757) (-616.504) [-621.802] (-616.642) -- 0:00:06
887000 -- (-617.271) [-617.869] (-616.517) (-619.354) * (-616.430) (-618.251) [-616.497] (-616.392) -- 0:00:06
887500 -- [-616.178] (-625.586) (-615.935) (-619.318) * [-618.144] (-620.228) (-621.497) (-618.206) -- 0:00:06
888000 -- (-615.716) (-617.277) (-619.909) [-617.550] * [-617.609] (-620.164) (-616.951) (-619.037) -- 0:00:06
888500 -- (-618.287) (-619.962) (-621.116) [-615.741] * (-618.141) (-621.071) [-617.552] (-619.029) -- 0:00:06
889000 -- (-616.233) [-616.581] (-616.677) (-616.224) * (-619.216) [-619.219] (-618.231) (-619.968) -- 0:00:06
889500 -- (-616.505) (-617.954) (-621.556) [-617.379] * (-618.863) (-617.069) [-618.903] (-619.471) -- 0:00:06
890000 -- (-617.053) (-617.818) (-618.887) [-617.088] * (-618.194) (-617.737) [-616.650] (-620.397) -- 0:00:06
Average standard deviation of split frequencies: 0.006457
890500 -- (-616.645) (-618.796) [-616.079] (-621.654) * [-615.824] (-617.063) (-617.616) (-617.626) -- 0:00:06
891000 -- (-618.784) (-621.147) (-617.892) [-618.690] * (-616.806) (-620.077) (-617.582) [-615.675] -- 0:00:06
891500 -- (-619.352) (-617.408) [-615.680] (-616.527) * (-618.694) [-617.121] (-616.577) (-616.651) -- 0:00:06
892000 -- (-618.890) [-619.107] (-615.687) (-618.688) * [-617.801] (-615.907) (-618.254) (-615.797) -- 0:00:06
892500 -- [-616.847] (-618.950) (-618.363) (-619.255) * [-620.143] (-617.538) (-618.387) (-618.221) -- 0:00:06
893000 -- [-617.813] (-616.862) (-618.420) (-616.381) * (-619.465) (-622.007) (-616.293) [-618.231] -- 0:00:06
893500 -- (-617.565) (-617.892) [-618.143] (-618.802) * [-618.730] (-620.524) (-617.118) (-618.269) -- 0:00:06
894000 -- (-623.083) (-618.352) (-623.087) [-618.430] * (-616.227) [-617.986] (-620.143) (-616.747) -- 0:00:06
894500 -- (-625.003) [-616.382] (-619.534) (-625.766) * (-618.491) (-621.286) (-616.177) [-618.533] -- 0:00:06
895000 -- (-626.485) [-616.143] (-622.347) (-616.147) * [-617.733] (-615.688) (-618.369) (-617.828) -- 0:00:06
Average standard deviation of split frequencies: 0.006068
895500 -- (-623.904) (-616.429) (-619.306) [-618.627] * (-615.814) (-615.683) (-617.038) [-615.824] -- 0:00:06
896000 -- (-618.216) [-617.647] (-618.006) (-617.719) * (-617.249) (-617.120) [-615.880] (-617.823) -- 0:00:06
896500 -- (-620.298) (-619.145) (-617.426) [-618.875] * [-616.271] (-620.613) (-616.222) (-617.201) -- 0:00:06
897000 -- (-617.243) [-616.421] (-621.034) (-619.041) * (-620.012) [-616.605] (-616.755) (-621.049) -- 0:00:06
897500 -- (-616.983) [-615.766] (-616.724) (-616.347) * (-619.330) (-618.003) [-616.844] (-616.196) -- 0:00:06
898000 -- (-623.707) [-618.158] (-617.977) (-617.427) * (-624.716) (-618.565) [-618.343] (-618.326) -- 0:00:06
898500 -- (-619.874) (-617.024) [-616.556] (-617.923) * (-619.150) (-619.958) (-624.072) [-618.443] -- 0:00:06
899000 -- (-617.052) (-615.999) (-616.655) [-616.965] * [-618.424] (-616.182) (-620.256) (-616.082) -- 0:00:06
899500 -- (-617.038) (-616.803) [-615.780] (-617.142) * [-616.725] (-617.421) (-619.198) (-620.955) -- 0:00:06
900000 -- (-620.855) (-619.833) (-618.655) [-621.809] * (-616.580) [-615.599] (-618.712) (-618.720) -- 0:00:06
Average standard deviation of split frequencies: 0.005792
900500 -- (-616.729) (-617.226) (-616.979) [-620.716] * (-616.850) (-615.781) (-617.528) [-616.680] -- 0:00:05
901000 -- (-617.732) [-616.870] (-617.289) (-620.076) * (-617.035) (-617.092) [-616.588] (-620.936) -- 0:00:05
901500 -- (-615.553) (-615.636) [-618.120] (-620.761) * (-621.748) [-619.963] (-622.277) (-618.054) -- 0:00:05
902000 -- (-616.287) [-616.279] (-623.148) (-619.997) * (-616.002) (-620.160) [-617.261] (-617.949) -- 0:00:05
902500 -- (-620.295) (-622.739) [-617.280] (-617.754) * (-617.114) (-620.270) [-618.124] (-617.949) -- 0:00:05
903000 -- (-618.019) (-620.938) (-619.095) [-617.656] * [-618.842] (-619.854) (-616.547) (-617.851) -- 0:00:05
903500 -- [-615.628] (-616.052) (-619.022) (-619.130) * [-615.839] (-617.578) (-616.757) (-619.106) -- 0:00:05
904000 -- (-616.896) [-617.730] (-617.100) (-618.515) * (-620.810) (-617.291) [-618.491] (-616.428) -- 0:00:05
904500 -- (-617.899) (-616.726) [-617.086] (-618.620) * (-616.243) (-618.672) [-619.964] (-618.087) -- 0:00:05
905000 -- (-617.480) (-618.220) (-616.702) [-619.315] * (-620.504) [-618.996] (-619.143) (-620.093) -- 0:00:05
Average standard deviation of split frequencies: 0.005515
905500 -- [-616.216] (-621.348) (-617.495) (-618.674) * [-620.287] (-617.125) (-617.906) (-615.755) -- 0:00:05
906000 -- (-624.230) [-617.947] (-617.738) (-618.424) * (-618.398) (-616.970) [-616.960] (-618.807) -- 0:00:05
906500 -- (-624.337) (-619.983) (-617.614) [-618.656] * (-617.993) (-616.246) (-616.832) [-617.170] -- 0:00:05
907000 -- [-616.021] (-622.022) (-617.747) (-616.741) * [-615.940] (-618.959) (-617.950) (-616.113) -- 0:00:05
907500 -- (-617.382) (-619.703) (-618.915) [-618.350] * (-617.805) (-618.612) [-616.263] (-617.917) -- 0:00:05
908000 -- (-619.805) [-619.168] (-618.230) (-619.721) * (-623.177) [-615.469] (-619.371) (-626.200) -- 0:00:05
908500 -- (-619.925) (-617.057) [-617.087] (-618.982) * [-617.007] (-616.491) (-618.328) (-619.459) -- 0:00:05
909000 -- (-617.206) (-619.293) (-624.826) [-618.732] * (-617.383) (-615.770) (-617.618) [-616.819] -- 0:00:05
909500 -- (-618.699) (-617.030) [-616.215] (-621.417) * (-617.013) (-615.780) [-621.040] (-616.720) -- 0:00:05
910000 -- (-615.670) [-615.665] (-620.371) (-618.436) * (-617.047) [-615.980] (-620.864) (-618.452) -- 0:00:05
Average standard deviation of split frequencies: 0.005073
910500 -- (-617.111) [-617.857] (-616.110) (-618.288) * (-615.875) [-618.672] (-617.403) (-623.306) -- 0:00:05
