--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:50:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1525/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -616.90          -621.41
2       -616.91          -620.77
--------------------------------------
TOTAL     -616.90          -621.14
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894483    0.088982    0.365089    1.485967    0.869405   1363.10   1432.05    1.000
r(A<->C){all}   0.172803    0.019911    0.000018    0.463027    0.136753    215.17    236.84    1.000
r(A<->G){all}   0.163858    0.019325    0.000121    0.452071    0.125748    135.56    186.31    1.001
r(A<->T){all}   0.160598    0.020074    0.000009    0.446721    0.122674    312.81    326.21    1.004
r(C<->G){all}   0.168926    0.019854    0.000015    0.454694    0.136144    135.44    185.48    1.000
r(C<->T){all}   0.159516    0.018616    0.000026    0.430414    0.120495    194.88    261.19    1.000
r(G<->T){all}   0.174299    0.022217    0.000103    0.489285    0.133201    153.25    188.22    1.000
pi(A){all}      0.177297    0.000321    0.141687    0.211558    0.176971   1280.94   1311.03    1.001
pi(C){all}      0.307498    0.000467    0.267401    0.349752    0.307752   1208.81   1284.95    1.000
pi(G){all}      0.306920    0.000451    0.265242    0.345417    0.306859   1313.66   1366.36    1.000
pi(T){all}      0.208284    0.000361    0.171830    0.245336    0.207640   1280.70   1298.26    1.000
alpha{1,2}      0.427009    0.242398    0.000181    1.390142    0.262903   1130.49   1180.11    1.000
alpha{3}        0.450569    0.225820    0.000216    1.425669    0.303943   1282.24   1322.19    1.000
pinvar{all}     0.996386    0.000021    0.987921    0.999998    0.997747   1145.90   1241.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-581.521522
Model 2: PositiveSelection	-581.52143
Model 0: one-ratio	-581.521558
Model 7: beta	-581.52143
Model 8: beta&w>1	-581.521495


Model 0 vs 1	7.200000004559115E-5

Model 2 vs 1	1.83999999990192E-4

Model 8 vs 7	1.2999999989915523E-4
>C1
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C2
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C3
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C4
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C5
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C6
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=151 

C1              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C2              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C3              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C4              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C5              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C6              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
                **************************************************

C1              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C2              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C3              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C4              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C5              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C6              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
                **************************************************

C1              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C2              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C3              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C4              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C5              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C6              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
                **************************************************

C1              E
C2              E
C3              E
C4              E
C5              E
C6              E
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  151 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  151 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4530]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4530]--->[4530]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.467 Mb, Max= 30.685 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C2              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C3              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C4              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C5              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
C6              MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
                **************************************************

C1              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C2              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C3              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C4              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C5              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
C6              LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
                **************************************************

C1              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C2              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C3              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C4              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C5              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
C6              TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
                **************************************************

C1              E
C2              E
C3              E
C4              E
C5              E
C6              E
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C2              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C3              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C4              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C5              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
C6              ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
                **************************************************

C1              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C2              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C3              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C4              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C5              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
C6              CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
                **************************************************

C1              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C2              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C3              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C4              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C5              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
C6              GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
                **************************************************

C1              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C2              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C3              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C4              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C5              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
C6              CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
                **************************************************

C1              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C2              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C3              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C4              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C5              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
C6              GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
                **************************************************

C1              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C2              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C3              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C4              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C5              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
C6              ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
                **************************************************

C1              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C2              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C3              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C4              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C5              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
C6              ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
                **************************************************

C1              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C2              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C3              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C4              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C5              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
C6              GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
                **************************************************

C1              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C2              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C3              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C4              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C5              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
C6              TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
                **************************************************

C1              GAA
C2              GAA
C3              GAA
C4              GAA
C5              GAA
C6              GAA
                ***



>C1
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C2
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C3
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C4
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C5
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C6
ATGACTAAGACGCTGCTGGTGGTGCACCATACCCCGTCGCCGACTACCCG
CGAGCTGCTGGAGGCAGTGCTTGCCGGAGCCAACGACTCCGAGATCGACG
GTGTAGAAGTGGTTTCCCGACCGGCGCTGGCCGCGACTATCCCGGACATG
CTTAACGCCGACGGCTACTTGTTTGGCACCACCGCCAACTTCGGCTACAT
GTCCGGGGCGCTTAAGCACTTCTTTGACACCGTTTACTACCCGATTCTGG
ACCACGTGTCGGGACGTCCCTACGGCTTGTGGGTGCATGGCAACAACGAC
ACCGTCGGCGCCGCGGTCGCCGTAGGCAAGCTTGCTACCGGGTTGTCGCT
GACTCATGCTGCAGACGTCCTGGAGGTCGTCGGTCCTGTCGATGCCATGG
TGTGCGAACGAGCCCACGAATTGGGTGGCACGCTTGCCGCGATGCTAATG
GAA
>C1
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C2
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C3
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C4
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C5
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E
>C6
MTKTLLVVHHTPSPTTRELLEAVLAGANDSEIDGVEVVSRPALAATIPDM
LNADGYLFGTTANFGYMSGALKHFFDTVYYPILDHVSGRPYGLWVHGNND
TVGAAVAVGKLATGLSLTHAADVLEVVGPVDAMVCERAHELGGTLAAMLM
E


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 453 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855776
      Setting output file names to "/data/7res/ML1525/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 852429742
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5360226034
      Seed = 277974678
      Swapseed = 1579855776
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1013.835717 -- -24.965149
         Chain 2 -- -1013.835717 -- -24.965149
         Chain 3 -- -1013.835717 -- -24.965149
         Chain 4 -- -1013.835658 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1013.835717 -- -24.965149
         Chain 2 -- -1013.835717 -- -24.965149
         Chain 3 -- -1013.835658 -- -24.965149
         Chain 4 -- -1013.835717 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1013.836] (-1013.836) (-1013.836) (-1013.836) * [-1013.836] (-1013.836) (-1013.836) (-1013.836) 
        500 -- (-628.083) (-628.915) [-624.273] (-630.648) * (-632.845) [-623.807] (-630.061) (-631.654) -- 0:00:00
       1000 -- (-622.485) (-637.014) (-622.184) [-623.401] * (-632.299) [-624.594] (-627.528) (-631.129) -- 0:00:00
       1500 -- (-634.414) [-627.767] (-623.327) (-629.198) * (-627.813) (-629.578) [-626.626] (-627.698) -- 0:00:00
       2000 -- (-626.146) (-626.765) (-624.653) [-628.532] * (-632.772) (-632.072) [-625.589] (-633.167) -- 0:00:00
       2500 -- (-626.181) (-629.869) [-622.581] (-627.843) * (-626.186) (-633.516) [-624.686] (-621.366) -- 0:00:00
       3000 -- (-634.912) (-628.221) (-623.962) [-625.880] * (-621.175) (-629.376) (-627.666) [-622.804] -- 0:00:00
       3500 -- (-635.755) [-625.162] (-625.010) (-625.484) * (-627.024) (-624.240) [-624.623] (-630.918) -- 0:00:00
       4000 -- (-626.096) [-628.972] (-625.706) (-631.953) * (-634.263) (-621.375) [-627.453] (-630.357) -- 0:00:00
       4500 -- [-624.394] (-630.467) (-636.772) (-627.120) * (-624.973) [-622.118] (-634.876) (-624.299) -- 0:00:00
       5000 -- (-631.382) (-625.995) (-633.472) [-623.473] * (-624.117) [-630.934] (-631.276) (-622.228) -- 0:00:00

      Average standard deviation of split frequencies: 0.098209

       5500 -- (-639.302) [-630.750] (-624.785) (-629.562) * (-625.086) [-625.042] (-631.520) (-622.621) -- 0:00:00
       6000 -- (-627.939) (-629.556) (-624.604) [-624.373] * (-626.974) [-626.980] (-628.770) (-624.610) -- 0:00:00
       6500 -- (-628.254) [-621.558] (-633.396) (-631.953) * (-633.813) (-624.014) (-629.520) [-630.117] -- 0:00:00
       7000 -- [-628.189] (-632.574) (-634.868) (-632.624) * (-631.745) [-623.893] (-630.714) (-626.794) -- 0:00:00
       7500 -- (-625.219) (-633.820) (-629.158) [-628.330] * (-629.440) (-628.944) (-624.831) [-623.004] -- 0:00:00
       8000 -- [-624.356] (-628.002) (-629.959) (-628.284) * (-630.498) (-625.113) [-623.987] (-626.270) -- 0:00:00
       8500 -- [-622.035] (-624.717) (-631.319) (-630.447) * (-625.557) [-623.499] (-627.508) (-623.206) -- 0:00:00
       9000 -- [-626.192] (-633.849) (-629.866) (-627.422) * (-625.566) (-629.148) (-627.975) [-627.857] -- 0:00:00
       9500 -- (-626.440) (-629.668) (-622.665) [-626.895] * (-627.954) (-629.169) (-625.803) [-629.661] -- 0:00:00
      10000 -- (-633.273) (-627.012) (-632.674) [-626.286] * (-626.073) (-632.505) (-622.710) [-624.079] -- 0:00:00

      Average standard deviation of split frequencies: 0.056821

      10500 -- (-627.346) (-625.410) [-622.360] (-624.852) * [-628.403] (-629.886) (-621.441) (-624.335) -- 0:00:00
      11000 -- (-626.899) (-622.381) (-620.862) [-622.459] * (-627.822) (-624.581) (-629.581) [-625.824] -- 0:00:00
      11500 -- [-625.132] (-625.952) (-630.607) (-633.954) * (-628.694) (-628.476) (-641.274) [-625.770] -- 0:00:00
      12000 -- (-631.792) (-633.571) [-635.885] (-633.049) * (-626.972) (-635.422) [-622.600] (-628.994) -- 0:00:00
      12500 -- (-625.673) (-635.713) (-626.217) [-623.801] * (-628.743) (-625.798) (-625.190) [-625.760] -- 0:00:00
      13000 -- (-626.507) (-632.358) [-629.784] (-628.112) * (-627.678) [-620.326] (-626.529) (-632.031) -- 0:01:15
      13500 -- (-636.020) (-641.177) [-623.767] (-624.040) * (-628.102) (-626.320) [-623.933] (-627.792) -- 0:01:13
      14000 -- (-638.532) [-630.274] (-630.589) (-633.194) * (-630.205) (-627.400) [-627.076] (-621.576) -- 0:01:10
      14500 -- (-621.444) [-632.439] (-627.514) (-629.267) * (-623.689) (-626.877) (-622.813) [-624.997] -- 0:01:07
      15000 -- (-624.228) [-632.034] (-622.911) (-623.984) * [-623.675] (-635.037) (-633.739) (-626.230) -- 0:01:05

      Average standard deviation of split frequencies: 0.045831

      15500 -- (-618.758) [-626.683] (-628.968) (-625.998) * (-622.887) (-631.069) [-630.690] (-626.208) -- 0:01:03
      16000 -- [-619.672] (-632.882) (-629.766) (-627.310) * (-627.139) (-622.757) [-616.662] (-623.027) -- 0:01:01
      16500 -- (-617.777) (-628.065) [-623.624] (-627.740) * (-631.768) (-628.394) (-618.971) [-627.587] -- 0:00:59
      17000 -- (-616.582) (-636.879) (-640.504) [-631.073] * (-624.974) (-631.020) [-617.726] (-624.072) -- 0:00:57
      17500 -- (-618.021) [-616.324] (-631.743) (-635.799) * [-631.881] (-631.847) (-616.562) (-630.791) -- 0:00:56
      18000 -- (-619.204) (-616.192) (-631.876) [-623.867] * [-620.641] (-624.258) (-617.889) (-631.734) -- 0:00:54
      18500 -- [-617.236] (-619.194) (-637.098) (-631.475) * (-624.431) (-628.048) [-615.805] (-626.724) -- 0:00:53
      19000 -- (-616.780) [-617.043] (-623.931) (-634.432) * (-629.328) (-623.503) [-616.305] (-632.988) -- 0:00:51
      19500 -- [-620.977] (-619.054) (-632.293) (-627.640) * (-632.031) (-631.298) [-616.083] (-630.064) -- 0:00:50
      20000 -- (-618.285) (-615.786) (-630.468) [-630.069] * [-622.902] (-631.895) (-617.199) (-644.122) -- 0:00:49

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-615.508) [-617.121] (-622.381) (-625.583) * (-626.770) (-620.724) [-617.853] (-643.336) -- 0:00:47
      21000 -- [-616.475] (-620.915) (-624.311) (-625.275) * [-625.784] (-626.110) (-616.544) (-619.958) -- 0:00:46
      21500 -- (-616.183) [-618.340] (-627.489) (-622.340) * [-621.458] (-627.329) (-617.160) (-617.625) -- 0:00:45
      22000 -- (-620.677) (-616.771) [-623.536] (-632.011) * (-632.384) [-624.125] (-618.241) (-619.035) -- 0:00:44
      22500 -- (-620.395) [-615.965] (-628.875) (-632.986) * [-626.611] (-625.615) (-622.323) (-618.234) -- 0:00:43
      23000 -- (-621.599) [-616.064] (-628.212) (-635.005) * [-627.145] (-630.227) (-619.821) (-618.946) -- 0:00:42
      23500 -- (-615.852) (-616.968) [-624.837] (-626.640) * (-628.919) [-628.408] (-616.190) (-618.278) -- 0:00:41
      24000 -- (-618.360) (-617.596) (-626.778) [-623.993] * [-625.233] (-628.360) (-616.239) (-616.494) -- 0:00:40
      24500 -- (-617.627) (-618.379) [-621.822] (-624.994) * (-622.571) [-622.447] (-616.815) (-620.780) -- 0:00:39
      25000 -- (-618.812) [-618.577] (-647.267) (-631.436) * [-629.484] (-622.522) (-616.651) (-619.434) -- 0:00:39

      Average standard deviation of split frequencies: 0.045759

      25500 -- [-619.029] (-616.206) (-616.788) (-628.920) * (-636.305) (-632.689) (-618.536) [-617.168] -- 0:00:38
      26000 -- (-615.721) [-619.001] (-619.430) (-628.959) * [-626.011] (-623.249) (-618.256) (-616.091) -- 0:00:37
      26500 -- (-617.892) (-617.984) [-617.606] (-628.985) * (-624.168) [-619.702] (-617.462) (-616.053) -- 0:00:36
      27000 -- (-618.946) (-615.829) [-616.589] (-622.797) * (-622.900) (-620.615) (-617.621) [-617.326] -- 0:00:36
      27500 -- (-620.217) (-616.147) [-625.105] (-631.346) * (-629.975) (-619.079) [-615.314] (-618.402) -- 0:00:35
      28000 -- (-616.516) (-618.158) [-619.024] (-621.045) * (-627.521) (-618.917) (-619.300) [-617.248] -- 0:00:34
      28500 -- (-617.022) [-617.178] (-619.012) (-628.006) * [-631.832] (-618.975) (-616.545) (-618.496) -- 0:00:34
      29000 -- (-618.660) [-618.566] (-620.053) (-623.618) * (-643.981) [-616.860] (-617.729) (-617.797) -- 0:00:33
      29500 -- (-619.017) (-618.014) [-616.141] (-626.197) * (-646.516) (-619.516) (-618.734) [-618.165] -- 0:01:05
      30000 -- [-616.805] (-617.739) (-617.195) (-624.357) * (-640.223) (-615.904) [-617.216] (-618.018) -- 0:01:04

      Average standard deviation of split frequencies: 0.053436

      30500 -- (-615.925) (-616.150) (-618.621) [-625.119] * (-624.675) [-616.126] (-616.036) (-617.433) -- 0:01:03
      31000 -- (-617.551) [-618.184] (-618.084) (-624.156) * (-617.622) (-616.285) [-618.954] (-618.693) -- 0:01:02
      31500 -- (-616.724) (-617.433) [-617.572] (-626.401) * (-618.116) [-616.014] (-618.889) (-616.832) -- 0:01:01
      32000 -- (-617.915) [-616.668] (-618.801) (-630.893) * (-618.674) [-619.024] (-615.831) (-616.025) -- 0:01:00
      32500 -- (-615.787) (-616.030) (-616.575) [-623.742] * [-618.572] (-617.411) (-617.824) (-617.609) -- 0:00:59
      33000 -- (-615.998) (-619.817) (-619.001) [-625.791] * [-615.492] (-620.627) (-617.401) (-616.816) -- 0:00:58
      33500 -- (-619.096) [-616.719] (-620.679) (-627.583) * (-615.743) (-619.198) [-617.363] (-615.532) -- 0:00:57
      34000 -- [-618.211] (-616.752) (-617.419) (-623.016) * [-616.728] (-617.684) (-616.801) (-621.371) -- 0:00:56
      34500 -- [-619.171] (-618.734) (-616.546) (-626.451) * (-616.942) [-616.658] (-620.268) (-619.401) -- 0:00:55
      35000 -- (-617.495) (-618.908) (-622.894) [-623.609] * (-616.968) (-617.205) (-619.570) [-617.076] -- 0:00:55

      Average standard deviation of split frequencies: 0.041778

      35500 -- (-616.105) (-619.857) [-619.444] (-624.565) * (-616.810) [-617.275] (-618.057) (-620.150) -- 0:00:54
      36000 -- [-617.580] (-621.654) (-619.680) (-623.841) * (-619.011) (-617.798) [-617.143] (-628.428) -- 0:00:53
      36500 -- [-619.106] (-617.519) (-620.902) (-626.179) * (-621.533) (-616.155) [-616.147] (-619.547) -- 0:00:52
      37000 -- (-618.546) [-618.016] (-619.447) (-631.051) * (-620.840) (-617.009) (-617.043) [-623.795] -- 0:00:52
      37500 -- [-616.373] (-617.065) (-618.706) (-624.574) * (-620.179) (-618.564) (-617.481) [-617.339] -- 0:00:51
      38000 -- [-617.046] (-616.805) (-617.871) (-633.617) * (-617.622) [-616.942] (-616.853) (-616.038) -- 0:00:50
      38500 -- (-618.497) (-616.596) (-616.058) [-627.252] * (-618.349) [-617.695] (-616.316) (-619.611) -- 0:00:49
      39000 -- [-620.169] (-615.658) (-616.694) (-625.225) * [-620.116] (-618.724) (-616.503) (-616.942) -- 0:00:49
      39500 -- (-618.345) (-617.027) [-620.946] (-635.184) * (-617.801) (-617.543) [-618.903] (-617.657) -- 0:00:48
      40000 -- [-618.816] (-617.522) (-616.737) (-624.513) * [-618.085] (-617.650) (-617.356) (-616.092) -- 0:00:48

      Average standard deviation of split frequencies: 0.038436

      40500 -- [-619.428] (-618.754) (-620.282) (-634.089) * (-616.108) [-618.150] (-616.820) (-617.702) -- 0:00:47
      41000 -- (-618.366) (-621.109) [-619.579] (-629.396) * (-615.821) (-617.197) [-616.800] (-615.603) -- 0:00:46
      41500 -- [-616.973] (-621.458) (-615.842) (-627.106) * [-617.176] (-617.861) (-616.960) (-617.212) -- 0:00:46
      42000 -- [-616.612] (-619.717) (-616.634) (-626.451) * (-617.086) (-616.335) [-618.929] (-615.833) -- 0:00:45
      42500 -- (-616.541) (-621.343) [-616.486] (-625.938) * (-616.246) (-618.755) [-619.450] (-616.083) -- 0:00:45
      43000 -- (-617.014) [-618.116] (-616.429) (-625.014) * (-617.570) [-615.389] (-618.499) (-617.021) -- 0:00:44
      43500 -- (-618.933) (-616.586) [-616.001] (-628.523) * (-620.388) (-616.012) (-621.633) [-616.571] -- 0:00:43
      44000 -- [-616.160] (-617.857) (-616.123) (-633.989) * (-615.717) [-618.615] (-619.761) (-616.897) -- 0:00:43
      44500 -- (-615.763) (-616.231) [-616.431] (-629.153) * [-616.772] (-617.832) (-618.481) (-616.512) -- 0:00:42
      45000 -- [-618.018] (-620.517) (-616.729) (-634.034) * (-616.042) [-617.517] (-619.271) (-618.295) -- 0:01:03