911000 -- (-617.728) [-617.855] (-619.680) (-616.210) * (-615.759) (-622.674) [-618.819] (-620.901) -- 0:00:05
911500 -- (-617.539) (-618.092) (-619.983) [-616.750] * [-618.338] (-617.360) (-619.053) (-622.420) -- 0:00:05
912000 -- [-618.526] (-617.288) (-619.477) (-616.083) * (-618.234) [-615.924] (-617.897) (-619.874) -- 0:00:05
912500 -- (-618.985) (-616.831) (-618.980) [-616.012] * [-618.646] (-618.218) (-619.599) (-617.804) -- 0:00:05
913000 -- (-620.372) [-616.979] (-618.368) (-616.406) * (-624.836) [-617.374] (-617.418) (-616.534) -- 0:00:05
913500 -- (-620.954) [-616.805] (-616.527) (-618.346) * (-619.433) (-616.417) [-616.887] (-618.489) -- 0:00:05
914000 -- [-618.248] (-618.117) (-617.066) (-619.811) * (-616.629) [-616.181] (-616.503) (-621.951) -- 0:00:05
914500 -- (-618.951) [-617.850] (-618.703) (-616.006) * (-618.666) [-617.957] (-616.261) (-618.020) -- 0:00:05
915000 -- (-624.004) (-617.191) (-617.466) [-616.096] * (-617.196) (-617.891) (-618.917) [-617.227] -- 0:00:05
Average standard deviation of split frequencies: 0.005043
915500 -- (-624.430) [-619.089] (-617.008) (-616.903) * (-622.487) [-616.431] (-621.372) (-618.800) -- 0:00:05
916000 -- (-621.467) (-617.174) [-617.778] (-618.562) * [-620.215] (-618.493) (-617.807) (-621.427) -- 0:00:05
916500 -- (-617.176) (-618.769) [-618.654] (-617.656) * [-615.917] (-616.641) (-618.223) (-620.182) -- 0:00:05
917000 -- [-616.684] (-621.447) (-615.777) (-619.090) * (-619.891) (-624.147) (-618.285) [-616.142] -- 0:00:04
917500 -- (-617.622) [-619.248] (-617.183) (-623.625) * (-618.766) [-617.712] (-617.611) (-616.395) -- 0:00:04
918000 -- (-619.250) (-619.338) [-617.667] (-618.109) * [-620.351] (-618.075) (-618.219) (-616.453) -- 0:00:04
918500 -- (-618.444) (-616.711) (-620.203) [-618.931] * (-619.712) (-617.444) [-620.125] (-617.105) -- 0:00:04
919000 -- (-618.308) (-622.396) (-619.406) [-616.265] * [-616.768] (-617.280) (-616.218) (-617.706) -- 0:00:04
919500 -- [-618.967] (-620.853) (-617.274) (-616.533) * (-622.856) [-616.417] (-616.302) (-618.348) -- 0:00:04
920000 -- (-617.353) (-621.873) (-620.337) [-616.593] * (-616.911) [-621.002] (-616.001) (-618.709) -- 0:00:04
Average standard deviation of split frequencies: 0.005223
920500 -- (-617.744) (-615.788) (-619.141) [-616.798] * [-623.173] (-620.142) (-615.843) (-625.515) -- 0:00:04
921000 -- (-616.866) (-621.094) (-621.453) [-616.649] * (-620.844) (-624.043) [-615.600] (-625.852) -- 0:00:04
921500 -- (-615.646) (-616.471) (-618.989) [-618.143] * (-624.994) [-616.191] (-617.749) (-621.438) -- 0:00:04
922000 -- (-615.729) (-616.449) (-618.153) [-620.261] * (-621.508) [-617.367] (-620.794) (-619.098) -- 0:00:04
922500 -- (-616.655) (-615.758) [-616.876] (-621.269) * (-617.493) (-623.077) [-619.032] (-623.887) -- 0:00:04
923000 -- (-620.144) [-615.425] (-617.363) (-616.030) * (-622.879) (-615.929) (-617.403) [-623.550] -- 0:00:04
923500 -- [-617.778] (-616.899) (-616.841) (-616.222) * (-618.556) [-616.735] (-619.380) (-624.197) -- 0:00:04
924000 -- (-616.557) (-617.964) (-616.653) [-616.240] * [-617.529] (-617.749) (-616.384) (-617.928) -- 0:00:04
924500 -- (-620.836) [-616.350] (-615.631) (-616.679) * (-618.159) [-616.872] (-616.907) (-617.949) -- 0:00:04
925000 -- (-620.278) [-616.737] (-618.189) (-616.362) * (-618.135) (-615.371) (-617.153) [-615.869] -- 0:00:04
Average standard deviation of split frequencies: 0.005227
925500 -- (-620.649) (-617.215) [-617.246] (-615.676) * (-622.721) (-617.961) [-618.404] (-616.227) -- 0:00:04
926000 -- (-620.253) (-616.029) [-617.950] (-618.112) * (-624.869) [-616.382] (-618.064) (-617.211) -- 0:00:04
926500 -- (-621.445) (-615.915) [-617.578] (-617.194) * [-619.583] (-617.914) (-618.288) (-618.482) -- 0:00:04
927000 -- (-620.793) (-615.998) [-616.340] (-616.630) * (-616.725) [-617.671] (-618.139) (-620.735) -- 0:00:04
927500 -- (-616.207) (-616.093) (-617.770) [-616.471] * (-616.450) (-617.293) [-618.381] (-619.068) -- 0:00:04
928000 -- (-617.967) [-616.585] (-615.963) (-617.195) * (-617.544) (-617.132) [-621.832] (-616.526) -- 0:00:04
928500 -- (-616.823) (-619.256) (-617.984) [-615.268] * (-622.765) (-616.639) (-619.537) [-623.194] -- 0:00:04
929000 -- (-617.314) (-618.247) [-618.375] (-615.963) * [-617.398] (-618.036) (-624.246) (-615.898) -- 0:00:04
929500 -- (-619.670) (-618.254) (-619.005) [-616.060] * [-617.948] (-618.577) (-620.254) (-617.242) -- 0:00:04
930000 -- (-619.626) [-617.658] (-618.113) (-617.078) * (-619.027) (-619.974) [-621.874] (-620.777) -- 0:00:04
Average standard deviation of split frequencies: 0.004964
930500 -- (-620.330) (-620.218) [-615.922] (-616.436) * (-619.451) [-618.425] (-617.876) (-624.823) -- 0:00:04
931000 -- (-619.294) [-620.820] (-615.942) (-616.344) * (-616.870) [-618.601] (-621.156) (-616.955) -- 0:00:04
931500 -- [-621.511] (-617.201) (-617.935) (-617.046) * (-618.160) (-618.905) [-618.824] (-618.236) -- 0:00:04
932000 -- (-619.065) [-618.010] (-619.325) (-618.395) * (-618.436) (-616.172) (-616.276) [-616.563] -- 0:00:04
932500 -- [-616.297] (-617.876) (-621.893) (-616.356) * (-616.857) (-618.607) [-616.798] (-618.591) -- 0:00:04
933000 -- (-620.209) (-619.104) [-618.424] (-616.403) * (-616.065) (-618.187) (-616.094) [-617.219] -- 0:00:04
933500 -- (-618.902) (-619.477) (-617.689) [-615.849] * (-616.885) (-616.704) [-616.710] (-617.261) -- 0:00:03
934000 -- (-618.511) (-618.279) (-624.968) [-618.143] * [-617.018] (-617.015) (-616.806) (-616.968) -- 0:00:03
934500 -- (-619.179) (-616.443) (-620.920) [-620.011] * (-619.676) [-615.516] (-616.768) (-623.036) -- 0:00:03
935000 -- (-616.338) (-617.967) (-618.166) [-616.705] * (-616.400) (-615.860) (-616.930) [-618.366] -- 0:00:03
Average standard deviation of split frequencies: 0.004969
935500 -- [-617.704] (-619.584) (-617.806) (-616.265) * (-616.883) (-615.731) (-616.933) [-615.898] -- 0:00:03
936000 -- (-618.097) (-619.546) (-617.716) [-616.020] * (-616.783) [-615.658] (-619.537) (-616.888) -- 0:00:03
936500 -- (-617.922) (-618.787) (-615.762) [-616.162] * (-616.241) [-615.259] (-620.511) (-615.888) -- 0:00:03
937000 -- [-620.187] (-616.038) (-618.255) (-616.667) * [-615.882] (-617.047) (-618.261) (-616.325) -- 0:00:03
937500 -- [-617.783] (-616.767) (-619.297) (-619.843) * (-623.402) (-616.789) (-616.775) [-617.837] -- 0:00:03
938000 -- [-618.782] (-618.006) (-617.392) (-615.796) * (-620.769) [-615.592] (-618.832) (-618.586) -- 0:00:03
938500 -- (-618.961) [-618.481] (-615.866) (-621.237) * [-616.598] (-616.165) (-616.833) (-616.422) -- 0:00:03
939000 -- (-624.017) [-617.345] (-617.259) (-618.666) * [-615.465] (-618.747) (-618.486) (-616.512) -- 0:00:03
939500 -- (-618.681) (-617.591) [-617.698] (-619.380) * (-617.079) (-619.361) [-616.959] (-616.651) -- 0:00:03
940000 -- [-618.016] (-617.964) (-617.796) (-620.486) * [-617.897] (-619.236) (-621.554) (-619.997) -- 0:00:03
Average standard deviation of split frequencies: 0.005575
940500 -- [-620.605] (-616.414) (-617.883) (-618.603) * [-619.736] (-621.089) (-616.962) (-616.772) -- 0:00:03
941000 -- (-617.420) (-616.389) (-616.038) [-619.365] * [-618.340] (-618.977) (-617.388) (-617.785) -- 0:00:03
941500 -- (-622.108) (-617.314) (-617.878) [-618.461] * [-617.169] (-617.030) (-616.642) (-616.017) -- 0:00:03
942000 -- (-616.623) (-616.805) [-617.069] (-617.548) * [-618.307] (-616.095) (-620.599) (-617.947) -- 0:00:03
942500 -- (-618.087) (-616.163) (-618.389) [-617.463] * (-617.899) (-616.659) (-617.886) [-615.406] -- 0:00:03
943000 -- [-615.739] (-616.376) (-617.148) (-617.406) * (-615.601) (-618.778) (-620.625) [-615.780] -- 0:00:03
943500 -- (-616.725) (-616.731) [-615.561] (-617.697) * [-615.490] (-617.825) (-615.777) (-615.876) -- 0:00:03
944000 -- (-617.472) (-615.875) [-618.287] (-617.012) * (-617.033) (-617.624) [-616.269] (-616.927) -- 0:00:03
944500 -- (-618.183) (-615.899) [-617.082] (-619.781) * [-616.879] (-618.345) (-622.089) (-620.919) -- 0:00:03
945000 -- (-616.822) (-617.601) (-616.106) [-619.127] * [-618.256] (-616.289) (-617.809) (-617.530) -- 0:00:03
Average standard deviation of split frequencies: 0.006104
945500 -- (-616.662) (-617.603) (-617.165) [-616.066] * (-616.380) (-622.344) [-617.259] (-616.933) -- 0:00:03
946000 -- [-615.211] (-617.874) (-618.556) (-615.854) * (-616.243) [-616.554] (-621.746) (-617.791) -- 0:00:03
946500 -- (-617.744) (-626.090) [-617.103] (-616.724) * (-616.616) (-616.878) [-621.686] (-621.003) -- 0:00:03
947000 -- (-617.771) [-616.857] (-618.201) (-616.480) * (-619.005) (-616.556) (-621.245) [-617.898] -- 0:00:03
947500 -- [-621.283] (-619.608) (-616.294) (-615.885) * (-618.990) (-616.480) [-619.029] (-616.826) -- 0:00:03
948000 -- (-624.490) (-615.838) [-615.680] (-616.008) * [-615.307] (-616.170) (-617.597) (-617.101) -- 0:00:03
948500 -- (-618.630) [-617.160] (-618.610) (-616.524) * (-617.375) (-616.620) (-617.342) [-615.979] -- 0:00:03
949000 -- (-615.594) [-618.558] (-616.698) (-618.509) * (-616.951) (-617.120) [-616.711] (-625.011) -- 0:00:03
949500 -- (-617.021) (-616.094) (-619.409) [-617.085] * (-617.334) [-618.122] (-616.936) (-621.857) -- 0:00:03
950000 -- (-616.669) (-621.144) (-620.261) [-618.434] * (-617.739) (-617.616) (-616.772) [-617.562] -- 0:00:03
Average standard deviation of split frequencies: 0.006446
950500 -- (-615.495) (-620.329) (-622.005) [-617.808] * (-619.127) (-616.246) (-616.962) [-618.844] -- 0:00:02
951000 -- (-618.036) (-616.620) [-616.066] (-618.859) * [-618.250] (-618.238) (-618.773) (-616.594) -- 0:00:02
951500 -- (-618.341) [-616.974] (-616.630) (-621.425) * (-618.475) (-617.090) (-616.848) [-617.735] -- 0:00:02
952000 -- (-617.578) [-617.937] (-618.136) (-616.775) * (-620.946) [-615.824] (-617.076) (-618.661) -- 0:00:02
952500 -- (-616.587) (-619.295) [-616.294] (-617.161) * (-617.728) [-616.753] (-617.064) (-623.069) -- 0:00:02
953000 -- [-618.424] (-619.168) (-616.686) (-617.335) * (-618.114) (-618.106) (-623.152) [-616.764] -- 0:00:02
953500 -- (-617.640) [-617.704] (-616.761) (-617.465) * (-617.274) (-618.492) (-620.228) [-619.795] -- 0:00:02
954000 -- (-618.155) (-620.206) (-618.238) [-617.080] * (-618.002) (-617.898) (-618.548) [-618.982] -- 0:00:02
954500 -- (-618.186) (-619.468) [-616.063] (-624.849) * (-618.932) [-616.325] (-619.815) (-616.866) -- 0:00:02
955000 -- [-615.726] (-623.077) (-617.460) (-617.789) * (-617.751) (-616.641) [-618.685] (-616.316) -- 0:00:02
Average standard deviation of split frequencies: 0.006040
955500 -- (-618.121) (-618.926) (-615.943) [-617.322] * (-618.125) (-618.708) [-620.964] (-619.605) -- 0:00:02
956000 -- (-616.087) (-617.283) [-616.891] (-620.094) * (-616.731) (-615.468) (-617.635) [-618.668] -- 0:00:02
956500 -- (-616.910) (-616.922) (-616.380) [-618.062] * [-621.021] (-616.755) (-617.256) (-618.742) -- 0:00:02
957000 -- (-618.008) [-616.698] (-618.362) (-618.569) * (-620.937) (-616.810) (-616.072) [-617.206] -- 0:00:02
957500 -- [-618.248] (-624.473) (-619.999) (-618.111) * (-622.149) [-615.782] (-617.984) (-616.118) -- 0:00:02
958000 -- [-616.370] (-617.518) (-619.772) (-621.224) * (-620.190) (-616.509) (-616.155) [-616.863] -- 0:00:02
958500 -- (-616.984) (-616.921) (-620.046) [-616.860] * (-616.936) (-619.177) (-616.366) [-616.287] -- 0:00:02
959000 -- [-623.794] (-616.971) (-619.974) (-619.368) * (-618.151) [-616.961] (-616.803) (-617.695) -- 0:00:02
959500 -- (-620.387) (-618.263) (-617.952) [-616.569] * (-623.403) [-616.924] (-616.253) (-616.706) -- 0:00:02