      Average standard deviation of split frequencies: 0.035402

      45500 -- (-617.255) [-620.551] (-616.495) (-627.890) * [-620.407] (-622.373) (-618.112) (-616.396) -- 0:01:02
      46000 -- (-615.587) [-619.805] (-616.735) (-622.759) * (-617.183) [-618.023] (-618.725) (-615.765) -- 0:01:02
      46500 -- (-621.778) (-618.865) [-617.175] (-627.945) * (-621.882) (-619.445) (-616.760) [-619.405] -- 0:01:01
      47000 -- [-617.360] (-619.452) (-618.304) (-638.761) * (-622.258) [-617.680] (-617.888) (-618.544) -- 0:01:00
      47500 -- [-617.062] (-619.855) (-619.471) (-622.063) * (-621.495) (-621.307) [-617.296] (-620.397) -- 0:01:00
      48000 -- (-618.245) [-616.788] (-617.303) (-620.163) * (-618.168) (-617.204) [-616.392] (-619.067) -- 0:00:59
      48500 -- (-620.224) (-615.817) (-616.027) [-616.282] * (-616.961) [-618.548] (-617.978) (-616.554) -- 0:00:58
      49000 -- (-618.172) (-619.320) [-616.991] (-620.713) * (-617.924) (-617.747) (-618.651) [-615.513] -- 0:00:58
      49500 -- [-618.986] (-620.504) (-617.640) (-617.070) * (-616.799) (-622.109) (-619.245) [-615.962] -- 0:00:57
      50000 -- [-619.862] (-616.996) (-621.775) (-615.872) * (-620.559) (-617.903) [-619.461] (-615.705) -- 0:00:57

      Average standard deviation of split frequencies: 0.027447

      50500 -- (-620.883) (-617.920) (-616.559) [-617.861] * [-617.493] (-620.713) (-618.898) (-619.055) -- 0:00:56
      51000 -- (-620.379) (-619.102) (-618.412) [-616.424] * [-620.086] (-618.900) (-622.385) (-621.064) -- 0:00:55
      51500 -- [-619.080] (-616.783) (-618.299) (-617.937) * [-618.962] (-619.943) (-618.719) (-619.143) -- 0:00:55
      52000 -- (-617.880) (-619.473) (-620.773) [-616.303] * [-617.255] (-617.164) (-619.813) (-617.759) -- 0:00:54
      52500 -- [-617.249] (-619.655) (-619.051) (-618.111) * (-619.261) (-616.875) [-618.283] (-618.772) -- 0:00:54
      53000 -- (-617.467) (-617.030) [-619.068] (-618.066) * (-618.493) (-617.396) (-618.520) [-618.078] -- 0:00:53
      53500 -- [-619.106] (-619.171) (-618.824) (-619.064) * (-619.550) (-620.918) [-616.924] (-618.019) -- 0:00:53
      54000 -- (-618.201) (-620.975) (-617.705) [-615.644] * (-620.218) (-620.482) (-619.452) [-615.951] -- 0:00:52
      54500 -- (-617.320) (-619.793) [-619.128] (-616.225) * (-618.390) (-618.737) (-618.677) [-615.526] -- 0:00:52
      55000 -- (-620.910) (-617.032) (-625.020) [-615.660] * (-617.757) (-616.288) (-622.340) [-617.787] -- 0:00:51

      Average standard deviation of split frequencies: 0.022596

      55500 -- (-620.647) (-617.894) [-617.112] (-621.536) * (-616.472) [-617.662] (-620.351) (-617.076) -- 0:00:51
      56000 -- [-619.394] (-617.414) (-617.517) (-617.880) * (-617.523) [-618.682] (-622.133) (-616.722) -- 0:00:50
      56500 -- [-618.185] (-618.876) (-617.014) (-619.067) * (-617.342) (-615.556) (-617.121) [-616.788] -- 0:00:50
      57000 -- (-620.719) [-615.657] (-617.452) (-618.042) * [-624.421] (-616.624) (-623.266) (-619.028) -- 0:00:49
      57500 -- [-620.236] (-618.493) (-618.098) (-619.823) * [-621.470] (-617.298) (-619.292) (-617.577) -- 0:00:49
      58000 -- (-622.420) [-617.245] (-618.139) (-617.916) * (-615.592) [-617.521] (-618.139) (-618.346) -- 0:00:48
      58500 -- (-617.524) (-619.615) [-618.095] (-619.343) * [-617.196] (-622.369) (-616.532) (-617.234) -- 0:00:48
      59000 -- (-616.903) (-616.912) (-618.652) [-619.880] * (-618.549) (-617.042) (-621.892) [-616.856] -- 0:00:47
      59500 -- (-620.674) (-616.693) (-617.483) [-616.306] * [-617.392] (-618.229) (-618.310) (-616.188) -- 0:00:47
      60000 -- [-617.285] (-616.521) (-615.677) (-616.629) * [-615.510] (-619.944) (-618.175) (-617.247) -- 0:00:47

      Average standard deviation of split frequencies: 0.024283

      60500 -- (-618.069) [-618.890] (-618.251) (-618.138) * (-617.144) [-617.095] (-618.404) (-616.352) -- 0:01:02
      61000 -- (-617.821) (-616.746) [-618.464] (-616.897) * (-618.488) (-615.924) (-617.338) [-616.193] -- 0:01:01
      61500 -- (-616.373) (-615.866) [-618.264] (-617.991) * [-619.870] (-618.149) (-617.136) (-615.288) -- 0:01:01
      62000 -- (-616.562) (-616.686) (-618.818) [-617.700] * (-618.042) (-617.108) (-616.438) [-618.896] -- 0:01:00
      62500 -- (-616.533) (-615.611) [-617.467] (-616.914) * (-618.729) (-616.241) [-616.304] (-616.399) -- 0:01:00
      63000 -- (-617.101) (-618.639) [-616.422] (-619.043) * (-617.246) (-617.856) [-615.791] (-619.840) -- 0:00:59
      63500 -- [-619.433] (-617.857) (-616.517) (-616.813) * (-619.875) (-616.198) (-617.974) [-617.575] -- 0:00:58
      64000 -- (-619.232) [-617.055] (-619.005) (-618.067) * (-618.564) (-618.317) [-617.470] (-616.795) -- 0:00:58
      64500 -- (-618.588) (-617.962) (-617.134) [-620.400] * (-620.249) (-617.281) [-617.549] (-622.605) -- 0:00:58
      65000 -- (-618.106) [-620.254] (-617.187) (-619.680) * (-619.623) (-615.746) [-618.465] (-618.807) -- 0:00:57

      Average standard deviation of split frequencies: 0.023468

      65500 -- (-618.270) (-620.176) (-617.447) [-617.759] * (-618.651) (-620.274) (-621.535) [-618.149] -- 0:00:57
      66000 -- (-617.507) [-615.914] (-619.201) (-617.779) * (-615.580) (-618.500) (-617.455) [-618.280] -- 0:00:56
      66500 -- (-618.029) (-616.190) (-619.061) [-616.561] * (-617.002) (-617.184) (-618.556) [-616.408] -- 0:00:56
      67000 -- (-616.542) [-616.864] (-618.767) (-622.830) * (-619.677) [-616.366] (-619.956) (-616.456) -- 0:00:55
      67500 -- (-615.685) [-616.155] (-616.785) (-618.466) * (-616.752) (-615.921) (-616.458) [-616.215] -- 0:00:55
      68000 -- (-616.071) (-616.841) [-616.443] (-617.414) * (-617.505) [-619.897] (-616.458) (-619.988) -- 0:00:54
      68500 -- (-617.889) [-616.165] (-616.335) (-619.182) * (-617.847) (-617.740) (-617.420) [-618.123] -- 0:00:54
      69000 -- (-618.961) (-619.257) (-616.254) [-616.269] * [-617.001] (-619.927) (-616.856) (-616.302) -- 0:00:53
      69500 -- (-619.823) [-617.914] (-616.508) (-616.074) * (-617.348) (-618.372) [-618.143] (-617.096) -- 0:00:53
      70000 -- (-617.671) [-617.267] (-616.607) (-616.579) * [-618.110] (-617.248) (-616.101) (-617.960) -- 0:00:53

      Average standard deviation of split frequencies: 0.021347

      70500 -- (-619.230) (-618.993) [-615.883] (-617.895) * [-616.713] (-621.638) (-615.827) (-619.331) -- 0:00:52
      71000 -- (-617.301) [-615.901] (-617.005) (-618.497) * (-616.414) [-617.967] (-615.505) (-618.026) -- 0:00:52
      71500 -- (-617.543) (-617.444) (-617.014) [-619.237] * (-618.354) [-618.054] (-617.423) (-619.660) -- 0:00:51
      72000 -- (-620.377) (-619.537) (-617.310) [-619.538] * (-619.339) [-616.696] (-616.472) (-619.514) -- 0:00:51
      72500 -- (-622.109) [-617.810] (-620.018) (-617.869) * [-616.759] (-616.979) (-619.056) (-618.525) -- 0:00:51
      73000 -- (-618.471) (-621.673) [-615.897] (-618.542) * (-617.134) [-621.397] (-616.694) (-617.697) -- 0:00:50
      73500 -- [-618.415] (-618.157) (-618.848) (-617.358) * (-620.741) [-615.984] (-616.517) (-619.157) -- 0:00:50
      74000 -- (-618.308) (-618.469) (-619.766) [-617.668] * (-618.970) [-618.408] (-616.422) (-617.609) -- 0:00:50
      74500 -- (-617.454) (-617.580) [-619.992] (-618.058) * (-621.272) (-618.196) [-616.497] (-618.693) -- 0:00:49
      75000 -- (-616.353) [-615.927] (-619.171) (-616.799) * (-622.775) [-616.716] (-617.236) (-620.800) -- 0:00:49

      Average standard deviation of split frequencies: 0.020469

      75500 -- [-617.725] (-616.581) (-618.591) (-616.389) * [-618.465] (-618.178) (-618.565) (-616.775) -- 0:00:48
      76000 -- (-622.470) (-617.141) (-617.400) [-616.317] * (-617.290) (-617.942) (-617.308) [-617.219] -- 0:00:48
      76500 -- [-616.591] (-617.807) (-615.530) (-616.969) * (-617.388) (-616.348) (-617.424) [-618.963] -- 0:01:00
      77000 -- (-616.950) [-616.834] (-616.593) (-620.227) * (-619.340) (-616.634) (-620.238) [-616.345] -- 0:00:59
      77500 -- (-618.423) [-619.401] (-617.091) (-618.230) * (-617.659) (-615.691) [-625.598] (-619.046) -- 0:00:59
      78000 -- [-617.832] (-616.718) (-617.026) (-621.481) * [-616.298] (-618.434) (-617.710) (-619.791) -- 0:00:59
      78500 -- (-616.593) (-615.859) (-617.042) [-616.889] * (-617.318) (-618.288) [-617.604] (-621.154) -- 0:00:58
      79000 -- (-617.796) (-617.550) (-615.616) [-618.235] * [-617.171] (-616.481) (-616.940) (-619.940) -- 0:00:58
      79500 -- (-618.400) (-620.362) (-617.805) [-616.636] * (-615.787) (-615.849) (-616.979) [-616.003] -- 0:00:57
      80000 -- (-618.569) (-620.090) [-619.011] (-618.096) * (-616.792) [-615.811] (-617.492) (-617.058) -- 0:00:57

      Average standard deviation of split frequencies: 0.024349

      80500 -- (-620.011) [-616.113] (-616.551) (-620.523) * [-617.787] (-617.430) (-618.246) (-619.949) -- 0:00:57
      81000 -- [-619.966] (-619.083) (-621.595) (-621.113) * (-616.144) (-617.417) [-616.472] (-617.190) -- 0:00:56
      81500 -- [-619.642] (-620.359) (-616.571) (-619.956) * (-617.744) (-615.686) (-616.052) [-617.055] -- 0:00:56
      82000 -- [-617.619] (-617.411) (-616.164) (-620.034) * [-616.972] (-616.247) (-619.032) (-618.289) -- 0:00:55
      82500 -- [-617.854] (-620.335) (-617.479) (-616.352) * [-616.557] (-618.045) (-617.297) (-618.307) -- 0:00:55
      83000 -- (-618.300) (-617.613) (-624.264) [-619.783] * (-616.618) (-620.727) (-618.145) [-616.968] -- 0:00:55
      83500 -- (-616.647) (-616.538) [-617.622] (-616.411) * (-621.095) (-619.678) (-615.434) [-615.709] -- 0:00:54
      84000 -- [-616.365] (-618.390) (-615.952) (-616.272) * (-617.927) [-620.338] (-615.719) (-622.046) -- 0:00:54
      84500 -- (-617.062) (-616.259) [-617.847] (-617.730) * [-617.592] (-616.128) (-615.724) (-616.511) -- 0:00:54
      85000 -- (-618.468) [-621.478] (-616.371) (-617.867) * (-620.560) [-616.227] (-621.186) (-617.842) -- 0:00:53

      Average standard deviation of split frequencies: 0.024392

      85500 -- (-622.647) (-620.941) (-616.360) [-618.490] * (-619.189) (-617.922) (-617.102) [-615.398] -- 0:00:53
      86000 -- [-617.107] (-617.996) (-617.970) (-618.243) * (-618.734) (-618.338) (-619.449) [-616.470] -- 0:00:53
      86500 -- (-619.383) [-616.578] (-615.560) (-620.283) * (-617.486) (-615.662) (-618.891) [-616.775] -- 0:00:52
      87000 -- (-620.191) (-619.133) (-616.260) [-615.729] * [-615.935] (-616.984) (-621.614) (-617.433) -- 0:00:52
      87500 -- (-622.547) [-620.077] (-618.120) (-620.334) * (-617.255) (-617.709) [-616.553] (-618.279) -- 0:00:52
      88000 -- (-618.040) (-620.463) (-617.963) [-617.165] * (-617.287) (-618.404) [-615.737] (-618.489) -- 0:00:51
      88500 -- (-617.782) [-619.617] (-621.013) (-617.396) * (-616.753) (-618.180) (-616.118) [-619.731] -- 0:00:51
      89000 -- (-616.787) [-617.853] (-616.676) (-616.127) * (-618.414) [-616.945] (-616.271) (-616.778) -- 0:00:51
      89500 -- (-617.315) (-618.479) (-618.565) [-617.894] * [-616.008] (-616.215) (-617.599) (-616.728) -- 0:00:50
      90000 -- (-620.201) [-618.624] (-617.560) (-620.509) * (-617.611) [-616.636] (-617.294) (-616.716) -- 0:00:50

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-618.774) [-615.958] (-617.382) (-617.749) * (-617.741) [-616.744] (-626.419) (-618.084) -- 0:00:50
      91000 -- (-618.147) (-617.558) [-619.078] (-623.539) * (-618.685) [-621.041] (-618.757) (-615.561) -- 0:00:49
      91500 -- (-619.493) (-617.131) [-616.603] (-622.991) * (-617.693) (-617.719) [-616.510] (-616.960) -- 0:00:49
      92000 -- (-616.949) (-618.208) [-617.079] (-619.145) * [-617.710] (-617.710) (-615.257) (-617.129) -- 0:00:49
      92500 -- (-619.687) [-615.771] (-616.792) (-622.357) * (-620.536) (-618.182) [-616.733] (-617.432) -- 0:00:49
      93000 -- (-615.657) (-615.904) [-616.641] (-620.669) * (-616.454) (-620.710) [-618.021] (-618.804) -- 0:00:48
      93500 -- [-616.475] (-617.767) (-617.353) (-621.600) * [-618.666] (-621.888) (-617.792) (-617.602) -- 0:00:58
      94000 -- (-617.887) (-617.027) (-618.040) [-618.888] * [-618.512] (-621.958) (-616.245) (-616.326) -- 0:00:57
      94500 -- (-617.523) (-621.050) (-617.637) [-621.710] * (-617.775) [-620.362] (-617.701) (-615.643) -- 0:00:57
      95000 -- [-616.560] (-617.468) (-621.845) (-624.049) * (-618.612) (-617.143) [-615.566] (-617.611) -- 0:00:57

      Average standard deviation of split frequencies: 0.025289

      95500 -- (-616.320) (-616.044) (-619.469) [-623.921] * [-616.331] (-616.731) (-615.797) (-622.953) -- 0:00:56
      96000 -- (-616.425) (-621.930) (-615.166) [-619.418] * (-618.172) [-620.475] (-616.059) (-616.325) -- 0:00:56
      96500 -- [-619.710] (-620.682) (-619.930) (-618.785) * (-617.197) (-617.809) (-616.877) [-619.994] -- 0:00:56
      97000 -- [-617.102] (-615.535) (-620.747) (-616.341) * (-615.889) (-620.304) (-617.451) [-617.984] -- 0:00:55
      97500 -- (-620.765) [-621.434] (-618.837) (-618.337) * (-616.409) (-617.272) [-616.114] (-618.704) -- 0:00:55
      98000 -- (-617.279) (-616.739) [-616.516] (-617.607) * [-617.593] (-615.456) (-618.350) (-619.354) -- 0:00:55
      98500 -- (-619.962) [-617.922] (-617.815) (-616.356) * (-617.580) (-616.715) [-617.879] (-618.710) -- 0:00:54
      99000 -- (-623.012) [-618.740] (-616.343) (-620.392) * (-615.750) [-615.247] (-616.875) (-618.830) -- 0:00:54
      99500 -- [-619.793] (-618.056) (-618.019) (-617.656) * (-616.328) [-615.681] (-615.449) (-620.993) -- 0:00:54
      100000 -- [-616.523] (-617.072) (-617.492) (-617.029) * (-616.894) (-616.181) [-616.669] (-619.690) -- 0:00:54

      Average standard deviation of split frequencies: 0.023168

      100500 -- (-615.849) (-620.537) [-620.849] (-619.018) * [-616.171] (-616.222) (-616.669) (-621.455) -- 0:00:53
      101000 -- (-616.207) (-617.174) (-618.989) [-616.706] * (-616.542) [-616.496] (-616.710) (-621.050) -- 0:00:53
      101500 -- (-617.532) [-617.151] (-618.417) (-618.378) * [-615.462] (-619.287) (-617.012) (-618.275) -- 0:00:53
      102000 -- (-618.613) (-615.571) (-615.589) [-616.801] * [-617.173] (-618.517) (-617.067) (-619.346) -- 0:00:52
      102500 -- (-619.088) (-616.614) [-617.256] (-615.971) * (-620.681) [-617.653] (-619.131) (-619.435) -- 0:00:52
      103000 -- [-616.421] (-617.914) (-616.337) (-620.769) * (-616.604) [-616.328] (-616.472) (-617.668) -- 0:00:52
      103500 -- (-617.882) [-617.416] (-620.035) (-619.536) * (-621.020) [-616.523] (-616.556) (-617.542) -- 0:00:51
      104000 -- (-619.841) (-616.087) [-616.824] (-617.113) * [-618.379] (-616.587) (-615.696) (-622.440) -- 0:00:51
      104500 -- (-618.600) (-617.432) (-616.506) [-617.045] * [-620.062] (-616.630) (-615.565) (-616.194) -- 0:00:51
      105000 -- (-616.813) (-617.511) [-616.464] (-617.503) * [-618.284] (-617.314) (-617.352) (-619.218) -- 0:00:51

      Average standard deviation of split frequencies: 0.021177

      105500 -- [-616.854] (-616.901) (-617.939) (-621.813) * [-617.561] (-616.559) (-616.235) (-617.825) -- 0:00:50
      106000 -- (-618.874) (-615.512) (-617.523) [-619.055] * (-618.137) (-617.291) [-616.849] (-620.636) -- 0:00:50
      106500 -- (-616.329) (-618.189) [-626.943] (-617.901) * [-617.367] (-617.396) (-618.086) (-624.309) -- 0:00:50
      107000 -- [-615.895] (-615.942) (-619.341) (-618.595) * (-616.319) (-618.032) (-615.346) [-618.156] -- 0:00:50
      107500 -- (-616.580) (-617.399) [-617.471] (-618.881) * (-621.126) (-618.115) (-617.964) [-617.693] -- 0:00:49
      108000 -- (-616.863) [-618.354] (-618.033) (-618.693) * (-618.329) (-617.987) [-618.484] (-617.851) -- 0:00:49
      108500 -- (-615.713) [-619.815] (-620.701) (-616.799) * [-617.913] (-617.033) (-616.277) (-617.107) -- 0:00:49
      109000 -- (-616.647) (-620.045) (-620.222) [-617.417] * [-618.592] (-618.226) (-615.698) (-619.638) -- 0:00:49
      109500 -- (-617.288) (-616.311) (-619.268) [-618.850] * (-621.885) [-616.680] (-616.756) (-616.132) -- 0:00:48
      110000 -- (-617.640) (-616.839) (-616.562) [-619.127] * (-619.414) (-617.581) (-617.688) [-615.457] -- 0:00:56

      Average standard deviation of split frequencies: 0.023124

      110500 -- (-618.114) (-616.941) [-619.840] (-616.384) * [-618.370] (-617.791) (-616.397) (-616.352) -- 0:00:56
      111000 -- (-618.761) (-616.037) (-617.034) [-616.055] * (-620.652) (-618.575) (-620.490) [-618.195] -- 0:00:56
      111500 -- (-618.678) (-617.330) [-617.766] (-617.341) * (-621.038) (-617.576) [-618.059] (-617.540) -- 0:00:55
      112000 -- (-619.570) [-618.373] (-621.547) (-619.064) * (-618.220) (-618.126) (-617.373) [-615.534] -- 0:00:55
      112500 -- (-616.529) (-617.198) [-616.179] (-622.919) * (-618.236) (-618.344) (-620.575) [-616.087] -- 0:00:55
      113000 -- (-616.035) (-618.325) (-617.299) [-616.516] * (-616.658) (-618.452) [-618.245] (-616.058) -- 0:00:54
      113500 -- (-619.032) (-617.616) (-618.137) [-619.191] * (-617.775) [-618.080] (-620.373) (-615.854) -- 0:00:54
      114000 -- [-617.419] (-616.817) (-617.817) (-617.898) * (-619.774) (-616.635) (-621.201) [-615.806] -- 0:00:54
      114500 -- (-618.146) [-617.641] (-616.823) (-617.769) * (-618.216) [-616.643] (-617.335) (-617.445) -- 0:00:54
      115000 -- (-617.148) [-617.468] (-616.828) (-617.154) * (-616.238) (-617.396) (-621.468) [-617.082] -- 0:00:53

      Average standard deviation of split frequencies: 0.022448

      115500 -- (-617.632) [-617.443] (-615.509) (-616.388) * (-615.989) [-616.851] (-622.257) (-616.459) -- 0:00:53
      116000 -- (-618.117) (-616.926) (-619.673) [-616.411] * (-615.752) [-616.494] (-618.511) (-615.748) -- 0:00:53
      116500 -- (-617.638) (-618.337) (-616.255) [-617.407] * (-615.310) (-616.084) (-616.596) [-616.779] -- 0:00:53
      117000 -- [-617.035] (-618.411) (-617.844) (-617.587) * (-618.340) [-616.074] (-617.255) (-616.960) -- 0:00:52
      117500 -- (-617.399) (-622.538) (-615.719) [-616.475] * [-617.880] (-619.681) (-617.181) (-616.857) -- 0:00:52
      118000 -- [-620.714] (-618.220) (-616.645) (-616.241) * (-616.577) (-625.429) [-617.637] (-616.603) -- 0:00:52
      118500 -- (-616.985) [-616.232] (-620.562) (-617.767) * (-617.653) (-617.315) (-617.021) [-617.003] -- 0:00:52
      119000 -- (-618.834) [-616.155] (-616.670) (-617.157) * (-617.042) (-616.832) (-617.700) [-616.828] -- 0:00:51
      119500 -- (-620.664) [-618.090] (-615.576) (-620.470) * (-617.689) [-616.867] (-616.940) (-616.261) -- 0:00:51
      120000 -- (-616.486) (-619.590) [-615.647] (-620.063) * (-618.843) [-617.199] (-617.059) (-616.769) -- 0:00:51

      Average standard deviation of split frequencies: 0.023234

      120500 -- (-616.016) (-617.171) (-617.815) [-619.334] * (-619.324) (-615.373) (-615.936) [-615.916] -- 0:00:51
      121000 -- (-620.662) [-617.295] (-619.794) (-621.501) * [-616.878] (-621.645) (-616.159) (-616.308) -- 0:00:50
      121500 -- (-617.260) [-618.032] (-616.263) (-617.770) * [-620.241] (-617.430) (-617.483) (-617.339) -- 0:00:50
      122000 -- [-615.927] (-617.816) (-616.914) (-617.026) * (-619.806) (-620.800) [-615.905] (-619.153) -- 0:00:50
      122500 -- (-617.581) (-620.840) [-618.371] (-616.729) * (-621.645) [-616.692] (-619.556) (-620.320) -- 0:00:50
      123000 -- (-618.397) (-618.303) (-618.481) [-618.377] * (-617.760) (-616.398) [-617.776] (-618.989) -- 0:00:49
      123500 -- (-617.516) [-620.075] (-617.964) (-616.160) * (-621.235) [-616.593] (-616.621) (-616.748) -- 0:00:49
      124000 -- (-618.273) [-620.117] (-616.075) (-616.758) * (-617.396) [-616.326] (-618.582) (-617.270) -- 0:00:49
      124500 -- (-619.390) [-616.526] (-616.130) (-617.087) * (-616.298) (-617.412) [-616.090] (-623.859) -- 0:00:49
      125000 -- (-617.155) [-615.901] (-618.541) (-615.801) * [-617.809] (-616.934) (-616.129) (-617.965) -- 0:00:49

      Average standard deviation of split frequencies: 0.022788

      125500 -- (-618.664) (-617.339) [-617.835] (-617.222) * (-616.778) (-616.108) (-617.263) [-617.664] -- 0:00:48
      126000 -- (-618.170) (-619.919) (-619.713) [-616.658] * (-616.474) (-615.742) [-618.136] (-616.725) -- 0:00:48
      126500 -- (-616.868) (-617.248) (-619.323) [-619.153] * (-615.861) (-616.871) (-618.986) [-617.413] -- 0:00:48
      127000 -- (-619.142) [-616.341] (-627.707) (-618.635) * (-617.578) [-617.921] (-615.832) (-616.910) -- 0:00:54
      127500 -- (-616.941) (-616.231) (-619.291) [-617.410] * (-620.151) (-618.763) (-616.332) [-618.830] -- 0:00:54
      128000 -- (-616.249) (-617.787) [-617.486] (-618.328) * [-620.235] (-617.199) (-620.025) (-619.078) -- 0:00:54
      128500 -- (-619.129) [-618.821] (-616.224) (-621.164) * [-618.699] (-618.396) (-617.784) (-621.660) -- 0:00:54
      129000 -- (-616.240) (-616.853) [-616.286] (-619.019) * (-615.907) [-617.018] (-617.832) (-624.223) -- 0:00:54
      129500 -- [-615.345] (-616.523) (-618.133) (-622.608) * (-622.842) (-619.019) (-618.522) [-618.749] -- 0:00:53
      130000 -- (-615.932) (-617.526) [-616.286] (-618.953) * (-616.014) [-617.544] (-616.710) (-619.492) -- 0:00:53

      Average standard deviation of split frequencies: 0.022333

      130500 -- [-615.763] (-618.413) (-618.780) (-617.911) * [-616.456] (-616.398) (-616.334) (-618.915) -- 0:00:53
      131000 -- (-616.515) (-617.225) (-617.347) [-620.565] * (-617.128) (-620.387) (-616.756) [-618.747] -- 0:00:53
      131500 -- (-617.039) (-618.116) (-620.672) [-617.250] * [-621.456] (-619.656) (-616.756) (-618.971) -- 0:00:52
      132000 -- (-619.768) [-616.441] (-617.936) (-616.152) * (-616.724) [-616.328] (-616.199) (-617.182) -- 0:00:52
      132500 -- (-620.081) [-618.111] (-616.636) (-617.991) * (-624.971) [-616.278] (-617.738) (-617.069) -- 0:00:52
      133000 -- (-621.386) (-616.557) (-616.772) [-622.398] * (-620.178) (-621.016) (-618.450) [-619.391] -- 0:00:52
      133500 -- [-617.465] (-616.453) (-620.021) (-617.199) * [-618.794] (-616.198) (-618.887) (-619.597) -- 0:00:51
      134000 -- (-618.422) (-619.536) (-623.824) [-616.145] * [-617.659] (-618.120) (-618.130) (-618.474) -- 0:00:51
      134500 -- (-617.539) (-616.320) (-619.462) [-620.471] * (-619.291) (-617.232) [-616.611] (-617.336) -- 0:00:51
      135000 -- (-618.660) [-616.783] (-619.384) (-618.642) * (-618.981) [-615.563] (-618.048) (-616.379) -- 0:00:51

      Average standard deviation of split frequencies: 0.020797

      135500 -- [-616.841] (-618.886) (-617.070) (-618.507) * (-617.126) [-615.764] (-617.329) (-619.484) -- 0:00:51
      136000 -- (-617.335) (-617.602) [-618.601] (-626.549) * (-617.842) (-618.437) (-620.953) [-617.758] -- 0:00:50
      136500 -- (-616.637) (-617.500) (-617.017) [-619.868] * [-618.807] (-616.888) (-620.164) (-617.560) -- 0:00:50
      137000 -- [-616.310] (-617.781) (-621.501) (-621.204) * (-617.160) (-619.414) (-619.826) [-618.558] -- 0:00:50
      137500 -- (-617.222) (-620.222) (-622.925) [-617.329] * [-617.223] (-620.255) (-615.990) (-616.874) -- 0:00:50
      138000 -- (-617.218) [-617.080] (-617.165) (-617.841) * (-617.652) (-616.561) (-616.741) [-616.528] -- 0:00:49
      138500 -- (-618.038) (-616.630) (-616.411) [-616.952] * [-620.909] (-616.935) (-615.784) (-615.589) -- 0:00:49
      139000 -- (-619.418) (-619.351) (-617.444) [-619.752] * (-621.772) (-617.221) [-616.209] (-616.639) -- 0:00:49
      139500 -- (-617.025) (-617.833) (-620.941) [-618.255] * (-618.795) (-615.232) [-616.003] (-616.279) -- 0:00:49
      140000 -- (-616.423) (-616.733) [-619.645] (-617.692) * (-618.030) [-619.251] (-616.716) (-615.880) -- 0:00:49

      Average standard deviation of split frequencies: 0.020989

      140500 -- (-616.160) [-619.573] (-617.844) (-617.245) * (-617.038) [-620.380] (-619.153) (-618.558) -- 0:00:48
      141000 -- (-615.915) [-618.310] (-615.946) (-618.447) * (-618.807) [-617.776] (-616.640) (-617.025) -- 0:00:48
      141500 -- (-616.352) (-620.495) [-616.582] (-621.060) * [-622.914] (-617.297) (-616.429) (-618.404) -- 0:00:48
      142000 -- (-618.507) [-617.241] (-617.354) (-616.117) * (-621.461) [-617.148] (-616.549) (-618.462) -- 0:00:48
      142500 -- (-620.319) (-617.002) [-617.494] (-616.472) * (-615.460) [-616.364] (-618.386) (-618.421) -- 0:00:48
      143000 -- [-616.980] (-617.709) (-619.608) (-616.945) * [-616.212] (-617.730) (-616.835) (-618.917) -- 0:00:47
      143500 -- (-619.668) (-616.663) (-616.873) [-617.173] * (-616.275) [-615.931] (-616.771) (-619.413) -- 0:00:53
      144000 -- [-616.652] (-615.820) (-617.112) (-618.297) * (-618.370) (-618.780) [-616.292] (-616.260) -- 0:00:53
      144500 -- (-617.804) [-617.394] (-616.700) (-620.660) * (-621.645) [-617.037] (-618.062) (-616.021) -- 0:00:53
      145000 -- [-617.208] (-617.523) (-621.575) (-619.297) * (-619.792) [-616.270] (-617.582) (-618.284) -- 0:00:53

      Average standard deviation of split frequencies: 0.018727

      145500 -- (-616.494) (-616.175) [-619.342] (-619.833) * (-618.945) (-617.082) [-617.694] (-615.939) -- 0:00:52
      146000 -- (-623.519) (-618.325) [-617.006] (-618.727) * (-621.390) (-617.650) (-617.754) [-621.804] -- 0:00:52
      146500 -- (-618.889) [-617.473] (-616.652) (-619.655) * (-618.722) [-617.231] (-617.545) (-620.543) -- 0:00:52
      147000 -- (-617.490) (-616.211) [-617.835] (-619.778) * [-615.699] (-615.808) (-618.994) (-616.164) -- 0:00:52
      147500 -- [-615.819] (-617.303) (-617.445) (-618.053) * [-618.625] (-615.966) (-617.355) (-616.612) -- 0:00:52
      148000 -- (-616.511) (-617.538) (-617.400) [-620.578] * (-619.485) [-616.809] (-616.334) (-616.984) -- 0:00:51
      148500 -- (-615.684) [-623.631] (-617.902) (-620.215) * (-619.144) (-617.268) (-617.972) [-620.384] -- 0:00:51
      149000 -- [-617.228] (-618.816) (-617.257) (-620.412) * (-619.410) (-616.357) [-616.336] (-620.395) -- 0:00:51
      149500 -- (-620.154) (-619.413) (-616.855) [-617.475] * (-619.826) [-617.244] (-618.236) (-620.812) -- 0:00:51
      150000 -- (-616.340) [-615.967] (-616.685) (-618.212) * (-619.338) (-617.969) (-616.611) [-619.825] -- 0:00:51

      Average standard deviation of split frequencies: 0.018773

      150500 -- (-616.356) [-618.142] (-616.026) (-619.124) * (-619.395) (-620.924) [-616.793] (-619.510) -- 0:00:50
      151000 -- (-616.757) (-618.388) [-617.941] (-623.755) * (-623.042) (-616.598) [-617.222] (-617.008) -- 0:00:50
      151500 -- (-618.663) (-617.334) [-616.443] (-620.835) * (-618.199) (-617.598) (-620.107) [-618.052] -- 0:00:50
      152000 -- (-616.356) (-617.546) [-616.704] (-618.218) * (-617.439) [-617.427] (-617.434) (-616.601) -- 0:00:50
      152500 -- (-618.165) (-624.116) [-617.691] (-618.963) * (-616.941) (-621.314) [-617.227] (-616.159) -- 0:00:50
      153000 -- (-616.489) (-620.594) [-621.875] (-616.884) * [-616.803] (-617.588) (-618.822) (-622.781) -- 0:00:49
      153500 -- (-618.030) [-616.708] (-620.165) (-619.374) * (-616.396) (-618.237) [-620.787] (-620.017) -- 0:00:49
      154000 -- (-616.217) (-617.763) (-616.526) [-617.000] * [-615.687] (-618.062) (-617.701) (-619.436) -- 0:00:49
      154500 -- (-617.117) (-616.995) [-621.880] (-618.430) * (-617.343) [-616.952] (-617.631) (-616.657) -- 0:00:49
      155000 -- (-616.172) (-615.850) (-616.282) [-621.172] * (-619.264) [-618.787] (-616.113) (-616.155) -- 0:00:49

      Average standard deviation of split frequencies: 0.019085

      155500 -- (-617.184) [-616.592] (-616.478) (-620.699) * [-616.736] (-618.969) (-616.953) (-616.561) -- 0:00:48
      156000 -- (-617.431) (-615.659) [-616.850] (-620.584) * (-619.959) [-617.432] (-616.289) (-616.079) -- 0:00:48
      156500 -- (-616.514) (-617.958) [-616.792] (-616.412) * (-618.766) [-617.434] (-619.031) (-617.929) -- 0:00:48
      157000 -- (-616.911) (-616.061) [-620.199] (-616.258) * (-615.599) (-618.041) [-616.590] (-619.003) -- 0:00:48
      157500 -- (-618.085) [-617.040] (-615.411) (-616.894) * (-615.389) (-618.227) (-617.598) [-619.538] -- 0:00:48
      158000 -- (-617.716) [-616.151] (-617.004) (-619.949) * (-616.614) (-623.101) [-617.876] (-624.437) -- 0:00:47
      158500 -- [-619.866] (-618.403) (-619.324) (-616.827) * (-616.670) (-618.704) [-619.028] (-617.768) -- 0:00:47
      159000 -- [-618.514] (-619.586) (-617.887) (-616.348) * (-617.117) [-617.900] (-617.135) (-616.425) -- 0:00:47
      159500 -- (-617.492) (-620.411) (-618.595) [-617.540] * [-617.221] (-617.744) (-615.669) (-616.494) -- 0:00:47
      160000 -- (-616.358) (-615.624) (-618.292) [-616.970] * (-617.253) (-616.368) [-617.224] (-619.856) -- 0:00:47

      Average standard deviation of split frequencies: 0.016789

      160500 -- (-619.673) (-619.692) [-617.092] (-616.534) * (-616.477) (-616.777) [-618.015] (-617.549) -- 0:00:52
      161000 -- (-617.019) (-618.122) [-615.916] (-619.701) * (-619.354) (-619.558) [-618.283] (-619.097) -- 0:00:52
      161500 -- (-617.635) [-617.617] (-615.699) (-620.357) * (-619.983) (-617.224) [-618.206] (-618.183) -- 0:00:51
      162000 -- (-623.690) (-618.585) [-615.532] (-619.034) * (-617.974) (-618.125) [-617.430] (-616.206) -- 0:00:51
      162500 -- (-619.896) (-617.543) (-615.918) [-615.649] * (-616.739) [-616.456] (-619.750) (-616.922) -- 0:00:51
      163000 -- (-617.036) (-623.029) (-620.410) [-618.252] * (-618.664) [-617.992] (-617.644) (-615.350) -- 0:00:51
      163500 -- (-616.382) [-620.109] (-620.432) (-618.297) * (-617.968) (-615.384) [-616.922] (-615.579) -- 0:00:51
      164000 -- [-616.876] (-615.827) (-619.880) (-621.083) * (-619.494) [-615.554] (-618.824) (-623.622) -- 0:00:50
      164500 -- (-616.876) [-616.166] (-618.321) (-618.379) * [-616.490] (-616.980) (-615.955) (-617.647) -- 0:00:50
      165000 -- (-619.691) [-616.037] (-616.080) (-617.730) * (-616.546) [-616.600] (-617.044) (-620.876) -- 0:00:50

      Average standard deviation of split frequencies: 0.019131

      165500 -- (-618.264) (-617.130) [-616.576] (-619.089) * (-615.565) (-616.243) (-616.485) [-617.679] -- 0:00:50
      166000 -- (-617.795) (-615.844) [-615.767] (-619.715) * (-616.747) (-616.007) [-618.192] (-617.300) -- 0:00:50
      166500 -- (-618.499) [-616.068] (-617.360) (-620.266) * (-616.776) (-617.831) [-621.119] (-616.624) -- 0:00:50
      167000 -- (-616.229) (-617.780) [-616.694] (-621.819) * (-616.490) (-617.608) (-618.921) [-619.451] -- 0:00:49
      167500 -- [-616.685] (-616.577) (-617.184) (-619.561) * (-619.037) (-616.435) [-622.035] (-616.699) -- 0:00:49
      168000 -- (-616.091) (-617.841) [-615.941] (-620.370) * (-618.199) (-619.212) (-616.952) [-616.302] -- 0:00:49
      168500 -- (-618.045) (-618.695) [-616.845] (-621.034) * [-615.945] (-618.179) (-616.541) (-619.357) -- 0:00:49
      169000 -- [-616.893] (-618.542) (-620.870) (-620.537) * [-615.552] (-616.486) (-619.112) (-620.040) -- 0:00:49
      169500 -- (-617.826) [-617.848] (-619.078) (-617.611) * (-619.723) [-615.687] (-621.604) (-618.500) -- 0:00:48
      170000 -- [-619.078] (-617.871) (-616.591) (-616.836) * (-622.145) (-616.201) [-620.127] (-616.654) -- 0:00:48