960000 -- (-617.511) [-619.939] (-616.435) (-616.941) * (-616.624) (-617.014) [-617.194] (-616.182) -- 0:00:02
Average standard deviation of split frequencies: 0.006103
960500 -- (-617.078) [-625.716] (-617.340) (-616.723) * (-618.459) [-617.700] (-619.543) (-616.494) -- 0:00:02
961000 -- (-615.416) (-617.004) [-618.471] (-617.822) * [-616.941] (-618.257) (-618.657) (-619.233) -- 0:00:02
961500 -- (-616.936) (-617.169) [-617.429] (-621.190) * (-616.335) (-616.819) (-619.318) [-617.267] -- 0:00:02
962000 -- (-616.645) (-616.315) [-616.373] (-618.203) * (-616.988) (-616.716) [-620.924] (-617.514) -- 0:00:02
962500 -- [-616.718] (-616.512) (-616.415) (-615.436) * (-618.734) (-617.220) [-616.205] (-616.091) -- 0:00:02
963000 -- (-616.077) [-619.712] (-616.612) (-616.972) * [-616.340] (-617.040) (-617.270) (-616.379) -- 0:00:02
963500 -- (-618.561) (-616.366) (-616.765) [-617.972] * (-616.787) (-616.896) (-615.851) [-616.470] -- 0:00:02
964000 -- (-618.392) (-616.810) [-618.408] (-617.024) * [-615.622] (-618.544) (-617.649) (-619.461) -- 0:00:02
964500 -- (-620.922) (-616.814) [-616.609] (-619.123) * (-616.853) (-621.173) (-619.213) [-616.143] -- 0:00:02
965000 -- (-620.819) [-616.194] (-616.604) (-621.768) * (-625.378) [-620.096] (-615.664) (-616.017) -- 0:00:02
Average standard deviation of split frequencies: 0.005498
965500 -- (-616.526) (-620.060) [-616.616] (-617.242) * [-619.678] (-616.552) (-617.445) (-617.288) -- 0:00:02
966000 -- [-616.837] (-617.102) (-616.888) (-619.615) * (-620.117) (-618.035) [-616.819] (-618.233) -- 0:00:02
966500 -- (-616.184) (-618.665) [-615.467] (-617.213) * (-617.621) (-617.937) (-617.273) [-618.060] -- 0:00:02
967000 -- (-617.205) (-617.889) (-621.283) [-618.136] * (-619.793) [-616.029] (-616.108) (-620.372) -- 0:00:01
967500 -- (-617.102) (-616.736) [-617.451] (-617.798) * [-616.432] (-615.888) (-619.878) (-617.331) -- 0:00:01
968000 -- (-616.539) [-620.860] (-615.783) (-617.940) * (-617.564) [-615.644] (-618.581) (-617.005) -- 0:00:01
968500 -- [-618.788] (-617.676) (-616.365) (-619.070) * (-617.873) (-615.587) [-616.807] (-621.399) -- 0:00:01
969000 -- (-617.874) (-619.104) [-616.459] (-618.857) * (-617.415) (-616.844) (-619.108) [-616.580] -- 0:00:01
969500 -- (-621.703) [-623.422] (-620.222) (-617.850) * (-617.988) [-617.183] (-616.569) (-619.819) -- 0:00:01
970000 -- [-618.514] (-621.115) (-617.564) (-619.657) * (-615.383) (-616.969) [-616.273] (-616.682) -- 0:00:01
Average standard deviation of split frequencies: 0.005889
970500 -- (-618.597) (-622.339) (-619.899) [-618.764] * [-615.506] (-620.109) (-616.618) (-616.705) -- 0:00:01
971000 -- [-616.518] (-627.587) (-617.962) (-618.684) * (-616.528) [-616.099] (-616.926) (-618.799) -- 0:00:01
971500 -- (-619.509) (-623.132) [-616.773] (-616.119) * (-617.262) (-616.054) (-616.645) [-616.209] -- 0:00:01
972000 -- [-620.789] (-622.521) (-617.378) (-616.184) * (-618.934) (-617.091) (-617.908) [-615.753] -- 0:00:01
972500 -- (-619.456) [-617.114] (-617.458) (-620.262) * (-620.511) (-616.659) (-618.808) [-617.640] -- 0:00:01
973000 -- [-618.274] (-622.304) (-619.381) (-622.193) * (-617.602) (-618.756) [-617.765] (-617.962) -- 0:00:01
973500 -- (-616.457) (-619.096) (-618.152) [-617.353] * (-619.913) (-617.909) [-618.179] (-616.057) -- 0:00:01
974000 -- (-618.936) (-621.886) [-617.383] (-615.890) * [-619.685] (-622.697) (-616.453) (-618.987) -- 0:00:01
974500 -- (-619.232) (-618.631) [-617.690] (-619.769) * (-618.700) (-620.082) [-619.637] (-618.576) -- 0:00:01
975000 -- (-616.805) (-622.370) (-617.725) [-617.582] * (-617.513) (-619.856) (-621.808) [-617.268] -- 0:00:01
Average standard deviation of split frequencies: 0.005766
975500 -- [-619.156] (-617.308) (-617.676) (-616.673) * [-615.978] (-617.917) (-617.841) (-616.654) -- 0:00:01
976000 -- (-617.300) [-618.347] (-617.749) (-619.883) * [-616.858] (-619.740) (-617.222) (-620.644) -- 0:00:01
976500 -- [-615.965] (-615.429) (-617.155) (-619.729) * (-619.206) [-616.638] (-617.985) (-618.787) -- 0:00:01
977000 -- (-617.038) (-617.429) (-617.953) [-615.710] * (-616.229) (-616.874) (-620.709) [-618.733] -- 0:00:01
977500 -- [-619.306] (-615.996) (-619.561) (-616.961) * (-617.575) (-617.539) (-619.065) [-618.738] -- 0:00:01
978000 -- [-618.469] (-617.418) (-616.454) (-617.978) * (-619.080) (-617.580) [-618.938] (-618.317) -- 0:00:01
978500 -- (-617.792) (-615.430) (-618.073) [-617.863] * (-615.798) [-621.855] (-616.771) (-620.232) -- 0:00:01
979000 -- (-618.159) (-615.712) [-616.456] (-616.024) * (-615.843) (-616.832) [-617.106] (-619.068) -- 0:00:01
979500 -- (-617.022) (-618.691) [-619.532] (-617.741) * [-615.696] (-617.005) (-617.999) (-616.795) -- 0:00:01
980000 -- [-619.244] (-618.991) (-616.466) (-618.067) * [-616.578] (-617.527) (-618.620) (-621.011) -- 0:00:01
Average standard deviation of split frequencies: 0.005736
980500 -- (-617.850) (-621.036) (-617.938) [-621.351] * (-616.869) (-616.147) [-619.019] (-621.302) -- 0:00:01
981000 -- [-617.581] (-617.613) (-620.988) (-620.023) * [-618.532] (-616.445) (-618.815) (-619.855) -- 0:00:01
981500 -- (-618.632) (-622.840) (-616.570) [-619.044] * (-616.493) (-617.004) (-617.337) [-617.643] -- 0:00:01
982000 -- [-616.851] (-620.308) (-616.130) (-618.281) * (-618.385) (-620.072) (-618.546) [-616.488] -- 0:00:01
982500 -- [-616.193] (-619.766) (-618.552) (-619.817) * (-618.044) [-618.032] (-620.174) (-617.389) -- 0:00:01
983000 -- [-616.803] (-617.129) (-620.732) (-615.775) * [-617.129] (-619.357) (-618.032) (-616.973) -- 0:00:01
983500 -- [-618.006] (-616.435) (-619.600) (-616.237) * (-617.072) [-616.588] (-620.258) (-617.764) -- 0:00:00
984000 -- [-617.378] (-617.143) (-616.637) (-621.413) * (-621.962) (-616.558) [-617.318] (-617.917) -- 0:00:00