      Average standard deviation of split frequencies: 0.019949

      170500 -- [-617.325] (-621.309) (-617.778) (-617.583) * (-616.562) (-617.036) (-621.158) [-616.316] -- 0:00:48
      171000 -- (-619.961) (-620.486) [-618.191] (-619.422) * (-617.942) [-616.023] (-617.978) (-615.331) -- 0:00:48
      171500 -- [-619.862] (-616.640) (-618.228) (-618.048) * (-617.866) [-616.891] (-616.231) (-615.331) -- 0:00:48
      172000 -- (-621.122) (-616.942) [-617.019] (-616.534) * (-618.205) [-618.737] (-615.863) (-616.553) -- 0:00:48
      172500 -- (-621.163) (-617.035) (-616.547) [-617.002] * (-617.583) (-621.713) [-618.128] (-616.784) -- 0:00:47
      173000 -- [-618.274] (-616.830) (-617.731) (-620.601) * [-617.778] (-622.143) (-619.744) (-617.197) -- 0:00:47
      173500 -- [-618.520] (-616.638) (-623.384) (-618.834) * (-618.012) [-617.591] (-620.436) (-615.510) -- 0:00:47
      174000 -- (-617.621) (-616.764) [-623.021] (-619.836) * (-617.601) (-618.556) (-617.913) [-617.121] -- 0:00:47
      174500 -- (-616.766) (-617.732) (-617.734) [-617.126] * (-617.321) (-622.986) (-618.095) [-616.300] -- 0:00:47
      175000 -- (-619.095) [-617.791] (-615.746) (-619.201) * (-619.017) (-619.417) [-618.028] (-615.651) -- 0:00:47

      Average standard deviation of split frequencies: 0.020683

      175500 -- (-616.867) (-618.313) (-615.297) [-616.657] * (-616.978) (-619.514) [-615.816] (-617.718) -- 0:00:46
      176000 -- (-616.291) (-616.776) [-617.658] (-617.045) * (-618.262) (-622.483) [-618.521] (-617.704) -- 0:00:46
      176500 -- [-615.935] (-616.612) (-617.457) (-617.288) * (-617.711) [-618.499] (-616.699) (-617.249) -- 0:00:46
      177000 -- (-619.724) (-619.352) (-616.950) [-619.236] * (-617.497) [-618.608] (-616.413) (-621.131) -- 0:00:46
      177500 -- (-616.763) [-618.240] (-620.084) (-616.364) * (-617.268) [-618.862] (-619.547) (-621.038) -- 0:00:50
      178000 -- (-620.435) (-616.335) (-620.203) [-615.880] * (-618.847) (-616.258) [-616.555] (-616.855) -- 0:00:50
      178500 -- (-622.886) (-616.365) [-617.205] (-617.070) * (-616.772) [-616.729] (-617.804) (-618.788) -- 0:00:50
      179000 -- (-617.637) (-615.956) (-619.828) [-615.960] * (-618.127) [-619.871] (-617.894) (-617.577) -- 0:00:50
      179500 -- (-616.218) (-615.783) [-618.973] (-618.515) * (-618.278) (-617.404) (-617.090) [-617.697] -- 0:00:50
      180000 -- (-616.483) [-615.955] (-616.991) (-617.062) * [-616.363] (-617.298) (-616.902) (-617.187) -- 0:00:50

      Average standard deviation of split frequencies: 0.021309

      180500 -- (-615.905) [-616.333] (-617.437) (-616.914) * (-618.534) [-616.331] (-621.294) (-615.783) -- 0:00:49
      181000 -- [-616.678] (-616.479) (-616.745) (-620.170) * [-617.639] (-620.240) (-619.219) (-616.132) -- 0:00:49
      181500 -- [-616.379] (-617.423) (-619.988) (-620.556) * [-618.024] (-621.220) (-617.368) (-616.726) -- 0:00:49
      182000 -- (-617.920) (-617.965) [-619.191] (-618.353) * (-617.583) (-617.901) (-615.456) [-616.768] -- 0:00:49
      182500 -- (-621.815) [-616.584] (-618.264) (-615.585) * (-619.548) [-619.406] (-620.088) (-618.099) -- 0:00:49
      183000 -- (-618.797) (-615.635) [-616.163] (-616.343) * (-615.966) (-620.009) (-619.950) [-617.967] -- 0:00:49
      183500 -- (-617.095) [-617.143] (-617.484) (-615.426) * (-615.985) [-619.422] (-616.877) (-619.274) -- 0:00:48
      184000 -- (-617.130) (-616.619) (-619.454) [-615.670] * (-615.959) (-620.075) [-616.411] (-618.912) -- 0:00:48
      184500 -- (-617.165) [-619.025] (-623.522) (-619.103) * [-619.782] (-615.626) (-616.064) (-618.811) -- 0:00:48
      185000 -- [-617.208] (-616.847) (-618.739) (-620.160) * (-617.346) (-616.954) [-616.987] (-617.580) -- 0:00:48

      Average standard deviation of split frequencies: 0.023077

      185500 -- (-616.501) (-622.199) (-620.995) [-617.308] * (-619.861) (-618.204) (-619.597) [-616.680] -- 0:00:48
      186000 -- (-617.847) (-624.166) (-616.974) [-616.209] * [-616.902] (-618.692) (-617.113) (-617.164) -- 0:00:48
      186500 -- (-618.305) (-617.648) [-620.646] (-621.904) * [-618.772] (-618.678) (-620.568) (-621.194) -- 0:00:47
      187000 -- (-616.599) (-622.300) [-619.508] (-617.212) * [-619.734] (-619.608) (-618.235) (-621.804) -- 0:00:47
      187500 -- (-617.084) (-617.997) [-617.439] (-617.120) * [-616.878] (-616.996) (-622.394) (-623.912) -- 0:00:47
      188000 -- (-616.263) [-618.803] (-617.900) (-616.870) * (-619.323) (-616.402) (-618.377) [-618.507] -- 0:00:47
      188500 -- [-618.155] (-617.316) (-621.069) (-621.677) * (-618.411) [-616.036] (-616.096) (-617.337) -- 0:00:47
      189000 -- (-615.974) (-617.412) [-616.465] (-621.520) * (-618.656) (-615.664) [-616.211] (-616.171) -- 0:00:47
      189500 -- (-616.850) [-617.967] (-616.176) (-617.660) * (-620.659) [-618.028] (-615.984) (-617.072) -- 0:00:47
      190000 -- [-617.418] (-617.630) (-617.338) (-616.196) * [-617.896] (-618.411) (-618.144) (-617.728) -- 0:00:46

      Average standard deviation of split frequencies: 0.023213

      190500 -- [-616.241] (-617.158) (-618.521) (-617.032) * [-617.397] (-620.213) (-616.739) (-619.054) -- 0:00:46
      191000 -- (-616.812) (-617.695) [-622.014] (-617.330) * (-616.999) [-619.993] (-616.918) (-616.019) -- 0:00:46
      191500 -- (-617.481) [-617.485] (-622.005) (-621.240) * [-617.692] (-619.952) (-619.637) (-617.688) -- 0:00:46
      192000 -- [-616.235] (-618.661) (-618.633) (-618.264) * [-617.141] (-615.678) (-619.510) (-617.164) -- 0:00:46
      192500 -- (-621.377) (-617.485) [-617.768] (-617.757) * (-616.326) (-616.977) (-619.699) [-616.910] -- 0:00:46
      193000 -- [-619.052] (-617.212) (-616.133) (-616.345) * [-615.795] (-616.520) (-621.545) (-617.268) -- 0:00:45
      193500 -- (-617.447) (-618.077) [-616.850] (-618.367) * (-617.968) (-617.677) [-615.851] (-617.303) -- 0:00:45
      194000 -- (-617.499) [-618.319] (-620.121) (-617.706) * (-619.127) [-620.820] (-617.871) (-616.483) -- 0:00:49
      194500 -- (-615.822) (-616.448) (-617.398) [-619.303] * (-619.929) (-616.960) [-618.668] (-615.394) -- 0:00:49
      195000 -- [-617.838] (-618.304) (-620.267) (-617.651) * (-621.830) [-617.326] (-618.795) (-626.171) -- 0:00:49

      Average standard deviation of split frequencies: 0.020887

      195500 -- (-619.473) (-616.897) [-618.269] (-618.092) * (-623.010) (-618.964) (-617.082) [-620.800] -- 0:00:49
      196000 -- (-621.270) [-616.157] (-617.069) (-617.482) * [-618.391] (-618.261) (-617.129) (-618.547) -- 0:00:49
      196500 -- [-619.405] (-616.388) (-617.066) (-617.620) * (-618.790) [-617.176] (-617.749) (-618.896) -- 0:00:49
      197000 -- (-620.922) [-617.112] (-618.206) (-621.939) * (-621.733) (-617.257) [-617.396] (-617.128) -- 0:00:48
      197500 -- (-618.030) (-619.529) (-616.051) [-615.607] * [-620.012] (-620.615) (-617.827) (-618.932) -- 0:00:48
      198000 -- (-616.873) (-621.465) [-617.704] (-616.258) * (-618.245) (-618.020) (-616.113) [-618.490] -- 0:00:48
      198500 -- (-616.233) (-619.711) [-617.947] (-618.602) * [-616.009] (-616.038) (-616.732) (-616.936) -- 0:00:48
      199000 -- [-616.156] (-617.443) (-616.150) (-618.062) * (-621.273) (-627.313) (-616.736) [-617.347] -- 0:00:48
      199500 -- (-616.003) (-619.031) (-615.386) [-616.989] * (-618.264) (-618.159) (-620.336) [-615.617] -- 0:00:48
      200000 -- [-615.934] (-616.040) (-615.622) (-618.867) * [-617.844] (-617.249) (-619.487) (-617.777) -- 0:00:48

      Average standard deviation of split frequencies: 0.020321

      200500 -- (-620.410) (-616.050) (-615.766) [-617.789] * (-620.486) [-616.157] (-617.166) (-616.071) -- 0:00:47
      201000 -- (-617.303) (-616.058) [-615.440] (-616.771) * [-620.782] (-616.118) (-617.104) (-619.149) -- 0:00:47
      201500 -- [-617.508] (-616.932) (-616.120) (-615.654) * [-620.153] (-616.143) (-618.304) (-618.559) -- 0:00:47
      202000 -- (-618.818) [-617.301] (-619.342) (-617.631) * (-617.232) (-617.571) (-616.626) [-617.348] -- 0:00:47
      202500 -- (-616.990) [-617.044] (-617.875) (-618.834) * (-618.835) (-620.338) [-620.265] (-616.970) -- 0:00:47
      203000 -- [-617.562] (-617.958) (-618.233) (-618.864) * [-616.489] (-621.807) (-618.015) (-615.640) -- 0:00:47
      203500 -- [-615.959] (-618.402) (-621.212) (-617.118) * (-619.003) (-616.618) [-618.004] (-617.671) -- 0:00:46
      204000 -- [-616.265] (-616.351) (-620.916) (-615.209) * (-619.805) [-617.380] (-616.804) (-617.889) -- 0:00:46
      204500 -- (-616.718) (-621.027) [-616.665] (-615.555) * (-617.927) [-616.416] (-617.152) (-617.788) -- 0:00:46
      205000 -- (-617.291) (-619.014) [-616.223] (-616.313) * (-617.896) [-617.234] (-617.364) (-617.537) -- 0:00:46

      Average standard deviation of split frequencies: 0.018765

      205500 -- (-618.015) (-620.328) [-616.320] (-617.708) * (-618.151) (-616.951) [-617.088] (-617.338) -- 0:00:46
      206000 -- [-617.910] (-619.314) (-615.642) (-617.085) * (-620.455) [-616.806] (-620.188) (-620.340) -- 0:00:46
      206500 -- (-615.304) (-617.567) (-617.628) [-615.336] * [-619.059] (-617.126) (-621.303) (-622.667) -- 0:00:46
      207000 -- (-618.192) (-622.107) [-618.226] (-617.065) * (-616.364) (-620.603) (-615.710) [-616.974] -- 0:00:45
      207500 -- (-616.297) [-619.795] (-617.329) (-619.371) * (-616.007) (-623.060) (-616.378) [-615.366] -- 0:00:45
      208000 -- (-617.266) [-620.641] (-616.173) (-616.497) * [-615.544] (-617.890) (-619.191) (-615.572) -- 0:00:45
      208500 -- (-617.194) (-617.696) [-619.180] (-617.045) * (-618.437) (-618.728) (-620.234) [-619.102] -- 0:00:45
      209000 -- (-616.174) (-619.484) [-618.553] (-619.585) * (-618.188) (-623.091) (-618.136) [-620.025] -- 0:00:45
      209500 -- (-618.938) (-625.859) [-618.680] (-622.665) * (-618.133) (-619.104) [-619.840] (-617.421) -- 0:00:45
      210000 -- (-619.648) (-618.199) (-616.695) [-618.296] * (-619.193) [-619.655] (-618.833) (-617.659) -- 0:00:45

      Average standard deviation of split frequencies: 0.016606

      210500 -- [-622.275] (-618.364) (-618.752) (-619.072) * (-617.692) (-616.316) (-617.157) [-618.900] -- 0:00:45
      211000 -- (-617.724) [-616.757] (-618.514) (-617.460) * (-619.449) (-616.806) [-620.606] (-617.288) -- 0:00:48
      211500 -- (-622.139) [-616.028] (-618.330) (-619.099) * (-616.625) (-618.559) (-615.422) [-615.532] -- 0:00:48
      212000 -- (-617.967) [-617.121] (-616.728) (-617.092) * (-619.526) (-616.080) [-616.466] (-615.861) -- 0:00:48
      212500 -- (-621.819) (-617.254) (-616.766) [-615.980] * (-616.502) (-615.714) [-616.008] (-618.765) -- 0:00:48
      213000 -- (-617.488) [-618.028] (-617.103) (-616.959) * (-617.859) (-615.547) (-615.418) [-616.492] -- 0:00:48
      213500 -- (-618.664) (-617.077) (-616.675) [-617.448] * (-617.137) (-616.476) (-616.064) [-616.280] -- 0:00:47
      214000 -- (-620.308) (-620.565) [-615.840] (-617.401) * (-620.537) (-616.690) (-617.956) [-617.544] -- 0:00:47
      214500 -- (-617.201) (-622.959) (-621.255) [-617.092] * (-621.557) (-620.801) [-616.202] (-617.707) -- 0:00:47
      215000 -- (-617.147) (-619.323) [-615.787] (-615.359) * [-624.958] (-616.771) (-616.897) (-615.789) -- 0:00:47

      Average standard deviation of split frequencies: 0.016247

      215500 -- [-616.916] (-619.738) (-616.706) (-616.391) * [-619.516] (-620.226) (-616.552) (-621.445) -- 0:00:47
      216000 -- (-619.417) (-616.928) [-617.435] (-615.773) * [-619.642] (-618.860) (-616.033) (-616.478) -- 0:00:47
      216500 -- (-618.064) (-616.553) [-618.616] (-620.035) * (-618.637) (-617.674) [-618.947] (-620.206) -- 0:00:47
      217000 -- (-615.526) (-617.870) [-619.444] (-618.211) * (-617.056) (-616.450) (-621.060) [-616.308] -- 0:00:46
      217500 -- (-616.778) [-617.101] (-615.457) (-616.714) * (-619.480) [-615.570] (-620.467) (-616.958) -- 0:00:46
      218000 -- (-615.990) [-617.516] (-619.781) (-616.640) * (-619.304) [-615.293] (-619.471) (-618.027) -- 0:00:46
      218500 -- (-616.231) (-617.476) (-616.816) [-619.892] * [-616.189] (-617.187) (-617.067) (-617.639) -- 0:00:46
      219000 -- [-616.229] (-619.012) (-619.060) (-617.261) * (-615.894) [-615.976] (-617.394) (-616.175) -- 0:00:46
      219500 -- (-615.960) (-619.640) [-616.843] (-617.393) * (-616.743) (-615.738) (-618.222) [-619.303] -- 0:00:46
      220000 -- [-615.937] (-618.911) (-619.857) (-616.255) * (-615.687) (-617.408) [-619.189] (-618.153) -- 0:00:46

      Average standard deviation of split frequencies: 0.016865

      220500 -- (-616.267) [-616.822] (-618.792) (-618.545) * (-616.928) (-619.977) (-617.446) [-617.909] -- 0:00:45
      221000 -- [-615.434] (-616.326) (-618.506) (-618.375) * [-616.903] (-616.269) (-618.583) (-617.964) -- 0:00:45
      221500 -- (-615.625) [-619.243] (-616.992) (-618.599) * (-616.847) (-616.962) (-615.809) [-617.076] -- 0:00:45
      222000 -- (-616.955) [-617.075] (-617.560) (-616.609) * (-619.380) (-617.778) [-618.846] (-616.624) -- 0:00:45
      222500 -- (-618.140) (-617.493) [-617.704] (-620.598) * (-620.823) (-621.488) [-617.500] (-619.091) -- 0:00:45
      223000 -- (-616.445) (-623.739) (-617.271) [-616.961] * (-620.639) [-617.034] (-618.364) (-618.952) -- 0:00:45
      223500 -- (-623.100) [-619.923] (-618.783) (-616.786) * [-617.838] (-620.650) (-619.601) (-618.453) -- 0:00:45
      224000 -- [-619.231] (-620.037) (-623.036) (-618.010) * (-619.956) (-618.334) (-620.847) [-617.602] -- 0:00:45
      224500 -- (-617.748) [-618.409] (-620.538) (-617.213) * [-617.078] (-623.127) (-615.557) (-617.025) -- 0:00:44
      225000 -- (-618.488) [-618.432] (-619.975) (-616.442) * (-619.249) (-621.189) [-616.042] (-617.450) -- 0:00:44

      Average standard deviation of split frequencies: 0.016797

      225500 -- (-616.358) [-619.159] (-618.670) (-616.253) * (-616.340) (-618.096) (-616.647) [-616.985] -- 0:00:44
      226000 -- (-616.877) (-624.098) (-622.962) [-616.175] * [-617.973] (-618.093) (-619.497) (-618.193) -- 0:00:44
      226500 -- [-615.879] (-619.270) (-618.894) (-618.203) * (-618.064) (-618.017) (-616.183) [-619.602] -- 0:00:44
      227000 -- [-619.809] (-618.407) (-618.879) (-617.497) * (-618.363) [-619.271] (-619.513) (-617.551) -- 0:00:44
      227500 -- (-618.148) (-618.087) [-617.978] (-621.647) * (-617.445) (-620.350) [-619.266] (-619.742) -- 0:00:47
      228000 -- (-616.461) (-619.515) [-617.766] (-624.933) * (-615.864) (-617.390) [-620.854] (-621.071) -- 0:00:47
      228500 -- (-617.256) (-617.121) [-616.750] (-620.305) * (-618.686) [-616.048] (-616.919) (-618.675) -- 0:00:47
      229000 -- (-615.951) (-616.372) [-619.586] (-616.157) * (-616.625) (-620.921) (-620.280) [-616.714] -- 0:00:47
      229500 -- [-617.309] (-617.942) (-624.261) (-617.005) * (-622.363) (-618.008) [-616.454] (-616.829) -- 0:00:47
      230000 -- (-619.150) [-617.317] (-622.672) (-616.227) * [-617.064] (-617.079) (-618.134) (-616.159) -- 0:00:46

      Average standard deviation of split frequencies: 0.017258

      230500 -- [-616.331] (-617.542) (-617.988) (-616.545) * (-617.589) [-616.113] (-617.953) (-616.015) -- 0:00:46
      231000 -- [-616.917] (-617.077) (-617.559) (-619.185) * (-623.620) (-617.116) (-616.102) [-615.988] -- 0:00:46
      231500 -- (-621.698) (-620.324) [-616.423] (-617.817) * (-623.680) [-617.081] (-616.337) (-618.692) -- 0:00:46
      232000 -- (-618.184) (-617.673) (-620.810) [-621.720] * (-616.828) (-620.927) (-615.863) [-615.785] -- 0:00:46
      232500 -- (-615.749) [-616.809] (-618.808) (-617.256) * (-615.935) (-620.125) [-616.382] (-618.278) -- 0:00:46
      233000 -- (-618.385) (-616.919) (-616.805) [-615.585] * (-617.702) (-618.441) (-616.783) [-618.587] -- 0:00:46
      233500 -- (-620.345) (-618.695) (-617.539) [-616.150] * [-616.463] (-616.613) (-616.233) (-618.802) -- 0:00:45
      234000 -- (-617.927) (-618.160) (-616.126) [-616.063] * (-616.552) [-616.326] (-616.354) (-616.644) -- 0:00:45
      234500 -- [-616.040] (-617.128) (-616.122) (-617.245) * (-618.848) [-617.165] (-617.617) (-617.312) -- 0:00:45
      235000 -- [-616.265] (-616.576) (-615.898) (-617.359) * [-616.457] (-617.981) (-616.440) (-616.856) -- 0:00:45

      Average standard deviation of split frequencies: 0.015536

      235500 -- (-616.736) (-616.085) (-616.691) [-619.348] * (-617.798) [-617.035] (-616.178) (-617.267) -- 0:00:45
      236000 -- (-618.413) (-617.162) (-616.276) [-616.173] * (-616.209) (-616.881) (-616.122) [-618.207] -- 0:00:45
      236500 -- (-616.115) (-615.860) [-617.856] (-616.212) * (-617.896) (-618.410) [-616.148] (-619.407) -- 0:00:45
      237000 -- (-618.720) (-616.519) (-617.244) [-616.215] * (-617.387) (-617.920) (-616.505) [-619.187] -- 0:00:45
      237500 -- (-617.714) (-618.317) [-617.046] (-619.428) * (-617.956) (-618.524) [-619.152] (-619.485) -- 0:00:44
      238000 -- [-617.623] (-617.138) (-617.721) (-618.608) * (-615.810) [-618.786] (-616.790) (-617.026) -- 0:00:44
      238500 -- (-619.796) (-617.934) [-617.070] (-628.815) * (-618.561) (-618.516) [-617.354] (-618.978) -- 0:00:44
      239000 -- (-620.016) [-617.284] (-617.422) (-617.340) * [-616.436] (-618.140) (-616.858) (-617.558) -- 0:00:44
      239500 -- (-624.254) [-617.857] (-618.364) (-617.146) * (-620.908) [-621.092] (-621.585) (-617.177) -- 0:00:44
      240000 -- (-616.899) (-618.290) [-615.945] (-618.046) * [-621.945] (-619.790) (-621.211) (-618.103) -- 0:00:44

      Average standard deviation of split frequencies: 0.015979

      240500 -- (-618.281) (-618.363) (-617.014) [-616.927] * (-616.768) (-618.936) [-618.337] (-620.171) -- 0:00:44
      241000 -- (-617.120) (-616.713) (-616.720) [-616.889] * [-616.913] (-616.951) (-617.685) (-616.775) -- 0:00:44
      241500 -- (-615.932) [-617.961] (-617.298) (-618.172) * (-617.568) (-616.903) (-620.452) [-618.019] -- 0:00:43
      242000 -- (-621.912) (-616.433) [-617.401] (-618.923) * [-619.506] (-619.049) (-617.630) (-620.224) -- 0:00:43
      242500 -- (-616.865) (-616.066) [-619.649] (-619.454) * (-619.785) [-616.564] (-619.175) (-619.766) -- 0:00:43
      243000 -- (-619.304) (-615.770) [-615.884] (-615.966) * (-617.097) (-617.083) [-618.201] (-616.595) -- 0:00:43
      243500 -- [-616.245] (-616.498) (-616.116) (-616.269) * (-617.762) [-619.289] (-617.658) (-615.930) -- 0:00:46
      244000 -- (-618.000) [-616.523] (-617.338) (-617.380) * (-615.782) (-616.078) (-616.163) [-617.146] -- 0:00:46
      244500 -- [-618.736] (-617.162) (-618.144) (-618.035) * (-617.736) [-615.924] (-616.394) (-617.623) -- 0:00:46
      245000 -- (-618.902) [-617.174] (-617.554) (-616.427) * [-616.912] (-617.544) (-616.184) (-618.007) -- 0:00:46

      Average standard deviation of split frequencies: 0.015734

      245500 -- (-617.978) [-619.004] (-619.918) (-616.334) * (-618.731) (-615.406) [-617.597] (-618.093) -- 0:00:46
      246000 -- (-617.111) (-618.609) (-617.575) [-616.643] * (-617.767) [-616.206] (-621.712) (-615.734) -- 0:00:45
      246500 -- (-615.361) [-617.644] (-620.429) (-619.348) * (-615.907) (-617.709) (-617.572) [-617.541] -- 0:00:45
      247000 -- [-617.707] (-616.624) (-617.874) (-617.725) * (-618.040) (-618.993) [-617.053] (-615.646) -- 0:00:45
      247500 -- (-618.348) (-617.901) [-615.800] (-617.471) * (-616.468) [-618.949] (-618.859) (-621.239) -- 0:00:45
      248000 -- (-617.665) (-616.633) [-619.346] (-616.958) * (-622.927) (-619.005) (-619.805) [-616.458] -- 0:00:45
      248500 -- (-617.323) [-618.855] (-617.848) (-616.747) * [-618.539] (-623.056) (-617.181) (-617.256) -- 0:00:45
      249000 -- (-618.349) [-616.196] (-616.144) (-617.284) * [-620.261] (-621.357) (-619.853) (-615.940) -- 0:00:45
      249500 -- [-617.005] (-617.512) (-615.790) (-617.573) * (-621.573) [-618.625] (-616.169) (-616.092) -- 0:00:45
      250000 -- (-618.058) (-618.778) (-618.064) [-617.963] * [-616.480] (-616.995) (-617.341) (-618.934) -- 0:00:45

      Average standard deviation of split frequencies: 0.016716

      250500 -- (-617.136) [-617.476] (-619.853) (-623.595) * (-621.389) (-618.272) (-617.316) [-616.821] -- 0:00:44
      251000 -- (-615.684) (-617.083) (-618.136) [-619.359] * [-618.011] (-620.405) (-616.406) (-617.640) -- 0:00:44
      251500 -- [-617.740] (-620.249) (-616.755) (-620.740) * (-616.048) (-619.177) [-617.015] (-616.852) -- 0:00:44
      252000 -- [-618.332] (-618.702) (-616.598) (-620.380) * (-615.946) [-616.951] (-621.935) (-618.019) -- 0:00:44
      252500 -- (-618.936) [-616.479] (-615.942) (-620.889) * [-617.230] (-622.018) (-617.689) (-617.410) -- 0:00:44
      253000 -- (-615.576) [-615.803] (-618.963) (-618.307) * (-616.310) [-620.980] (-616.378) (-616.591) -- 0:00:44
      253500 -- (-615.578) (-617.577) (-619.015) [-618.015] * (-615.930) (-617.470) (-617.597) [-617.105] -- 0:00:44
      254000 -- (-619.127) (-617.432) [-617.602] (-616.651) * (-619.474) [-616.092] (-621.863) (-617.861) -- 0:00:44
      254500 -- [-617.707] (-616.513) (-617.974) (-618.075) * [-618.274] (-616.102) (-620.965) (-617.299) -- 0:00:43
      255000 -- [-617.079] (-615.782) (-621.228) (-618.251) * (-616.662) [-616.102] (-617.760) (-619.815) -- 0:00:43

      Average standard deviation of split frequencies: 0.017494

      255500 -- (-618.290) (-618.188) [-623.508] (-617.245) * [-616.300] (-616.112) (-616.011) (-621.893) -- 0:00:43
      256000 -- [-615.986] (-617.829) (-628.644) (-615.593) * [-619.029] (-616.680) (-620.397) (-621.005) -- 0:00:43
      256500 -- [-617.658] (-617.999) (-618.034) (-615.628) * (-617.490) [-618.692] (-619.077) (-618.092) -- 0:00:43
      257000 -- [-616.993] (-618.729) (-619.461) (-616.526) * (-616.739) [-617.119] (-616.851) (-618.936) -- 0:00:43
      257500 -- [-617.658] (-616.899) (-620.745) (-617.644) * [-616.110] (-621.945) (-617.969) (-615.414) -- 0:00:43
      258000 -- [-617.149] (-621.609) (-616.425) (-622.608) * (-616.557) (-616.916) (-615.958) [-617.300] -- 0:00:43
      258500 -- (-620.001) (-619.893) (-616.805) [-623.030] * (-617.541) (-618.640) (-616.299) [-619.234] -- 0:00:43
      259000 -- (-619.379) (-618.517) [-617.328] (-617.334) * (-616.677) [-618.463] (-616.424) (-616.579) -- 0:00:42
      259500 -- (-615.647) [-616.266] (-617.888) (-616.193) * (-616.925) (-618.276) [-617.399] (-616.295) -- 0:00:42
      260000 -- (-615.559) [-616.742] (-617.938) (-618.673) * [-617.650] (-616.565) (-616.918) (-621.268) -- 0:00:42

      Average standard deviation of split frequencies: 0.016808

      260500 -- [-616.558] (-616.163) (-618.351) (-617.062) * [-616.443] (-617.140) (-616.597) (-616.001) -- 0:00:45
      261000 -- [-618.728] (-617.773) (-615.707) (-616.655) * [-617.130] (-618.627) (-618.013) (-618.836) -- 0:00:45
      261500 -- [-618.306] (-620.181) (-616.628) (-618.008) * (-615.865) (-620.745) (-619.461) [-615.729] -- 0:00:45
      262000 -- (-617.275) (-617.725) (-616.921) [-618.893] * (-616.333) (-618.745) [-617.304] (-616.684) -- 0:00:45
      262500 -- (-616.510) [-617.147] (-619.989) (-619.573) * [-615.961] (-619.203) (-618.286) (-616.194) -- 0:00:44
      263000 -- (-618.868) [-616.235] (-623.170) (-619.305) * [-616.532] (-618.254) (-617.843) (-616.336) -- 0:00:44
      263500 -- [-618.636] (-618.060) (-616.963) (-616.088) * [-618.860] (-616.113) (-615.804) (-615.957) -- 0:00:44
      264000 -- (-616.372) (-617.111) [-619.145] (-621.214) * (-618.378) (-617.971) (-617.425) [-617.088] -- 0:00:44
      264500 -- (-616.618) (-617.007) (-617.895) [-618.632] * [-616.318] (-619.961) (-618.003) (-618.770) -- 0:00:44
      265000 -- (-618.141) [-617.289] (-619.051) (-616.201) * (-619.055) [-616.771] (-618.396) (-615.903) -- 0:00:44

      Average standard deviation of split frequencies: 0.016934

      265500 -- (-619.358) [-618.483] (-615.642) (-616.086) * (-615.760) (-617.252) [-616.107] (-618.815) -- 0:00:44
      266000 -- [-617.225] (-617.582) (-617.144) (-617.650) * (-618.742) (-617.313) (-616.436) [-616.007] -- 0:00:44
      266500 -- (-615.589) (-617.544) (-620.946) [-621.065] * [-616.377] (-616.556) (-615.351) (-618.687) -- 0:00:44
      267000 -- (-618.086) (-616.108) [-617.391] (-618.169) * [-620.022] (-620.483) (-618.891) (-618.768) -- 0:00:43
      267500 -- (-622.429) (-618.854) (-615.738) [-617.644] * [-617.288] (-617.979) (-617.713) (-617.648) -- 0:00:43
      268000 -- (-616.653) (-619.998) [-616.103] (-616.222) * (-619.410) (-615.315) (-617.447) [-620.172] -- 0:00:43
      268500 -- (-617.578) (-618.406) (-620.542) [-625.837] * (-619.850) (-616.063) (-617.785) [-618.612] -- 0:00:43
      269000 -- [-616.081] (-618.689) (-620.446) (-620.236) * (-617.908) (-616.414) [-622.976] (-617.985) -- 0:00:43
      269500 -- [-615.908] (-618.724) (-618.440) (-617.637) * (-617.394) [-616.265] (-615.899) (-617.356) -- 0:00:43
      270000 -- (-620.859) [-617.744] (-619.603) (-617.510) * (-619.919) [-619.926] (-616.430) (-620.229) -- 0:00:43

      Average standard deviation of split frequencies: 0.017513

      270500 -- (-616.004) (-618.920) [-618.484] (-617.573) * (-622.262) (-617.118) (-617.596) [-618.870] -- 0:00:43
      271000 -- (-618.913) (-620.005) [-617.327] (-617.947) * [-618.668] (-616.497) (-617.578) (-616.571) -- 0:00:43
      271500 -- (-618.687) (-617.185) (-617.199) [-617.129] * (-618.471) [-617.393] (-617.390) (-616.081) -- 0:00:42
      272000 -- (-618.390) (-618.020) (-617.628) [-618.446] * (-617.022) [-619.162] (-616.789) (-617.349) -- 0:00:42
      272500 -- [-616.230] (-620.732) (-618.879) (-617.201) * [-618.803] (-617.480) (-617.696) (-619.633) -- 0:00:42
      273000 -- (-616.380) (-621.271) (-619.295) [-619.519] * (-618.180) (-617.361) [-617.050] (-615.731) -- 0:00:42
      273500 -- (-623.282) (-621.741) [-616.687] (-617.020) * (-617.049) (-617.461) [-616.066] (-616.393) -- 0:00:42
      274000 -- (-616.418) [-619.154] (-618.932) (-615.693) * (-618.555) (-622.594) [-617.260] (-616.825) -- 0:00:42
      274500 -- (-618.269) (-616.066) [-618.099] (-616.927) * (-615.957) [-618.396] (-617.363) (-617.303) -- 0:00:42
      275000 -- [-619.785] (-615.914) (-616.488) (-617.723) * (-619.854) (-615.695) [-616.874] (-617.707) -- 0:00:42

      Average standard deviation of split frequencies: 0.016226

      275500 -- (-620.109) (-616.474) (-617.047) [-617.789] * (-618.658) (-618.249) [-620.166] (-616.969) -- 0:00:42
      276000 -- [-615.719] (-616.162) (-618.754) (-618.447) * (-617.014) (-617.348) [-617.869] (-616.128) -- 0:00:41
      276500 -- (-618.648) [-616.379] (-619.449) (-616.091) * [-618.354] (-617.514) (-619.949) (-616.892) -- 0:00:41
      277000 -- [-615.352] (-615.613) (-616.432) (-616.102) * [-622.773] (-619.254) (-616.494) (-617.559) -- 0:00:44
      277500 -- (-615.646) (-618.240) (-617.011) [-616.034] * (-622.443) (-616.995) (-620.249) [-619.427] -- 0:00:44
      278000 -- [-615.708] (-619.905) (-622.036) (-617.102) * (-616.377) [-616.279] (-619.999) (-621.567) -- 0:00:44
      278500 -- (-615.912) [-617.776] (-620.606) (-615.963) * [-616.471] (-626.644) (-619.240) (-621.037) -- 0:00:44
      279000 -- (-619.593) [-617.751] (-616.451) (-617.853) * (-617.259) [-626.095] (-617.745) (-618.187) -- 0:00:43
      279500 -- (-616.778) [-615.712] (-616.255) (-617.653) * (-618.600) [-616.219] (-621.664) (-620.227) -- 0:00:43
      280000 -- [-618.137] (-619.580) (-621.135) (-618.492) * (-617.134) [-617.790] (-619.806) (-618.468) -- 0:00:43

      Average standard deviation of split frequencies: 0.017356

      280500 -- (-618.662) (-618.475) (-616.184) [-619.607] * (-615.785) [-619.857] (-618.149) (-619.759) -- 0:00:43
      281000 -- (-621.143) (-616.310) (-620.391) [-617.328] * [-617.313] (-619.024) (-620.123) (-617.159) -- 0:00:43
      281500 -- [-616.487] (-623.862) (-620.621) (-615.889) * (-616.854) [-617.005] (-616.971) (-616.492) -- 0:00:43
      282000 -- (-618.281) (-618.289) [-620.197] (-616.659) * (-621.403) [-620.139] (-617.533) (-619.098) -- 0:00:43
      282500 -- (-617.243) (-617.402) (-618.097) [-618.407] * (-620.000) (-616.243) (-619.935) [-617.025] -- 0:00:43
      283000 -- [-618.707] (-616.883) (-620.839) (-617.524) * (-618.041) [-616.483] (-621.863) (-620.886) -- 0:00:43
      283500 -- (-619.878) (-616.595) (-617.896) [-615.390] * [-616.985] (-617.533) (-617.124) (-617.756) -- 0:00:42
      284000 -- [-616.883] (-619.095) (-622.937) (-618.327) * (-619.025) (-616.351) [-618.116] (-617.980) -- 0:00:42
      284500 -- [-617.372] (-617.515) (-615.869) (-619.284) * (-616.900) (-615.679) [-615.681] (-620.265) -- 0:00:42
      285000 -- (-617.211) (-615.359) [-618.447] (-616.741) * [-616.629] (-618.227) (-620.090) (-618.008) -- 0:00:42

      Average standard deviation of split frequencies: 0.016483

      285500 -- (-619.860) [-620.050] (-616.231) (-619.272) * (-615.286) [-616.540] (-622.182) (-619.673) -- 0:00:42
      286000 -- [-618.687] (-618.289) (-618.502) (-616.932) * (-621.073) (-617.372) (-617.934) [-618.732] -- 0:00:42
      286500 -- (-616.867) (-620.163) (-618.890) [-617.214] * [-620.290] (-621.902) (-616.292) (-617.382) -- 0:00:42
      287000 -- (-619.794) (-619.661) (-617.733) [-615.902] * [-618.126] (-617.482) (-620.511) (-621.817) -- 0:00:42
      287500 -- (-619.417) (-616.470) (-620.459) [-615.790] * [-615.930] (-616.280) (-618.225) (-621.672) -- 0:00:42
      288000 -- (-620.032) [-616.140] (-618.991) (-616.503) * (-619.477) (-616.599) (-619.936) [-617.035] -- 0:00:42
      288500 -- (-617.046) [-616.344] (-618.525) (-625.594) * (-618.658) (-616.709) (-620.997) [-616.236] -- 0:00:41
      289000 -- (-616.538) (-616.271) (-620.639) [-616.956] * (-616.863) (-620.839) (-616.245) [-616.225] -- 0:00:41
      289500 -- (-616.704) [-617.531] (-619.669) (-615.940) * (-616.063) (-620.798) [-617.344] (-617.761) -- 0:00:41
      290000 -- (-615.812) (-617.170) (-616.816) [-617.084] * (-619.202) [-620.206] (-616.563) (-616.788) -- 0:00:41