984500 -- (-622.361) (-616.033) [-615.497] (-616.889) * (-616.589) (-616.536) (-618.706) [-615.492] -- 0:00:00
985000 -- (-616.834) [-615.835] (-616.523) (-619.477) * (-620.934) (-616.241) [-618.638] (-616.413) -- 0:00:00
Average standard deviation of split frequencies: 0.005514
985500 -- (-616.672) [-616.675] (-616.896) (-619.232) * (-621.286) [-616.810] (-619.525) (-621.302) -- 0:00:00
986000 -- (-619.763) [-616.261] (-623.219) (-617.441) * (-621.135) (-617.813) [-619.051] (-615.981) -- 0:00:00
986500 -- (-619.429) (-617.066) (-616.768) [-617.476] * (-618.451) (-618.930) [-617.922] (-617.037) -- 0:00:00
987000 -- (-622.324) (-617.258) (-620.827) [-617.680] * (-617.029) (-619.318) [-621.090] (-618.800) -- 0:00:00
987500 -- (-617.456) (-618.270) [-618.959] (-618.535) * (-618.261) (-622.917) [-621.363] (-618.617) -- 0:00:00
988000 -- (-618.069) (-617.399) [-615.972] (-618.752) * [-617.517] (-616.714) (-618.403) (-619.321) -- 0:00:00
988500 -- [-616.592] (-617.776) (-615.720) (-617.251) * (-618.505) (-616.029) [-617.813] (-622.385) -- 0:00:00
989000 -- (-615.366) (-617.369) [-619.795] (-619.631) * (-618.252) (-615.409) [-615.732] (-620.931) -- 0:00:00
989500 -- (-616.188) (-619.120) (-616.366) [-619.481] * (-620.932) (-616.627) [-617.350] (-622.111) -- 0:00:00
990000 -- (-615.942) (-616.135) [-616.768] (-621.292) * (-620.384) [-618.809] (-621.134) (-618.488) -- 0:00:00
Average standard deviation of split frequencies: 0.005615
990500 -- (-616.824) (-617.774) (-616.769) [-620.356] * (-617.699) [-618.821] (-615.916) (-619.187) -- 0:00:00
991000 -- (-617.057) (-616.642) (-619.491) [-623.895] * (-616.867) [-618.596] (-616.053) (-620.100) -- 0:00:00
991500 -- [-618.619] (-617.973) (-617.419) (-620.187) * (-620.747) (-616.379) [-615.763] (-618.025) -- 0:00:00
992000 -- (-618.956) (-619.884) [-616.925] (-620.173) * [-618.259] (-618.272) (-615.964) (-617.495) -- 0:00:00
992500 -- (-616.705) (-617.748) (-616.894) [-616.413] * (-615.737) [-620.074] (-617.774) (-622.793) -- 0:00:00
993000 -- (-617.000) (-617.201) (-617.267) [-620.237] * (-616.486) [-617.385] (-617.325) (-619.794) -- 0:00:00
993500 -- (-618.266) (-615.889) (-618.756) [-622.680] * (-618.333) (-616.712) (-620.227) [-620.301] -- 0:00:00
994000 -- (-616.586) (-616.037) [-618.764] (-617.358) * [-617.906] (-621.367) (-618.359) (-617.462) -- 0:00:00
994500 -- [-616.522] (-620.822) (-617.805) (-616.131) * (-617.628) (-617.418) [-615.803] (-619.291) -- 0:00:00
995000 -- (-615.987) (-616.604) [-617.596] (-615.687) * (-618.819) [-616.970] (-615.449) (-618.748) -- 0:00:00
Average standard deviation of split frequencies: 0.005553
995500 -- (-616.227) (-619.959) [-616.248] (-616.701) * (-618.032) [-617.045] (-615.896) (-618.421) -- 0:00:00
996000 -- (-615.938) [-617.233] (-619.643) (-617.412) * (-617.069) [-617.011] (-617.574) (-616.340) -- 0:00:00
996500 -- (-618.055) [-616.743] (-619.073) (-617.181) * (-616.200) (-615.834) (-617.852) [-617.023] -- 0:00:00
997000 -- (-619.545) [-617.106] (-616.929) (-616.400) * (-616.114) (-617.545) (-618.982) [-617.860] -- 0:00:00
997500 -- (-618.035) (-617.052) (-616.731) [-616.492] * (-617.056) [-618.613] (-618.581) (-627.121) -- 0:00:00
998000 -- (-618.650) (-618.987) (-621.697) [-615.869] * (-619.292) (-620.470) (-619.072) [-618.868] -- 0:00:00
998500 -- (-616.334) (-616.862) [-618.822] (-615.830) * (-618.053) [-618.559] (-618.651) (-623.733) -- 0:00:00
999000 -- (-617.877) [-622.241] (-617.411) (-615.579) * (-618.974) [-615.445] (-621.304) (-618.896) -- 0:00:00
999500 -- (-618.335) (-618.785) (-617.076) [-616.743] * (-618.681) (-616.767) [-616.309] (-619.310) -- 0:00:00
1000000 -- [-617.418] (-618.350) (-617.461) (-619.183) * [-618.240] (-616.978) (-617.942) (-617.794) -- 0:00:00
Average standard deviation of split frequencies: 0.005559
Analysis completed in 60 seconds
Analysis used 59.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -615.16
Likelihood of best state for "cold" chain of run 2 was -615.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.2 % ( 23 %) Dirichlet(Pi{all})
33.7 % ( 27 %) Slider(Pi{all})
78.3 % ( 58 %) Multiplier(Alpha{1,2})
77.9 % ( 54 %) Multiplier(Alpha{3})
24.2 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 96 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
32.5 % ( 29 %) Dirichlet(Pi{all})
33.3 % ( 23 %) Slider(Pi{all})
78.5 % ( 58 %) Multiplier(Alpha{1,2})
77.7 % ( 50 %) Multiplier(Alpha{3})
24.0 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166246 0.82 0.67
3 | 166874 166756 0.84
4 | 167059 166615 166450
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166655 0.82 0.67
3 | 166800 167042 0.83
4 | 166600 166387 166516
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -617.07
| 1 2 |
| 1 1 1 2 |
| 1 1 2 * 2 |
|2 1 2 1 1 2 1 22 1 |
| 111 2 *1 22 2 1 1 2 * 2 121 2 1 |
| 2 22 2 2 1 1 12 2 2 11 2 1 1 |
| 2 2 1 2 1 122 1 2 |
| 2 2 1 1 22 2 * 2 1 2 2 2 2 2 2|
|1 1* 2 * 1 2 1 11 2 11 |
| 1 1 2 1 1 2 |
| 1 2 11 1 2 1 |
| 1 2 1|
| 2 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -618.59
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -616.90 -621.41
2 -616.91 -620.77
--------------------------------------
TOTAL -616.90 -621.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894483 0.088982 0.365089 1.485967 0.869405 1363.10 1432.05 1.000
r(A<->C){all} 0.172803 0.019911 0.000018 0.463027 0.136753 215.17 236.84 1.000
r(A<->G){all} 0.163858 0.019325 0.000121 0.452071 0.125748 135.56 186.31 1.001
r(A<->T){all} 0.160598 0.020074 0.000009 0.446721 0.122674 312.81 326.21 1.004
r(C<->G){all} 0.168926 0.019854 0.000015 0.454694 0.136144 135.44 185.48 1.000
r(C<->T){all} 0.159516 0.018616 0.000026 0.430414 0.120495 194.88 261.19 1.000
r(G<->T){all} 0.174299 0.022217 0.000103 0.489285 0.133201 153.25 188.22 1.000
pi(A){all} 0.177297 0.000321 0.141687 0.211558 0.176971 1280.94 1311.03 1.001
pi(C){all} 0.307498 0.000467 0.267401 0.349752 0.307752 1208.81 1284.95 1.000
pi(G){all} 0.306920 0.000451 0.265242 0.345417 0.306859 1313.66 1366.36 1.000
pi(T){all} 0.208284 0.000361 0.171830 0.245336 0.207640 1280.70 1298.26 1.000
alpha{1,2} 0.427009 0.242398 0.000181 1.390142 0.262903 1130.49 1180.11 1.000
alpha{3} 0.450569 0.225820 0.000216 1.425669 0.303943 1282.24 1322.19 1.000
pinvar{all} 0.996386 0.000021 0.987921 0.999998 0.997747 1145.90 1241.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*.***
9 -- .*..*.
10 -- .*...*
11 -- .***.*
12 -- ..****
13 -- ..*.*.
14 -- ...**.
15 -- ..*..*
16 -- .**...
17 -- .**.**
18 -- ....**
19 -- .*.*..
20 -- ..**..
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.003298 0.147901 0.152565 2
8 447 0.148901 0.013662 0.139241 0.158561 2
9 446 0.148568 0.001884 0.147235 0.149900 2
10 443 0.147568 0.015546 0.136576 0.158561 2
11 434 0.144570 0.000000 0.144570 0.144570 2
12 433 0.144237 0.003298 0.141905 0.146569 2
13 431 0.143571 0.005182 0.139907 0.147235 2
14 428 0.142572 0.002827 0.140573 0.144570 2
15 425 0.141572 0.006124 0.137242 0.145903 2
16 425 0.141572 0.002355 0.139907 0.143238 2
17 423 0.140906 0.001413 0.139907 0.141905 2
18 419 0.139574 0.008009 0.133911 0.145237 2
19 415 0.138241 0.004240 0.135243 0.141239 2
20 414 0.137908 0.003769 0.135243 0.140573 2
21 407 0.135576 0.011777 0.127249 0.143904 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101986 0.011149 0.000034 0.307306 0.069324 1.000 2
length{all}[2] 0.093266 0.008946 0.000040 0.279431 0.063206 1.000 2
length{all}[3] 0.099159 0.009614 0.000086 0.306338 0.068585 1.000 2
length{all}[4] 0.100956 0.010469 0.000029 0.303718 0.069958 1.001 2
length{all}[5] 0.100428 0.010498 0.000021 0.305161 0.069973 1.000 2
length{all}[6] 0.101592 0.010171 0.000024 0.304695 0.070941 1.000 2
length{all}[7] 0.099191 0.010173 0.000524 0.296637 0.070930 0.998 2
length{all}[8] 0.097653 0.009405 0.000192 0.295241 0.069183 0.998 2
length{all}[9] 0.094946 0.008854 0.000023 0.300815 0.063050 0.998 2
length{all}[10] 0.102314 0.009865 0.000155 0.295952 0.073192 0.999 2
length{all}[11] 0.095149 0.010614 0.000047 0.322398 0.060239 0.998 2
length{all}[12] 0.105149 0.010352 0.000390 0.307341 0.073252 0.998 2
length{all}[13] 0.103379 0.010448 0.000611 0.286481 0.071266 1.006 2
length{all}[14] 0.102436 0.011772 0.000125 0.335639 0.072181 0.998 2
length{all}[15] 0.090019 0.008212 0.000126 0.257659 0.059481 1.004 2
length{all}[16] 0.105124 0.012089 0.000152 0.311957 0.069641 0.998 2
length{all}[17] 0.093682 0.007331 0.000147 0.284452 0.068211 0.999 2
length{all}[18] 0.097283 0.011098 0.000273 0.301177 0.061728 0.998 2
length{all}[19] 0.095766 0.008922 0.000150 0.291247 0.065054 1.000 2
length{all}[20] 0.097357 0.010234 0.000075 0.300087 0.065155 1.003 2
length{all}[21] 0.111049 0.011157 0.000516 0.330613 0.077912 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005559
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 453
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 43 patterns at 151 / 151 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 43 patterns at 151 / 151 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
41968 bytes for conP
3784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045497 0.030279 0.067229 0.044723 0.018805 0.066278 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -622.158863
Iterating by ming2
Initial: fx= 622.158863
x= 0.04550 0.03028 0.06723 0.04472 0.01881 0.06628 0.30000 1.30000
1 h-m-p 0.0000 0.0001 363.5165 ++ 605.474659 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0157 27.6174 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 332.7186 ++ 596.931632 m 0.0001 44 | 2/8
4 h-m-p 0.0011 0.0252 21.2282 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 297.9615 ++ 588.279558 m 0.0001 75 | 3/8
6 h-m-p 0.0015 0.0431 16.3203 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 258.5846 ++ 587.931101 m 0.0000 106 | 4/8
8 h-m-p 0.0001 0.0704 12.2728 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 210.8707 ++ 581.665715 m 0.0001 136 | 5/8
10 h-m-p 0.0025 0.1352 8.2494 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 149.7046 ++ 581.521558 m 0.0000 168 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 Y 581.521558 0 0.0160 179 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ---C 581.521558 0 0.0063 195
Out..
lnL = -581.521558
196 lfun, 196 eigenQcodon, 1176 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105058 0.087575 0.044402 0.024985 0.078391 0.079622 0.299976 0.600950 0.239072
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.550748
np = 9
lnL0 = -640.624799
Iterating by ming2
Initial: fx= 640.624799
x= 0.10506 0.08758 0.04440 0.02498 0.07839 0.07962 0.29998 0.60095 0.23907
1 h-m-p 0.0000 0.0002 327.2040 +++ 620.460971 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0004 237.2410 ++ 606.570105 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 844.0263 ++ 587.477961 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0001 117.7143 ++ 586.835946 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 3154.5379 ++ 584.115209 m 0.0000 63 | 5/9
6 h-m-p 0.0006 0.0030 14.0563 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 206.5275 ++ 584.028271 m 0.0000 96 | 6/9
8 h-m-p 0.0001 0.0378 9.0830 ---------.. | 6/9
9 h-m-p 0.0000 0.0001 145.6045 ++ 581.521522 m 0.0001 127 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 581.521522 m 8.0000 139 | 7/9
11 h-m-p 0.1513 8.0000 0.0001 -----Y 581.521522 0 0.0000 158
Out..