      Average standard deviation of split frequencies: 0.017209

      290500 -- (-615.770) [-617.482] (-617.049) (-616.555) * (-620.965) [-620.411] (-615.734) (-617.706) -- 0:00:41
      291000 -- (-620.079) [-617.517] (-618.777) (-618.174) * (-616.514) [-617.937] (-616.650) (-617.962) -- 0:00:41
      291500 -- [-619.270] (-617.370) (-618.274) (-616.370) * (-619.900) (-618.248) (-617.122) [-618.021] -- 0:00:41
      292000 -- (-623.366) (-615.866) [-618.481] (-618.128) * (-617.178) [-616.113] (-617.348) (-616.306) -- 0:00:41
      292500 -- (-617.839) [-618.310] (-617.427) (-621.377) * (-619.591) [-616.276] (-616.714) (-618.958) -- 0:00:41
      293000 -- (-617.071) [-618.529] (-619.029) (-622.334) * [-616.915] (-615.912) (-616.381) (-618.717) -- 0:00:41
      293500 -- (-615.467) (-615.920) [-619.113] (-619.396) * (-616.515) (-617.418) [-619.335] (-620.528) -- 0:00:40
      294000 -- (-615.997) [-616.247] (-619.702) (-617.642) * (-618.055) (-617.115) (-617.125) [-616.077] -- 0:00:43
      294500 -- [-619.870] (-616.869) (-618.561) (-616.195) * (-616.303) [-617.118] (-619.130) (-624.015) -- 0:00:43
      295000 -- (-617.038) (-619.078) (-618.013) [-619.837] * (-618.279) (-617.420) [-623.501] (-621.059) -- 0:00:43

      Average standard deviation of split frequencies: 0.017618

      295500 -- [-620.068] (-622.039) (-618.639) (-618.262) * (-616.286) [-615.681] (-616.826) (-617.797) -- 0:00:42
      296000 -- (-617.456) (-616.402) [-619.166] (-616.866) * (-616.738) (-616.437) [-617.528] (-621.216) -- 0:00:42
      296500 -- (-625.349) (-616.062) (-618.008) [-617.286] * (-619.183) (-618.754) [-617.439] (-617.199) -- 0:00:42
      297000 -- (-617.589) (-624.116) [-617.549] (-617.367) * (-620.415) [-619.239] (-616.526) (-616.696) -- 0:00:42
      297500 -- [-617.531] (-619.294) (-619.024) (-620.331) * (-620.593) (-616.502) [-615.995] (-617.826) -- 0:00:42
      298000 -- (-619.984) (-621.681) (-622.247) [-615.608] * (-616.322) (-616.423) (-621.602) [-617.315] -- 0:00:42
      298500 -- (-618.226) [-621.642] (-615.479) (-617.058) * (-618.655) [-619.878] (-616.844) (-616.622) -- 0:00:42
      299000 -- (-619.729) (-616.358) [-617.807] (-619.320) * (-618.975) (-618.616) [-617.740] (-619.946) -- 0:00:42
      299500 -- (-619.651) (-616.844) [-618.780] (-616.923) * (-617.875) (-618.629) [-618.355] (-618.490) -- 0:00:42
      300000 -- (-619.683) [-615.649] (-617.214) (-616.569) * [-619.989] (-619.471) (-617.959) (-617.961) -- 0:00:42

      Average standard deviation of split frequencies: 0.017638

      300500 -- [-615.625] (-618.922) (-618.642) (-616.489) * [-616.770] (-617.943) (-617.275) (-622.561) -- 0:00:41
      301000 -- [-615.427] (-616.778) (-615.793) (-620.152) * (-617.661) (-617.737) (-617.993) [-619.053] -- 0:00:41
      301500 -- [-618.970] (-619.441) (-617.120) (-619.954) * (-617.192) [-616.543] (-619.036) (-617.883) -- 0:00:41
      302000 -- (-622.073) (-616.277) [-617.093] (-624.795) * [-618.129] (-620.511) (-618.406) (-616.461) -- 0:00:41
      302500 -- (-617.112) (-616.729) [-620.187] (-626.402) * (-616.925) (-621.536) (-617.416) [-617.349] -- 0:00:41
      303000 -- [-617.108] (-616.907) (-616.473) (-625.458) * (-617.427) (-617.877) [-617.652] (-617.088) -- 0:00:41
      303500 -- [-618.013] (-616.464) (-616.855) (-617.257) * (-617.848) (-620.718) (-620.519) [-616.983] -- 0:00:41
      304000 -- (-617.532) [-616.631] (-618.341) (-617.656) * (-617.928) (-620.275) [-616.388] (-617.798) -- 0:00:41
      304500 -- (-616.480) (-616.581) [-618.394] (-619.358) * (-617.281) (-618.578) [-618.593] (-619.225) -- 0:00:41
      305000 -- (-617.844) [-617.569] (-615.848) (-620.039) * (-617.155) [-619.156] (-618.818) (-627.306) -- 0:00:41

      Average standard deviation of split frequencies: 0.017909

      305500 -- (-616.106) [-616.243] (-619.920) (-617.516) * (-620.370) [-618.226] (-617.642) (-623.254) -- 0:00:40
      306000 -- (-616.196) (-617.503) [-624.522] (-617.592) * (-618.099) [-620.207] (-618.715) (-623.904) -- 0:00:40
      306500 -- (-616.455) (-617.464) [-618.708] (-616.641) * (-616.778) (-618.930) (-618.509) [-621.062] -- 0:00:40
      307000 -- (-620.636) [-620.490] (-619.754) (-617.102) * [-617.380] (-620.394) (-618.776) (-620.618) -- 0:00:40
      307500 -- [-617.497] (-616.158) (-620.468) (-617.457) * (-617.003) (-616.676) [-618.949] (-620.202) -- 0:00:40
      308000 -- (-617.125) [-616.752] (-621.118) (-617.914) * [-615.951] (-615.992) (-622.032) (-617.028) -- 0:00:40
      308500 -- (-618.384) (-620.948) (-623.780) [-622.197] * (-618.574) (-615.503) [-617.733] (-616.602) -- 0:00:42
      309000 -- [-618.945] (-618.526) (-618.169) (-617.683) * (-620.667) (-619.282) [-618.309] (-617.473) -- 0:00:42
      309500 -- [-615.779] (-616.756) (-617.388) (-618.289) * (-618.216) (-620.568) (-616.171) [-619.693] -- 0:00:42
      310000 -- (-616.411) [-619.553] (-617.343) (-617.606) * (-618.009) [-616.395] (-618.806) (-619.585) -- 0:00:42

      Average standard deviation of split frequencies: 0.016334

      310500 -- [-616.825] (-624.037) (-616.348) (-620.960) * (-616.579) [-616.094] (-617.824) (-617.590) -- 0:00:42
      311000 -- (-616.017) (-619.365) (-619.489) [-617.430] * (-616.103) (-617.434) [-615.502] (-623.545) -- 0:00:42
      311500 -- [-615.931] (-618.194) (-617.341) (-617.919) * [-617.777] (-618.775) (-616.307) (-618.392) -- 0:00:41
      312000 -- (-617.280) (-616.272) (-617.325) [-617.417] * (-615.888) [-616.133] (-617.070) (-618.987) -- 0:00:41
      312500 -- (-619.337) [-615.313] (-618.624) (-618.316) * [-616.701] (-615.514) (-620.066) (-615.634) -- 0:00:41
      313000 -- [-619.218] (-616.849) (-619.266) (-616.018) * (-618.716) (-617.132) (-616.363) [-615.787] -- 0:00:41
      313500 -- (-619.209) (-618.623) [-617.028] (-615.581) * [-616.946] (-620.053) (-617.686) (-617.369) -- 0:00:41
      314000 -- (-616.664) (-616.572) [-617.192] (-618.054) * [-616.991] (-619.947) (-616.703) (-620.565) -- 0:00:41
      314500 -- (-617.027) (-620.644) (-617.388) [-621.837] * [-617.761] (-619.605) (-616.053) (-615.239) -- 0:00:41
      315000 -- (-616.429) (-617.641) (-623.197) [-619.234] * (-617.623) [-618.177] (-618.154) (-615.213) -- 0:00:41

      Average standard deviation of split frequencies: 0.016876

      315500 -- [-619.403] (-620.438) (-618.176) (-618.037) * [-615.801] (-616.982) (-617.245) (-617.554) -- 0:00:41
      316000 -- (-620.222) (-617.364) (-617.346) [-617.918] * [-618.641] (-619.944) (-619.035) (-619.143) -- 0:00:41
      316500 -- [-617.898] (-619.075) (-617.685) (-617.024) * (-618.783) (-617.450) (-622.954) [-618.367] -- 0:00:41
      317000 -- [-619.709] (-618.899) (-616.857) (-617.750) * [-615.770] (-619.314) (-618.783) (-617.846) -- 0:00:40
      317500 -- (-618.949) [-617.680] (-616.481) (-618.907) * (-618.581) [-615.532] (-619.506) (-618.103) -- 0:00:40
      318000 -- (-617.340) (-619.301) [-619.178] (-619.346) * (-618.938) (-618.070) (-617.897) [-621.758] -- 0:00:40
      318500 -- (-616.181) [-619.422] (-619.573) (-619.332) * (-621.089) [-618.244] (-616.693) (-618.934) -- 0:00:40
      319000 -- (-617.130) [-616.446] (-616.883) (-616.851) * [-616.930] (-620.958) (-618.676) (-620.629) -- 0:00:40
      319500 -- (-618.821) (-622.197) (-616.220) [-617.358] * (-617.928) [-619.656] (-617.197) (-617.374) -- 0:00:40
      320000 -- [-618.036] (-618.157) (-616.736) (-617.373) * (-616.523) (-616.778) [-617.726] (-617.080) -- 0:00:40

      Average standard deviation of split frequencies: 0.016538

      320500 -- (-622.256) (-618.070) (-617.254) [-615.479] * (-621.396) (-617.511) (-617.003) [-619.184] -- 0:00:40
      321000 -- [-618.328] (-616.785) (-619.400) (-617.025) * (-622.235) (-616.394) (-622.160) [-621.238] -- 0:00:40
      321500 -- [-617.667] (-621.372) (-622.172) (-616.112) * (-620.498) [-620.237] (-617.936) (-619.749) -- 0:00:40
      322000 -- (-620.367) (-621.261) (-620.764) [-615.155] * [-616.582] (-620.436) (-622.413) (-615.557) -- 0:00:40
      322500 -- (-619.001) [-617.794] (-622.827) (-617.076) * (-617.159) [-621.047] (-619.230) (-617.383) -- 0:00:39
      323000 -- (-617.732) (-616.286) [-616.414] (-615.356) * (-620.057) [-620.751] (-618.446) (-618.640) -- 0:00:41
      323500 -- (-616.868) (-616.999) (-618.242) [-618.717] * (-618.378) (-618.878) [-616.087] (-619.112) -- 0:00:41
      324000 -- (-622.075) [-619.636] (-619.893) (-615.973) * (-618.204) (-621.189) (-616.571) [-616.542] -- 0:00:41
      324500 -- [-616.197] (-618.014) (-615.500) (-618.128) * (-618.204) (-615.936) [-616.673] (-617.705) -- 0:00:41
      325000 -- (-619.656) (-620.895) [-615.526] (-618.287) * [-619.730] (-618.333) (-616.802) (-615.496) -- 0:00:41

      Average standard deviation of split frequencies: 0.016268

      325500 -- (-616.882) [-616.687] (-618.262) (-617.382) * [-617.089] (-616.220) (-620.455) (-620.003) -- 0:00:41
      326000 -- (-618.357) (-617.786) (-618.985) [-620.486] * (-616.517) [-616.154] (-616.137) (-615.915) -- 0:00:41
      326500 -- (-617.258) (-617.552) (-617.974) [-615.769] * (-616.468) (-616.578) [-619.370] (-617.874) -- 0:00:41
      327000 -- (-617.684) [-616.928] (-622.549) (-618.675) * (-618.550) (-618.671) [-616.496] (-616.621) -- 0:00:41
      327500 -- (-617.438) [-616.049] (-619.789) (-616.814) * [-621.755] (-617.426) (-617.317) (-616.696) -- 0:00:41
      328000 -- (-622.061) [-616.975] (-619.346) (-616.986) * (-616.218) (-615.963) (-618.849) [-616.689] -- 0:00:40
      328500 -- [-621.230] (-621.290) (-618.524) (-618.668) * [-621.995] (-617.557) (-622.669) (-617.363) -- 0:00:40
      329000 -- (-619.113) [-616.700] (-619.628) (-616.892) * (-620.969) (-622.742) (-615.963) [-616.646] -- 0:00:40
      329500 -- [-615.973] (-623.703) (-617.643) (-619.539) * [-617.707] (-619.977) (-615.452) (-616.869) -- 0:00:40
      330000 -- (-616.787) (-618.041) [-620.826] (-619.715) * (-617.191) (-619.935) (-619.943) [-616.880] -- 0:00:40

      Average standard deviation of split frequencies: 0.014969

      330500 -- (-615.990) (-617.515) [-619.147] (-616.635) * [-615.499] (-616.710) (-619.214) (-622.325) -- 0:00:40
      331000 -- (-616.327) [-616.958] (-617.386) (-615.967) * [-616.089] (-618.148) (-619.249) (-616.857) -- 0:00:40
      331500 -- (-616.038) [-616.901] (-617.268) (-618.032) * (-617.976) (-616.214) (-618.708) [-617.450] -- 0:00:40
      332000 -- (-618.539) [-617.931] (-616.563) (-621.840) * (-621.081) (-617.686) (-617.574) [-616.588] -- 0:00:40
      332500 -- (-616.425) (-618.579) [-617.729] (-616.821) * (-619.259) [-617.258] (-617.411) (-616.876) -- 0:00:40
      333000 -- (-616.451) (-620.395) [-617.759] (-619.030) * [-618.727] (-618.315) (-618.027) (-618.242) -- 0:00:40
      333500 -- (-619.728) (-617.705) [-617.561] (-617.215) * (-620.824) [-616.621] (-622.808) (-618.756) -- 0:00:39
      334000 -- (-618.863) [-615.835] (-620.269) (-617.319) * [-617.839] (-619.252) (-616.319) (-620.600) -- 0:00:39
      334500 -- [-616.262] (-617.116) (-617.972) (-617.339) * [-617.326] (-618.842) (-617.537) (-617.954) -- 0:00:39
      335000 -- (-617.096) [-616.620] (-616.900) (-618.067) * (-617.500) (-618.645) (-615.791) [-617.852] -- 0:00:39

      Average standard deviation of split frequencies: 0.015020

      335500 -- (-621.233) (-615.674) (-616.936) [-617.815] * (-617.450) (-617.907) (-617.443) [-618.137] -- 0:00:39
      336000 -- [-616.162] (-615.947) (-619.876) (-616.841) * (-620.405) (-620.122) (-616.337) [-617.757] -- 0:00:39
      336500 -- [-617.633] (-616.975) (-618.289) (-615.670) * [-616.823] (-618.599) (-618.085) (-617.046) -- 0:00:39
      337000 -- (-615.544) (-615.975) (-617.915) [-615.626] * [-615.841] (-616.548) (-616.532) (-619.424) -- 0:00:39
      337500 -- [-616.182] (-617.260) (-617.648) (-616.806) * [-616.296] (-627.072) (-621.987) (-618.948) -- 0:00:39
      338000 -- (-617.250) [-616.946] (-616.823) (-616.253) * [-617.502] (-619.637) (-620.409) (-618.996) -- 0:00:41
      338500 -- (-622.761) (-617.132) [-617.031] (-621.357) * (-615.797) (-617.667) [-616.105] (-619.352) -- 0:00:41
      339000 -- (-620.364) [-618.211] (-617.400) (-617.020) * (-616.165) (-616.662) [-620.344] (-616.819) -- 0:00:40
      339500 -- (-619.493) [-617.008] (-618.897) (-615.803) * [-621.475] (-616.676) (-620.153) (-620.740) -- 0:00:40
      340000 -- [-617.225] (-618.204) (-616.716) (-621.535) * (-617.915) [-618.792] (-618.875) (-620.113) -- 0:00:40

      Average standard deviation of split frequencies: 0.014407

      340500 -- (-621.959) (-619.935) (-620.231) [-621.873] * (-620.850) [-619.090] (-618.536) (-619.539) -- 0:00:40
      341000 -- (-622.922) [-616.429] (-621.055) (-624.163) * (-616.659) (-617.686) [-617.109] (-620.573) -- 0:00:40
      341500 -- (-617.369) [-618.056] (-619.523) (-620.859) * (-617.910) [-617.550] (-616.515) (-616.919) -- 0:00:40
      342000 -- (-618.425) (-617.490) [-622.320] (-616.721) * (-617.622) (-618.053) [-617.711] (-617.688) -- 0:00:40
      342500 -- (-618.631) (-616.107) [-616.888] (-617.707) * [-618.124] (-616.939) (-619.175) (-616.095) -- 0:00:40
      343000 -- (-619.891) [-616.355] (-618.177) (-618.282) * (-617.934) (-616.910) [-618.251] (-615.974) -- 0:00:40
      343500 -- (-618.982) [-615.522] (-617.441) (-617.369) * (-616.204) (-620.670) (-616.856) [-616.648] -- 0:00:40
      344000 -- (-617.819) (-619.537) (-618.496) [-617.943] * (-617.536) (-617.693) [-619.120] (-618.176) -- 0:00:40
      344500 -- (-620.429) [-620.231] (-615.728) (-618.189) * (-619.209) (-617.182) [-615.553] (-617.380) -- 0:00:39
      345000 -- [-617.146] (-621.792) (-621.978) (-618.626) * (-618.254) [-621.814] (-616.898) (-619.887) -- 0:00:39

      Average standard deviation of split frequencies: 0.015138

      345500 -- (-616.015) [-617.499] (-619.869) (-616.323) * [-618.023] (-617.300) (-616.112) (-617.704) -- 0:00:39
      346000 -- [-618.090] (-618.268) (-616.040) (-618.835) * (-617.962) (-620.999) (-620.748) [-617.395] -- 0:00:39
      346500 -- [-616.581] (-616.917) (-618.341) (-616.442) * (-616.566) (-616.262) [-618.369] (-616.769) -- 0:00:39
      347000 -- (-616.735) (-616.436) [-616.167] (-618.098) * (-617.084) (-617.226) (-618.419) [-616.200] -- 0:00:39
      347500 -- (-617.420) (-616.783) [-618.674] (-620.574) * [-618.443] (-617.521) (-615.626) (-617.791) -- 0:00:39
      348000 -- [-616.320] (-620.003) (-617.114) (-618.007) * (-618.276) [-619.020] (-616.368) (-618.373) -- 0:00:39
      348500 -- (-615.803) (-619.204) (-624.917) [-617.726] * (-616.712) (-617.127) [-616.070] (-617.329) -- 0:00:39
      349000 -- (-615.423) (-621.840) (-619.204) [-620.045] * (-617.437) (-619.024) [-619.625] (-617.499) -- 0:00:39
      349500 -- (-616.842) (-620.244) [-620.396] (-619.420) * (-621.541) (-620.524) (-623.294) [-616.028] -- 0:00:39
      350000 -- [-617.172] (-622.682) (-618.398) (-616.930) * (-620.826) [-618.685] (-625.431) (-615.753) -- 0:00:39

      Average standard deviation of split frequencies: 0.014115

      350500 -- [-617.559] (-621.801) (-619.674) (-619.071) * [-623.280] (-617.477) (-616.884) (-615.678) -- 0:00:38
      351000 -- (-617.936) [-618.675] (-620.499) (-617.400) * [-616.910] (-617.259) (-617.974) (-619.166) -- 0:00:38
      351500 -- (-618.569) (-617.050) (-619.465) [-618.102] * (-616.883) (-620.274) (-616.781) [-618.035] -- 0:00:38
      352000 -- (-616.970) [-619.945] (-621.573) (-616.150) * (-616.237) (-617.691) [-618.779] (-617.781) -- 0:00:38
      352500 -- (-616.361) (-617.723) (-622.360) [-615.977] * (-616.949) (-617.484) (-619.392) [-616.293] -- 0:00:38
      353000 -- (-616.772) [-618.607] (-617.671) (-616.936) * (-615.808) [-618.257] (-616.702) (-617.095) -- 0:00:38
      353500 -- (-618.950) [-618.026] (-616.587) (-616.288) * [-621.257] (-616.695) (-619.050) (-621.704) -- 0:00:38
      354000 -- (-617.556) (-616.760) (-618.616) [-621.442] * (-619.993) (-617.436) [-616.066] (-615.599) -- 0:00:38
      354500 -- (-617.778) [-617.718] (-622.802) (-618.231) * (-618.668) [-615.811] (-616.490) (-617.154) -- 0:00:40
      355000 -- (-617.817) (-617.040) [-617.079] (-617.786) * (-617.469) (-618.507) [-617.211] (-618.168) -- 0:00:39