lnL = -581.521522
159 lfun, 477 eigenQcodon, 1908 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018962 0.012240 0.093780 0.079538 0.099269 0.058373 0.285514 1.544940 0.237301 0.289375 1.533124
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.974116
np = 11
lnL0 = -632.166168
Iterating by ming2
Initial: fx= 632.166168
x= 0.01896 0.01224 0.09378 0.07954 0.09927 0.05837 0.28551 1.54494 0.23730 0.28938 1.53312
1 h-m-p 0.0000 0.0001 324.4661 ++ 622.455470 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 192.8043 ++ 617.613549 m 0.0002 30 | 2/11
3 h-m-p 0.0001 0.0007 132.2018 ++ 597.696995 m 0.0007 44 | 3/11
4 h-m-p 0.0005 0.0027 50.0539 ++ 587.318952 m 0.0027 58 | 4/11
5 h-m-p 0.0000 0.0000 5754.0249 ++ 582.819240 m 0.0000 72 | 5/11
6 h-m-p 0.0019 0.0095 3.8935 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 207.8143 ++ 582.446904 m 0.0000 110 | 6/11
8 h-m-p 0.0007 0.2338 1.8841 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 147.1433 ++ 581.521525 m 0.0000 147 | 7/11
10 h-m-p 0.0688 8.0000 0.0000 ++++ 581.521525 m 8.0000 163 | 7/11
11 h-m-p 0.0160 8.0000 0.0341 -------Y 581.521525 0 0.0000 188 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 581.521525 m 8.0000 209 | 7/11
13 h-m-p 0.0001 0.0472 11.1813 +++++ 581.521521 m 0.0472 230 | 8/11
14 h-m-p 0.1788 1.2075 0.8560 ++ 581.521499 m 1.2075 244 | 9/11
15 h-m-p 0.1588 8.0000 6.1934 +++ 581.521475 m 8.0000 262 | 9/11
16 h-m-p 1.6000 8.0000 1.0246 ++ 581.521474 m 8.0000 276 | 9/11
17 h-m-p 0.0294 0.1470 276.4348 ++ 581.521466 m 0.1470 290 | 9/11
18 h-m-p -0.0000 -0.0000 382.8374
h-m-p: -0.00000000e+00 -0.00000000e+00 3.82837357e+02 581.521466
.. | 9/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 581.521466 m 8.0000 318 | 9/11
20 h-m-p 0.0160 8.0000 0.0784 +++++ 581.521452 m 8.0000 337 | 9/11
21 h-m-p 0.3989 8.0000 1.5724 +++ 581.521430 m 8.0000 354 | 9/11
22 h-m-p 1.6000 8.0000 0.0000 N 581.521430 0 1.6000 368 | 9/11
23 h-m-p 0.0160 8.0000 0.0000 Y 581.521430 0 0.0160 384
Out..
lnL = -581.521430
385 lfun, 1540 eigenQcodon, 6930 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -581.551415 S = -581.522034 -0.011294
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:02
did 20 / 43 patterns 0:02
did 30 / 43 patterns 0:02
did 40 / 43 patterns 0:02
did 43 / 43 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027710 0.039885 0.048381 0.034045 0.044561 0.029788 0.000100 0.504127 1.768977
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.749840
np = 9
lnL0 = -613.447174
Iterating by ming2
Initial: fx= 613.447174
x= 0.02771 0.03989 0.04838 0.03404 0.04456 0.02979 0.00011 0.50413 1.76898
1 h-m-p 0.0000 0.0000 337.4396 ++ 612.822897 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0209 24.0759 +++++ 611.076819 m 0.0209 29 | 2/9
3 h-m-p 0.0000 0.0003 3071.2507 ++ 590.348167 m 0.0003 41 | 3/9
4 h-m-p 0.0002 0.0012 623.7435 ++ 585.836724 m 0.0012 53 | 4/9
5 h-m-p 0.0000 0.0000 1000.8663 ++ 585.676171 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0001 122.6097 ++ 585.285326 m 0.0001 77 | 6/9
7 h-m-p 0.0000 0.0002 60.8481 ++ 584.614528 m 0.0002 89 | 7/9
8 h-m-p 0.0040 0.2737 1.6121 ------------.. | 7/9
9 h-m-p 0.0000 0.0002 141.7565 ++ 581.521448 m 0.0002 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 581.521448 m 8.0000 135 | 8/9
11 h-m-p 0.0160 8.0000 0.0034 +++++ 581.521434 m 8.0000 151 | 8/9
12 h-m-p 1.6000 8.0000 0.0064 ++ 581.521431 m 8.0000 164 | 8/9
13 h-m-p 1.6000 8.0000 0.0033 ++ 581.521431 m 8.0000 177 | 8/9
14 h-m-p 1.6000 8.0000 0.0153 ++ 581.521430 m 8.0000 190 | 8/9
15 h-m-p 1.6000 8.0000 0.0078 ++ 581.521430 m 8.0000 203 | 8/9
16 h-m-p 1.3067 8.0000 0.0476 ++ 581.521430 m 8.0000 216 | 8/9
17 h-m-p 1.6000 8.0000 0.0256 ++ 581.521430 m 8.0000 229 | 8/9
18 h-m-p 1.6000 8.0000 0.0467 ++ 581.521430 m 8.0000 242 | 8/9
19 h-m-p 0.3150 1.5748 0.8523 ---------------.. | 8/9
20 h-m-p 0.0160 8.0000 0.0000 ----C 581.521430 0 0.0000 285 | 8/9
21 h-m-p 0.0160 8.0000 0.0000 ------Y 581.521430 0 0.0000 304
Out..
lnL = -581.521430
305 lfun, 3355 eigenQcodon, 18300 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057686 0.044644 0.046212 0.024787 0.027380 0.038348 0.000100 0.900000 0.686113 1.346272 1.299962
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.994264
np = 11
lnL0 = -615.366328
Iterating by ming2
Initial: fx= 615.366328
x= 0.05769 0.04464 0.04621 0.02479 0.02738 0.03835 0.00011 0.90000 0.68611 1.34627 1.29996
1 h-m-p 0.0000 0.0000 331.9244 ++ 614.630401 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0058 64.8937 ++++ 593.435717 m 0.0058 32 | 2/11
3 h-m-p 0.0000 0.0000 73461.0961 ++ 591.651922 m 0.0000 46 | 3/11
4 h-m-p 0.0014 0.0071 23.3960 ++ 590.094099 m 0.0071 60 | 4/11
5 h-m-p 0.0001 0.0004 1258.5341 ++ 584.237591 m 0.0004 74 | 5/11
6 h-m-p 0.0000 0.0001 3098.2010 ++ 581.809328 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0000 587.2573 ++ 581.521546 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 581.521546 m 8.0000 116 | 7/11
9 h-m-p 0.0132 6.5829 0.0793 ---------Y 581.521546 0 0.0000 143 | 7/11
10 h-m-p 0.0064 3.2193 0.1535 +++++ 581.521495 m 3.2193 164 | 8/11
11 h-m-p 0.9576 8.0000 0.0857 ------------C 581.521495 0 0.0000 194 | 8/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 581.521495 m 8.0000 214 | 8/11
13 h-m-p 0.0160 8.0000 0.4001 -----------Y 581.521495 0 0.0000 242 | 8/11
14 h-m-p 0.0160 8.0000 0.0002 ------C 581.521495 0 0.0000 265 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 --Y 581.521495 0 0.0001 284
Out..