      Average standard deviation of split frequencies: 0.013830

      355500 -- [-615.843] (-616.872) (-618.606) (-618.569) * (-619.273) [-617.851] (-616.793) (-616.127) -- 0:00:39
      356000 -- (-615.309) (-616.697) (-617.547) [-618.664] * (-623.336) [-618.334] (-617.767) (-618.533) -- 0:00:39
      356500 -- (-616.302) (-618.566) (-622.778) [-620.018] * [-621.106] (-617.904) (-616.650) (-620.956) -- 0:00:39
      357000 -- [-617.264] (-620.548) (-616.110) (-621.010) * (-618.029) [-616.527] (-616.767) (-619.088) -- 0:00:39
      357500 -- (-615.755) [-618.113] (-618.377) (-615.942) * (-618.627) (-618.529) (-618.346) [-616.416] -- 0:00:39
      358000 -- (-622.569) [-617.025] (-618.589) (-615.862) * (-618.528) (-616.527) (-616.735) [-616.678] -- 0:00:39
      358500 -- (-619.317) (-616.773) (-622.823) [-618.819] * (-616.526) (-617.322) (-616.125) [-620.113] -- 0:00:39
      359000 -- [-617.121] (-617.733) (-616.758) (-617.646) * (-617.589) [-616.801] (-618.391) (-621.613) -- 0:00:39
      359500 -- [-616.245] (-617.276) (-616.922) (-617.596) * (-616.361) (-617.346) [-618.841] (-616.690) -- 0:00:39
      360000 -- (-617.999) (-617.267) [-620.437] (-625.690) * (-617.492) (-617.574) (-620.011) [-619.892] -- 0:00:39

      Average standard deviation of split frequencies: 0.013002

      360500 -- (-617.890) (-617.244) (-617.244) [-622.007] * (-618.513) (-616.423) (-617.513) [-617.017] -- 0:00:39
      361000 -- (-617.594) (-617.061) [-618.073] (-620.357) * (-617.521) (-616.414) (-618.502) [-615.940] -- 0:00:38
      361500 -- (-617.774) [-615.884] (-616.085) (-616.122) * (-617.306) [-615.671] (-616.060) (-615.875) -- 0:00:38
      362000 -- (-619.703) [-616.520] (-617.861) (-616.121) * [-616.768] (-618.361) (-615.927) (-616.869) -- 0:00:38
      362500 -- (-616.541) (-619.323) (-617.801) [-619.037] * (-617.891) (-616.914) (-617.068) [-616.695] -- 0:00:38
      363000 -- (-622.647) [-622.216] (-615.415) (-617.644) * [-618.833] (-616.902) (-616.787) (-617.467) -- 0:00:38
      363500 -- (-619.255) [-617.403] (-618.860) (-616.055) * (-618.720) [-616.311] (-628.433) (-618.566) -- 0:00:38
      364000 -- [-618.285] (-618.545) (-617.755) (-617.368) * (-618.568) (-621.203) [-619.054] (-617.687) -- 0:00:38
      364500 -- (-619.690) [-616.578] (-618.093) (-615.836) * (-619.549) [-617.846] (-616.779) (-615.814) -- 0:00:38
      365000 -- (-616.728) [-617.399] (-616.730) (-618.286) * (-619.595) [-616.173] (-616.683) (-619.547) -- 0:00:38

      Average standard deviation of split frequencies: 0.013151

      365500 -- (-618.030) (-617.292) [-617.059] (-616.326) * [-619.400] (-616.587) (-619.746) (-619.305) -- 0:00:38
      366000 -- (-617.760) (-616.633) (-619.755) [-616.306] * (-617.443) (-617.047) (-619.434) [-617.756] -- 0:00:38
      366500 -- (-619.526) (-616.596) (-622.961) [-615.774] * (-617.954) [-616.874] (-616.864) (-621.685) -- 0:00:38
      367000 -- (-622.760) (-617.643) (-619.447) [-616.481] * (-618.449) (-618.453) [-617.098] (-618.736) -- 0:00:37
      367500 -- (-621.385) (-618.673) [-616.970] (-616.840) * (-617.226) (-616.790) [-616.814] (-619.701) -- 0:00:37
      368000 -- [-617.032] (-617.609) (-616.242) (-617.788) * [-617.762] (-618.805) (-617.475) (-620.337) -- 0:00:37
      368500 -- [-616.760] (-623.886) (-617.119) (-618.681) * [-616.711] (-616.718) (-616.941) (-617.909) -- 0:00:37
      369000 -- (-617.668) (-615.929) (-616.996) [-615.909] * [-616.846] (-618.539) (-618.545) (-617.133) -- 0:00:37
      369500 -- (-617.847) [-616.184] (-616.706) (-619.028) * (-617.338) [-617.549] (-616.047) (-617.697) -- 0:00:37
      370000 -- (-619.285) [-616.402] (-621.511) (-617.227) * (-618.271) [-618.502] (-615.913) (-620.320) -- 0:00:37

      Average standard deviation of split frequencies: 0.014190

      370500 -- [-616.690] (-617.077) (-618.679) (-618.753) * (-617.149) (-620.455) [-615.748] (-616.971) -- 0:00:37
      371000 -- (-616.958) (-617.576) (-623.304) [-616.267] * (-618.578) (-616.748) [-618.486] (-617.454) -- 0:00:38
      371500 -- (-618.473) (-617.602) (-619.336) [-619.585] * [-615.273] (-618.115) (-617.169) (-619.348) -- 0:00:38
      372000 -- (-629.178) (-616.983) (-619.363) [-618.222] * (-615.906) [-616.487] (-616.793) (-619.754) -- 0:00:38
      372500 -- (-626.095) (-618.239) (-617.409) [-616.184] * (-615.637) (-616.645) (-616.040) [-617.738] -- 0:00:38
      373000 -- (-619.323) (-618.643) (-625.565) [-617.689] * (-618.153) [-622.413] (-617.297) (-615.760) -- 0:00:38
      373500 -- [-616.468] (-625.918) (-621.515) (-619.703) * (-616.295) [-621.174] (-618.936) (-616.714) -- 0:00:38
      374000 -- (-616.279) (-621.374) (-622.002) [-617.172] * (-616.847) (-621.370) [-617.356] (-618.986) -- 0:00:38
      374500 -- [-617.067] (-625.262) (-618.909) (-617.344) * (-616.345) [-616.145] (-621.769) (-616.646) -- 0:00:38
      375000 -- (-617.373) [-622.610] (-617.281) (-617.181) * (-619.070) (-618.033) [-616.065] (-615.885) -- 0:00:38

      Average standard deviation of split frequencies: 0.013923

      375500 -- (-620.146) (-620.590) (-615.728) [-618.413] * (-620.456) [-624.551] (-619.235) (-615.384) -- 0:00:38
      376000 -- (-617.836) (-616.255) (-618.020) [-616.841] * (-620.273) [-620.125] (-615.981) (-615.324) -- 0:00:38
      376500 -- (-617.639) (-616.010) [-615.573] (-617.804) * [-617.394] (-621.438) (-616.829) (-617.408) -- 0:00:38
      377000 -- (-616.860) (-618.655) [-617.295] (-621.659) * [-618.503] (-618.396) (-616.570) (-615.624) -- 0:00:38
      377500 -- (-615.353) (-616.781) [-618.879] (-620.900) * (-620.017) [-616.383] (-616.927) (-616.055) -- 0:00:37
      378000 -- [-616.136] (-617.846) (-619.230) (-617.450) * (-619.079) (-619.421) [-617.713] (-617.338) -- 0:00:37
      378500 -- (-616.879) [-616.698] (-618.319) (-625.935) * (-618.499) [-617.002] (-616.520) (-617.582) -- 0:00:37
      379000 -- (-616.427) [-616.884] (-618.493) (-618.637) * (-616.759) (-617.322) (-619.340) [-616.292] -- 0:00:37
      379500 -- (-619.054) (-618.762) (-617.801) [-619.044] * (-616.564) (-616.069) [-618.768] (-619.685) -- 0:00:37
      380000 -- (-621.793) (-621.326) (-616.616) [-618.133] * (-616.472) (-621.667) [-617.025] (-617.376) -- 0:00:37

      Average standard deviation of split frequencies: 0.012905

      380500 -- (-617.708) (-615.912) [-618.380] (-618.113) * (-616.070) (-619.963) [-617.684] (-616.934) -- 0:00:37
      381000 -- (-617.285) [-615.473] (-616.375) (-617.138) * (-617.832) [-616.659] (-622.678) (-618.174) -- 0:00:37
      381500 -- (-618.089) [-619.960] (-616.582) (-616.002) * (-618.700) (-617.838) [-615.645] (-616.228) -- 0:00:37
      382000 -- [-620.230] (-616.682) (-616.551) (-616.722) * (-617.544) [-617.487] (-616.726) (-617.438) -- 0:00:37
      382500 -- (-619.829) (-616.919) [-620.521] (-617.341) * [-616.837] (-616.905) (-618.546) (-617.365) -- 0:00:37
      383000 -- (-620.935) (-617.830) [-617.700] (-616.750) * (-616.815) (-615.484) [-615.815] (-618.732) -- 0:00:37
      383500 -- [-618.658] (-617.528) (-617.144) (-622.208) * (-617.908) [-617.840] (-618.756) (-620.217) -- 0:00:36
      384000 -- (-616.621) [-618.066] (-620.854) (-616.502) * (-619.789) (-617.860) [-615.905] (-617.690) -- 0:00:36
      384500 -- (-617.734) (-617.726) [-616.991] (-617.627) * (-619.899) [-617.891] (-615.827) (-617.741) -- 0:00:36
      385000 -- (-618.169) (-621.168) (-618.022) [-625.762] * (-617.174) (-615.762) (-619.122) [-615.872] -- 0:00:36

      Average standard deviation of split frequencies: 0.012470

      385500 -- (-618.216) [-619.137] (-618.158) (-615.952) * (-616.654) (-615.876) [-617.153] (-618.913) -- 0:00:36
      386000 -- (-617.477) (-616.902) [-621.296] (-616.246) * [-620.307] (-616.993) (-615.592) (-615.615) -- 0:00:36
      386500 -- (-615.970) (-616.749) (-622.284) [-617.265] * (-618.077) (-616.483) [-618.669] (-617.407) -- 0:00:36
      387000 -- [-618.805] (-622.189) (-620.844) (-616.529) * (-617.080) (-615.960) (-619.195) [-617.433] -- 0:00:36
      387500 -- [-622.186] (-619.557) (-617.633) (-615.805) * (-617.292) (-615.697) [-616.958] (-617.401) -- 0:00:36
      388000 -- [-622.667] (-618.146) (-621.594) (-617.002) * (-618.490) (-618.620) (-616.622) [-618.410] -- 0:00:37
      388500 -- [-619.007] (-619.896) (-619.059) (-620.309) * (-618.136) [-617.610] (-616.821) (-616.285) -- 0:00:37
      389000 -- (-617.336) [-619.592] (-624.029) (-617.919) * (-617.147) (-617.675) (-616.724) [-616.378] -- 0:00:37
      389500 -- (-616.434) (-621.096) (-619.371) [-616.060] * [-615.475] (-618.122) (-616.721) (-616.633) -- 0:00:37
      390000 -- (-617.125) [-618.537] (-620.060) (-616.609) * [-617.617] (-617.620) (-617.134) (-618.950) -- 0:00:37

      Average standard deviation of split frequencies: 0.014125

      390500 -- (-619.274) (-616.857) [-619.308] (-617.539) * (-618.000) [-618.110] (-617.110) (-619.581) -- 0:00:37
      391000 -- (-619.385) [-618.725] (-617.347) (-620.010) * (-616.568) [-615.915] (-619.682) (-619.455) -- 0:00:37
      391500 -- [-616.830] (-618.653) (-620.181) (-615.965) * (-617.340) (-620.329) (-615.485) [-621.366] -- 0:00:37
      392000 -- (-619.973) (-617.961) (-617.157) [-617.898] * (-619.465) [-617.134] (-616.566) (-620.764) -- 0:00:37
      392500 -- (-616.223) [-618.033] (-617.659) (-618.823) * [-619.702] (-617.918) (-620.050) (-616.028) -- 0:00:37
      393000 -- (-617.419) (-618.768) (-620.977) [-618.338] * [-617.808] (-618.089) (-616.916) (-620.225) -- 0:00:37
      393500 -- (-617.649) [-616.595] (-619.328) (-618.895) * [-621.866] (-617.147) (-618.361) (-619.403) -- 0:00:36
      394000 -- [-618.412] (-617.812) (-617.505) (-617.378) * (-619.809) [-619.685] (-621.391) (-617.962) -- 0:00:36
      394500 -- [-616.116] (-619.855) (-617.026) (-616.794) * (-620.352) (-620.038) [-619.402] (-617.963) -- 0:00:36
      395000 -- (-616.444) [-617.969] (-618.092) (-616.196) * (-619.010) [-618.879] (-618.939) (-616.661) -- 0:00:36

      Average standard deviation of split frequencies: 0.013025

      395500 -- (-616.217) (-619.001) (-619.858) [-616.314] * [-617.689] (-619.535) (-623.325) (-616.790) -- 0:00:36
      396000 -- (-618.354) (-620.256) [-616.142] (-616.472) * [-617.011] (-618.447) (-621.008) (-618.441) -- 0:00:36
      396500 -- (-616.303) [-618.875] (-616.875) (-618.965) * (-621.866) [-619.198] (-618.700) (-618.746) -- 0:00:36
      397000 -- (-616.867) [-620.207] (-616.964) (-621.195) * [-617.421] (-618.661) (-617.216) (-617.309) -- 0:00:36
      397500 -- (-616.585) (-616.967) [-615.756] (-617.744) * [-619.486] (-618.339) (-619.189) (-616.555) -- 0:00:36
      398000 -- (-619.384) (-620.186) [-615.890] (-623.521) * [-616.477] (-618.056) (-617.345) (-617.496) -- 0:00:36
      398500 -- (-616.995) (-617.572) [-616.632] (-617.596) * [-617.140] (-620.166) (-616.981) (-621.325) -- 0:00:36
      399000 -- [-620.854] (-619.865) (-616.244) (-616.948) * [-616.434] (-616.020) (-616.487) (-618.088) -- 0:00:36
      399500 -- (-618.379) [-619.995] (-617.625) (-618.428) * (-619.665) [-618.992] (-617.762) (-616.735) -- 0:00:36
      400000 -- (-616.040) (-620.464) [-618.620] (-617.350) * (-619.218) [-615.839] (-617.450) (-618.687) -- 0:00:36

      Average standard deviation of split frequencies: 0.014119

      400500 -- (-618.674) [-616.909] (-616.001) (-619.420) * [-615.357] (-615.955) (-616.973) (-621.511) -- 0:00:35
      401000 -- (-618.167) [-617.536] (-617.917) (-617.367) * (-615.374) (-618.235) [-620.411] (-616.287) -- 0:00:35
      401500 -- (-617.532) (-619.460) [-616.547] (-622.552) * (-616.409) [-616.079] (-617.858) (-619.728) -- 0:00:35
      402000 -- (-618.299) (-616.835) (-620.900) [-618.995] * [-615.446] (-617.286) (-617.096) (-617.391) -- 0:00:35
      402500 -- [-616.801] (-616.103) (-619.267) (-617.550) * [-616.553] (-616.857) (-620.915) (-616.402) -- 0:00:35
      403000 -- (-616.391) [-617.732] (-619.502) (-618.366) * (-616.560) (-617.678) [-617.062] (-617.807) -- 0:00:35
      403500 -- [-617.919] (-620.861) (-623.325) (-618.992) * (-617.766) [-615.992] (-619.935) (-621.521) -- 0:00:35
      404000 -- (-618.694) (-618.821) [-619.245] (-620.564) * [-618.371] (-616.115) (-615.668) (-620.474) -- 0:00:35
      404500 -- [-618.632] (-618.161) (-619.189) (-616.906) * [-618.771] (-617.663) (-615.834) (-615.810) -- 0:00:36
      405000 -- [-617.644] (-619.750) (-618.378) (-622.015) * [-617.552] (-618.918) (-617.012) (-617.451) -- 0:00:36

      Average standard deviation of split frequencies: 0.013250

      405500 -- (-618.287) [-616.375] (-616.536) (-618.965) * (-616.520) (-621.604) (-618.626) [-618.577] -- 0:00:36
      406000 -- (-620.190) [-618.680] (-617.063) (-616.955) * (-619.971) [-621.708] (-617.701) (-616.756) -- 0:00:36
      406500 -- [-615.880] (-616.103) (-618.280) (-616.645) * [-618.957] (-617.868) (-617.773) (-621.299) -- 0:00:36
      407000 -- (-616.116) [-619.603] (-617.134) (-618.686) * (-616.781) (-617.149) [-618.209] (-621.627) -- 0:00:36
      407500 -- (-616.714) [-618.490] (-619.784) (-617.856) * (-615.957) [-615.279] (-626.082) (-620.189) -- 0:00:36
      408000 -- (-616.564) (-616.887) [-617.840] (-617.570) * [-617.174] (-615.662) (-618.869) (-618.432) -- 0:00:36
      408500 -- (-616.682) (-618.849) [-616.201] (-619.390) * (-618.033) (-619.831) (-621.401) [-618.120] -- 0:00:36
      409000 -- (-616.551) (-619.815) (-617.996) [-621.157] * (-617.144) (-619.895) (-619.175) [-618.486] -- 0:00:36
      409500 -- [-617.323] (-616.197) (-617.694) (-616.971) * (-616.966) (-616.578) [-617.241] (-617.200) -- 0:00:36
      410000 -- (-622.274) (-615.824) [-617.007] (-617.197) * (-621.823) [-616.593] (-620.760) (-617.321) -- 0:00:35

      Average standard deviation of split frequencies: 0.014134

      410500 -- (-618.469) (-617.762) [-617.518] (-616.007) * (-619.576) [-615.727] (-617.012) (-619.955) -- 0:00:35
      411000 -- (-616.814) (-619.035) (-618.195) [-616.359] * (-617.797) [-617.879] (-617.697) (-616.985) -- 0:00:35
      411500 -- (-616.517) (-617.837) [-618.102] (-617.813) * [-616.890] (-622.214) (-617.657) (-616.107) -- 0:00:35
      412000 -- [-617.669] (-617.756) (-618.538) (-616.464) * (-622.513) (-626.563) (-615.774) [-618.332] -- 0:00:35
      412500 -- (-616.772) (-617.394) [-618.712] (-617.606) * (-621.721) (-622.057) [-618.519] (-617.380) -- 0:00:35
      413000 -- [-618.182] (-620.072) (-620.910) (-621.278) * [-616.636] (-619.980) (-617.486) (-617.966) -- 0:00:35
      413500 -- [-617.730] (-619.058) (-616.561) (-619.993) * (-615.630) (-618.051) [-620.064] (-618.765) -- 0:00:35
      414000 -- (-617.599) [-618.141] (-616.505) (-617.507) * (-616.286) [-618.081] (-619.650) (-617.647) -- 0:00:35
      414500 -- (-616.497) (-616.714) (-615.820) [-621.555] * (-616.943) [-615.926] (-620.106) (-617.755) -- 0:00:35
      415000 -- (-616.027) [-615.780] (-619.185) (-618.011) * [-617.102] (-618.533) (-620.014) (-617.650) -- 0:00:35