lnL = -581.521495
285 lfun, 3420 eigenQcodon, 18810 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -581.542949 S = -581.520357 -0.009942
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:12
did 20 / 43 patterns 0:12
did 30 / 43 patterns 0:12
did 40 / 43 patterns 0:12
did 43 / 43 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=151
NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
NC_002677_1_NP_302066_1_938_ML1525 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
**************************************************
NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
NC_002677_1_NP_302066_1_938_ML1525 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
**************************************************
NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
NC_002677_1_NP_302066_1_938_ML1525 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
**************************************************
NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 E
NC_002677_1_NP_302066_1_938_ML1525 E
NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 E
NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 E
NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 E
NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 E
*
>NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA >NC_002677_1_NP_302066_1_938_ML1525 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA >NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA >NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA >NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA >NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG GAA
>NC_011896_1_WP_010908387_1_1616_MLBR_RS07680 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E >NC_002677_1_NP_302066_1_938_ML1525 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E >NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E >NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E >NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E >NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580 MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM E
#NEXUS
[ID: 5360226034]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908387_1_1616_MLBR_RS07680
NC_002677_1_NP_302066_1_938_ML1525
NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450
NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880
NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380
NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908387_1_1616_MLBR_RS07680,
2 NC_002677_1_NP_302066_1_938_ML1525,
3 NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450,
4 NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880,
5 NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380,
6 NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06932362,2:0.06320602,3:0.06858486,4:0.06995752,5:0.06997266,6:0.07094082);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06932362,2:0.06320602,3:0.06858486,4:0.06995752,5:0.06997266,6:0.07094082);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -616.90 -621.41
2 -616.91 -620.77
--------------------------------------
TOTAL -616.90 -621.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894483 0.088982 0.365089 1.485967 0.869405 1363.10 1432.05 1.000
r(A<->C){all} 0.172803 0.019911 0.000018 0.463027 0.136753 215.17 236.84 1.000
r(A<->G){all} 0.163858 0.019325 0.000121 0.452071 0.125748 135.56 186.31 1.001
r(A<->T){all} 0.160598 0.020074 0.000009 0.446721 0.122674 312.81 326.21 1.004
r(C<->G){all} 0.168926 0.019854 0.000015 0.454694 0.136144 135.44 185.48 1.000
r(C<->T){all} 0.159516 0.018616 0.000026 0.430414 0.120495 194.88 261.19 1.000
r(G<->T){all} 0.174299 0.022217 0.000103 0.489285 0.133201 153.25 188.22 1.000
pi(A){all} 0.177297 0.000321 0.141687 0.211558 0.176971 1280.94 1311.03 1.001
pi(C){all} 0.307498 0.000467 0.267401 0.349752 0.307752 1208.81 1284.95 1.000
pi(G){all} 0.306920 0.000451 0.265242 0.345417 0.306859 1313.66 1366.36 1.000
pi(T){all} 0.208284 0.000361 0.171830 0.245336 0.207640 1280.70 1298.26 1.000
alpha{1,2} 0.427009 0.242398 0.000181 1.390142 0.262903 1130.49 1180.11 1.000
alpha{3} 0.450569 0.225820 0.000216 1.425669 0.303943 1282.24 1322.19 1.000
pinvar{all} 0.996386 0.000021 0.987921 0.999998 0.997747 1145.90 1241.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1525/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 151
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 3 3 3 3 3 3 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 8 8 8 8 8 8 | CCG 5 5 5 5 5 5 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 4 4 4 4 4 4 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 7 7 7 7 7 7 | AAC 5 5 5 5 5 5 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 6 6 6 6 6 6 | GCC 10 10 10 10 10 10 | GAC 8 8 8 8 8 8 | GGC 8 8 8 8 8 8
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 2 2 2 2 2 2
GTG 7 7 7 7 7 7 | GCG 5 5 5 5 5 5 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908387_1_1616_MLBR_RS07680
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
#2: NC_002677_1_NP_302066_1_938_ML1525
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
#3: NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
#4: NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
#5: NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
#6: NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 18 | TAC 30 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 24 | CGC 6
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 12
CTG 48 | CCG 30 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 24 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 42 | AAC 30 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 36 | ACG 12 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 18
GTC 36 | GCC 60 | GAC 48 | GGC 48
GTA 12 | GCA 12 | Glu E GAA 24 | GGA 12
GTG 42 | GCG 30 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13907 C:0.21192 A:0.19868 G:0.45033
position 2: T:0.31788 C:0.29801 A:0.24503 G:0.13907
position 3: T:0.16556 C:0.41722 A:0.08609 G:0.33113
Average T:0.20751 C:0.30905 A:0.17660 G:0.30684
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -581.521558 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299976 1.299962
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908387_1_1616_MLBR_RS07680: 0.000004, NC_002677_1_NP_302066_1_938_ML1525: 0.000004, NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450: 0.000004, NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880: 0.000004, NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380: 0.000004, NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29998
omega (dN/dS) = 1.29996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 346.2 106.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -581.521522 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.285514 0.664041 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908387_1_1616_MLBR_RS07680: 0.000004, NC_002677_1_NP_302066_1_938_ML1525: 0.000004, NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450: 0.000004, NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880: 0.000004, NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380: 0.000004, NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28551
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66404 0.33596
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
7..2 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
7..3 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
7..4 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
7..5 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
7..6 0.000 346.3 106.7 0.3360 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -581.521430 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908387_1_1616_MLBR_RS07680: 0.000004, NC_002677_1_NP_302066_1_938_ML1525: 0.000004, NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450: 0.000004, NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880: 0.000004, NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380: 0.000004, NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908387_1_1616_MLBR_RS07680)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -581.521430 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.347222
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908387_1_1616_MLBR_RS07680: 0.000004, NC_002677_1_NP_302066_1_938_ML1525: 0.000004, NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450: 0.000004, NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880: 0.000004, NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380: 0.000004, NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.34722
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 348.5 104.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -581.521495 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.389082 1.440963 1.456209
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908387_1_1616_MLBR_RS07680: 0.000004, NC_002677_1_NP_302066_1_938_ML1525: 0.000004, NZ_LVXE01000041_1_WP_010908387_1_1842_A3216_RS10450: 0.000004, NZ_LYPH01000047_1_WP_010908387_1_1861_A8144_RS08880: 0.000004, NZ_CP029543_1_WP_010908387_1_1646_DIJ64_RS08380: 0.000004, NZ_AP014567_1_WP_010908387_1_1686_JK2ML_RS08580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.38908 q = 1.44096
(p1 = 0.00001) w = 1.45621
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00029 0.00484 0.01805 0.04321 0.08352 0.14269 0.22560 0.33979 0.49943 0.74469 1.45621
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
7..2 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
7..3 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
7..4 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
7..5 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
7..6 0.000 348.5 104.5 0.2102 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908387_1_1616_MLBR_RS07680)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:12
Model 1: NearlyNeutral -581.521522 Model 2: PositiveSelection -581.52143 Model 0: one-ratio -581.521558 Model 7: beta -581.52143 Model 8: beta&w>1 -581.521495 Model 0 vs 1 7.200000004559115E-5 Model 2 vs 1 1.83999999990192E-4 Model 8 vs 7 1.2999999989915523E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