      Average standard deviation of split frequencies: 0.013386

      415500 -- (-618.815) [-616.167] (-616.282) (-617.327) * [-616.949] (-617.163) (-619.909) (-618.373) -- 0:00:35
      416000 -- (-617.983) [-615.538] (-623.475) (-618.148) * (-617.134) (-621.105) [-618.600] (-619.307) -- 0:00:35
      416500 -- (-618.367) (-617.596) [-616.608] (-617.050) * [-617.445] (-619.804) (-624.971) (-619.115) -- 0:00:35
      417000 -- (-616.951) (-616.814) [-616.622] (-616.290) * (-618.238) (-620.625) (-617.252) [-617.480] -- 0:00:34
      417500 -- (-615.579) (-616.250) [-616.768] (-620.600) * [-618.797] (-617.831) (-616.680) (-616.985) -- 0:00:34
      418000 -- (-616.378) (-615.982) (-617.373) [-617.560] * (-618.304) (-617.084) [-616.367] (-617.412) -- 0:00:34
      418500 -- (-616.341) (-616.006) (-617.239) [-616.875] * [-616.716] (-618.995) (-617.603) (-618.894) -- 0:00:34
      419000 -- (-617.262) (-618.410) (-621.986) [-616.343] * (-616.238) (-619.716) [-619.247] (-619.541) -- 0:00:34
      419500 -- (-615.812) [-616.808] (-617.489) (-616.501) * (-616.152) (-616.419) (-619.319) [-618.079] -- 0:00:34
      420000 -- (-616.061) (-619.215) (-617.552) [-617.049] * (-615.538) (-618.266) (-616.017) [-619.295] -- 0:00:34

      Average standard deviation of split frequencies: 0.012986

      420500 -- (-618.402) (-619.559) (-616.808) [-622.346] * [-619.205] (-618.342) (-619.333) (-623.059) -- 0:00:34
      421000 -- (-619.184) [-617.725] (-616.448) (-617.667) * (-616.674) [-616.949] (-616.771) (-620.769) -- 0:00:34
      421500 -- (-617.535) (-616.924) (-616.179) [-616.631] * (-620.293) (-621.036) [-617.342] (-618.257) -- 0:00:35
      422000 -- (-617.908) [-616.649] (-617.230) (-615.557) * (-619.381) (-618.328) (-617.830) [-616.718] -- 0:00:35
      422500 -- [-616.019] (-625.710) (-619.223) (-624.586) * (-616.010) (-619.781) (-617.013) [-619.576] -- 0:00:35
      423000 -- [-616.406] (-628.424) (-618.494) (-618.144) * (-617.048) (-619.705) [-617.470] (-616.046) -- 0:00:35
      423500 -- [-617.171] (-617.873) (-619.628) (-620.090) * (-616.347) (-616.984) (-622.373) [-616.462] -- 0:00:35
      424000 -- (-617.266) (-622.419) (-622.079) [-617.897] * [-615.896] (-616.221) (-622.628) (-625.944) -- 0:00:35
      424500 -- [-620.540] (-618.340) (-615.720) (-617.008) * (-621.037) [-617.993] (-618.250) (-617.478) -- 0:00:35
      425000 -- (-621.776) (-618.769) [-617.943] (-615.929) * (-620.903) (-618.270) (-617.508) [-616.288] -- 0:00:35

      Average standard deviation of split frequencies: 0.012758

      425500 -- [-621.114] (-618.550) (-615.759) (-616.514) * (-617.930) (-615.995) (-615.816) [-616.115] -- 0:00:35
      426000 -- (-615.976) (-618.074) (-617.286) [-618.515] * (-616.736) (-616.264) (-615.842) [-615.275] -- 0:00:35
      426500 -- (-617.260) (-617.537) (-615.896) [-619.142] * (-619.707) (-616.934) (-619.611) [-617.152] -- 0:00:34
      427000 -- [-616.350] (-618.108) (-619.761) (-619.839) * (-624.749) (-620.040) (-617.934) [-618.707] -- 0:00:34
      427500 -- (-619.079) (-619.357) [-615.966] (-617.343) * [-617.047] (-617.042) (-616.004) (-617.391) -- 0:00:34
      428000 -- (-619.782) (-619.841) (-618.563) [-617.310] * (-619.874) [-616.412] (-615.901) (-619.354) -- 0:00:34
      428500 -- (-617.515) (-623.179) [-618.972] (-615.935) * (-619.042) [-618.270] (-617.301) (-616.688) -- 0:00:34
      429000 -- (-616.945) (-616.359) (-616.140) [-616.085] * (-617.857) (-621.543) [-615.878] (-615.719) -- 0:00:34
      429500 -- (-618.201) (-621.516) [-616.328] (-618.735) * (-624.743) [-617.157] (-615.535) (-618.726) -- 0:00:34
      430000 -- [-622.586] (-615.816) (-617.789) (-619.961) * [-618.003] (-616.036) (-618.311) (-617.740) -- 0:00:34

      Average standard deviation of split frequencies: 0.012749

      430500 -- (-619.285) (-616.326) [-616.588] (-615.519) * (-618.781) (-618.104) (-616.398) [-618.659] -- 0:00:34
      431000 -- (-619.409) [-615.994] (-617.015) (-616.881) * (-616.749) [-615.741] (-620.143) (-618.748) -- 0:00:34
      431500 -- (-617.701) (-617.228) [-616.208] (-616.640) * (-616.331) [-617.156] (-616.764) (-616.562) -- 0:00:34
      432000 -- [-617.813] (-620.974) (-617.818) (-616.779) * (-617.960) (-616.620) (-618.410) [-618.587] -- 0:00:34
      432500 -- (-619.218) [-617.062] (-616.499) (-616.299) * (-617.140) [-615.853] (-621.119) (-615.794) -- 0:00:34
      433000 -- (-617.021) (-616.831) (-615.606) [-616.203] * [-620.194] (-616.937) (-617.526) (-618.437) -- 0:00:34
      433500 -- (-615.788) [-616.087] (-625.322) (-618.614) * [-615.768] (-619.787) (-617.932) (-617.196) -- 0:00:33
      434000 -- (-616.239) (-616.213) [-616.310] (-615.630) * (-615.977) [-617.720] (-618.294) (-616.270) -- 0:00:33
      434500 -- [-618.471] (-620.345) (-619.475) (-617.069) * (-616.805) [-618.982] (-617.024) (-616.503) -- 0:00:33
      435000 -- (-620.514) (-616.431) (-619.154) [-620.082] * (-618.305) (-617.608) [-616.746] (-619.865) -- 0:00:33

      Average standard deviation of split frequencies: 0.012338

      435500 -- (-619.067) (-619.855) [-617.374] (-617.447) * (-618.705) [-627.361] (-615.986) (-617.931) -- 0:00:33
      436000 -- (-617.687) [-617.812] (-616.879) (-615.498) * (-616.880) (-618.533) [-615.571] (-618.041) -- 0:00:33
      436500 -- (-617.586) (-620.047) (-618.633) [-615.642] * [-618.340] (-618.880) (-617.390) (-620.506) -- 0:00:33
      437000 -- (-618.603) (-618.034) (-617.257) [-616.426] * (-619.256) (-618.721) (-616.869) [-617.448] -- 0:00:33
      437500 -- (-616.244) (-618.699) (-617.129) [-616.021] * (-618.116) (-619.075) [-616.539] (-620.932) -- 0:00:33
      438000 -- (-615.609) [-615.995] (-617.596) (-618.676) * (-617.146) (-619.900) (-616.016) [-619.522] -- 0:00:34
      438500 -- (-621.705) [-616.864] (-619.683) (-617.395) * [-615.700] (-620.380) (-621.252) (-617.810) -- 0:00:34
      439000 -- [-620.334] (-616.075) (-616.432) (-615.751) * (-618.830) (-619.608) (-617.973) [-616.885] -- 0:00:34
      439500 -- [-618.319] (-615.670) (-616.527) (-615.751) * (-616.667) (-620.110) (-615.917) [-619.866] -- 0:00:34
      440000 -- (-617.558) (-616.868) [-615.829] (-617.507) * (-618.984) (-616.161) [-618.792] (-617.317) -- 0:00:34

      Average standard deviation of split frequencies: 0.011453

      440500 -- (-616.482) (-615.918) (-616.472) [-615.953] * (-617.368) (-615.918) [-617.295] (-617.046) -- 0:00:34
      441000 -- (-616.281) (-616.576) [-617.958] (-617.060) * (-617.946) (-617.072) (-617.847) [-618.435] -- 0:00:34
      441500 -- (-616.727) (-616.268) [-621.471] (-619.194) * (-616.019) [-618.406] (-616.395) (-617.247) -- 0:00:34
      442000 -- (-619.103) (-616.035) (-620.177) [-617.590] * [-616.571] (-616.511) (-616.944) (-616.430) -- 0:00:34
      442500 -- (-619.673) [-615.783] (-618.945) (-617.234) * (-621.743) [-617.678] (-617.108) (-615.789) -- 0:00:34
      443000 -- (-623.107) [-617.139] (-618.508) (-615.824) * (-620.375) [-619.703] (-617.725) (-619.072) -- 0:00:33
      443500 -- (-616.933) [-617.751] (-621.129) (-615.672) * [-617.971] (-618.039) (-620.200) (-617.003) -- 0:00:33
      444000 -- (-617.093) (-620.213) (-619.299) [-617.012] * (-620.865) (-615.781) (-620.876) [-619.165] -- 0:00:33
      444500 -- (-619.127) (-620.509) (-618.155) [-618.554] * (-618.230) (-620.676) [-620.181] (-617.024) -- 0:00:33
      445000 -- (-616.072) [-616.938] (-618.335) (-619.718) * [-616.234] (-626.048) (-620.859) (-618.523) -- 0:00:33

      Average standard deviation of split frequencies: 0.012373

      445500 -- (-616.032) [-616.201] (-615.650) (-617.237) * (-618.336) (-617.270) (-617.153) [-617.384] -- 0:00:33
      446000 -- (-620.144) (-619.567) (-620.922) [-615.865] * (-617.315) [-616.408] (-617.527) (-619.111) -- 0:00:33
      446500 -- (-620.940) (-618.900) (-617.330) [-615.593] * (-619.899) [-616.859] (-617.124) (-617.752) -- 0:00:33
      447000 -- (-619.077) (-618.043) (-620.653) [-619.766] * [-616.453] (-616.186) (-615.758) (-617.376) -- 0:00:33
      447500 -- [-616.026] (-617.496) (-617.062) (-616.408) * [-616.153] (-615.969) (-618.779) (-620.508) -- 0:00:33
      448000 -- (-616.151) (-617.873) [-616.959] (-616.564) * (-616.910) [-620.536] (-616.659) (-616.899) -- 0:00:33
      448500 -- (-619.016) (-616.886) [-616.051] (-616.124) * (-616.572) (-617.864) [-619.342] (-617.051) -- 0:00:33
      449000 -- [-622.120] (-617.623) (-618.527) (-616.166) * (-618.953) [-617.757] (-617.404) (-616.964) -- 0:00:33
      449500 -- (-617.087) (-615.582) [-619.833] (-617.777) * (-618.041) (-616.860) (-619.793) [-615.863] -- 0:00:33
      450000 -- (-620.551) [-615.841] (-617.430) (-616.749) * (-618.981) (-616.251) (-616.026) [-616.212] -- 0:00:33

      Average standard deviation of split frequencies: 0.011998

      450500 -- [-616.978] (-619.374) (-616.614) (-617.172) * [-617.193] (-616.846) (-615.843) (-617.896) -- 0:00:32
      451000 -- (-620.521) (-617.963) [-624.424] (-616.902) * (-621.706) [-616.691] (-616.519) (-619.571) -- 0:00:32
      451500 -- (-620.196) (-618.706) [-616.129] (-618.465) * (-617.476) (-616.319) (-620.060) [-616.822] -- 0:00:32
      452000 -- (-615.524) [-617.377] (-620.656) (-616.204) * (-619.888) (-615.931) [-615.912] (-617.361) -- 0:00:32
      452500 -- (-618.007) (-616.988) (-620.062) [-619.019] * [-617.005] (-618.502) (-618.121) (-618.516) -- 0:00:32
      453000 -- [-617.781] (-617.639) (-620.751) (-616.642) * (-618.009) (-619.347) [-624.265] (-618.332) -- 0:00:32
      453500 -- [-620.725] (-617.681) (-616.552) (-618.457) * (-619.288) (-618.720) [-621.010] (-617.679) -- 0:00:32
      454000 -- (-616.922) (-617.054) [-616.357] (-616.584) * [-617.209] (-620.733) (-618.483) (-619.336) -- 0:00:32
      454500 -- [-616.929] (-617.533) (-618.370) (-619.626) * (-616.359) [-621.131] (-619.167) (-621.023) -- 0:00:32
      455000 -- [-615.411] (-619.433) (-619.727) (-616.602) * (-617.183) (-620.228) (-618.949) [-616.731] -- 0:00:33

      Average standard deviation of split frequencies: 0.012709

      455500 -- [-615.783] (-621.119) (-616.023) (-618.126) * (-619.555) (-618.151) [-619.000] (-619.209) -- 0:00:33
      456000 -- [-615.968] (-616.930) (-616.918) (-617.505) * [-617.311] (-617.918) (-619.110) (-619.124) -- 0:00:33
      456500 -- (-620.340) (-617.912) (-616.353) [-618.307] * (-617.321) (-617.185) (-622.066) [-617.162] -- 0:00:33
      457000 -- (-619.044) [-617.513] (-617.463) (-618.854) * [-617.369] (-616.669) (-618.689) (-617.668) -- 0:00:33
      457500 -- [-616.663] (-618.375) (-619.953) (-622.508) * (-619.096) (-616.008) (-616.404) [-617.682] -- 0:00:33
      458000 -- (-616.634) [-616.360] (-618.885) (-619.022) * (-620.089) (-616.628) [-617.063] (-619.360) -- 0:00:33
      458500 -- (-618.721) (-616.097) (-617.160) [-617.385] * (-619.159) (-617.948) (-617.136) [-616.310] -- 0:00:33
      459000 -- (-618.473) (-619.983) [-617.578] (-617.396) * [-619.280] (-619.786) (-620.137) (-616.126) -- 0:00:33
      459500 -- [-618.930] (-617.229) (-620.126) (-617.886) * (-618.247) (-623.858) (-618.408) [-615.779] -- 0:00:32
      460000 -- (-618.358) (-617.539) (-616.966) [-618.142] * (-616.460) (-616.896) [-616.058] (-617.196) -- 0:00:32

      Average standard deviation of split frequencies: 0.012882

      460500 -- (-619.639) (-616.980) [-616.958] (-617.791) * (-618.149) [-617.245] (-616.413) (-616.449) -- 0:00:32
      461000 -- (-617.545) (-617.027) (-616.555) [-616.561] * (-621.514) [-618.714] (-617.806) (-617.283) -- 0:00:32
      461500 -- (-616.546) (-617.069) (-619.849) [-616.079] * [-619.363] (-618.238) (-618.983) (-618.373) -- 0:00:32
      462000 -- (-620.930) (-616.035) [-615.627] (-617.370) * [-617.797] (-619.066) (-618.298) (-618.662) -- 0:00:32
      462500 -- (-616.835) (-617.639) [-618.737] (-618.045) * [-615.554] (-615.714) (-616.773) (-616.743) -- 0:00:32
      463000 -- (-615.768) (-617.861) [-622.875] (-623.055) * (-619.615) (-615.827) [-616.218] (-615.690) -- 0:00:32
      463500 -- [-615.593] (-617.513) (-619.729) (-619.477) * (-618.917) [-616.706] (-615.955) (-618.993) -- 0:00:32
      464000 -- [-619.121] (-619.717) (-617.282) (-616.610) * (-620.027) (-616.405) [-617.309] (-615.508) -- 0:00:32
      464500 -- (-616.006) (-618.305) [-617.399] (-618.505) * [-617.258] (-616.778) (-617.152) (-620.353) -- 0:00:32
      465000 -- [-616.003] (-617.594) (-617.865) (-616.568) * (-617.443) [-615.893] (-617.587) (-620.566) -- 0:00:32

      Average standard deviation of split frequencies: 0.013032

      465500 -- [-616.964] (-616.548) (-616.243) (-623.101) * (-622.170) [-618.344] (-620.205) (-616.720) -- 0:00:32
      466000 -- (-615.842) (-616.874) [-616.977] (-617.775) * (-616.752) (-616.351) (-615.407) [-615.433] -- 0:00:32
      466500 -- (-620.691) [-617.505] (-616.855) (-618.613) * (-619.914) [-616.475] (-616.980) (-616.652) -- 0:00:32
      467000 -- (-616.997) [-615.435] (-616.034) (-618.563) * (-618.989) (-618.044) [-623.838] (-618.394) -- 0:00:31
      467500 -- (-616.706) (-617.118) (-619.270) [-620.718] * (-620.634) [-618.604] (-621.606) (-618.080) -- 0:00:31
      468000 -- (-620.762) [-617.375] (-616.692) (-615.898) * [-619.807] (-618.947) (-618.495) (-616.990) -- 0:00:31
      468500 -- [-620.651] (-618.181) (-616.833) (-619.786) * (-621.425) (-617.842) [-618.050] (-622.273) -- 0:00:31
      469000 -- [-617.963] (-621.107) (-617.266) (-617.627) * (-617.863) [-617.600] (-617.048) (-617.610) -- 0:00:31
      469500 -- (-616.736) (-620.524) (-619.183) [-616.279] * (-622.362) [-618.370] (-617.188) (-618.518) -- 0:00:31
      470000 -- (-616.773) [-616.363] (-615.743) (-617.250) * [-617.974] (-617.032) (-616.222) (-617.342) -- 0:00:31

      Average standard deviation of split frequencies: 0.013433

      470500 -- (-619.174) (-616.641) [-616.694] (-618.799) * (-617.821) [-615.975] (-617.039) (-617.541) -- 0:00:31
      471000 -- (-617.927) [-617.064] (-616.457) (-616.810) * (-616.401) (-616.918) [-617.747] (-617.284) -- 0:00:31
      471500 -- (-615.300) (-616.627) (-617.789) [-616.510] * [-620.167] (-615.644) (-617.278) (-618.126) -- 0:00:32
      472000 -- (-618.005) (-617.458) (-619.112) [-621.568] * (-618.871) [-617.376] (-617.265) (-617.218) -- 0:00:32
      472500 -- [-619.441] (-618.190) (-619.499) (-618.334) * [-616.166] (-616.286) (-616.992) (-617.177) -- 0:00:32
      473000 -- [-616.334] (-619.398) (-617.158) (-623.341) * (-617.687) [-616.790] (-617.133) (-619.003) -- 0:00:32
      473500 -- (-616.980) [-616.673] (-616.932) (-622.573) * (-617.324) [-622.240] (-616.248) (-617.715) -- 0:00:32
      474000 -- (-616.681) (-617.933) [-618.473] (-617.697) * (-615.944) (-616.426) [-618.336] (-619.504) -- 0:00:32
      474500 -- (-615.992) [-618.641] (-618.410) (-620.421) * (-616.133) (-621.288) [-619.305] (-617.761) -- 0:00:32
      475000 -- (-619.663) [-617.333] (-618.827) (-620.022) * [-617.176] (-619.092) (-616.711) (-621.564) -- 0:00:32

      Average standard deviation of split frequencies: 0.012758

      475500 -- (-617.559) (-619.772) [-618.626] (-619.679) * (-617.742) [-618.170] (-617.339) (-621.504) -- 0:00:31
      476000 -- (-621.723) (-616.284) [-615.925] (-618.739) * (-618.294) (-619.077) (-617.095) [-616.526] -- 0:00:31
      476500 -- (-620.471) [-616.421] (-618.533) (-617.716) * (-617.391) (-617.564) (-618.111) [-617.119] -- 0:00:31
      477000 -- (-617.195) [-616.789] (-621.441) (-618.399) * [-621.241] (-616.715) (-620.415) (-616.720) -- 0:00:31
      477500 -- [-617.738] (-618.121) (-617.689) (-616.458) * (-617.496) (-618.298) (-620.635) [-615.490] -- 0:00:31
      478000 -- (-622.335) [-616.402] (-616.511) (-615.364) * [-616.133] (-616.216) (-621.731) (-616.883) -- 0:00:31
      478500 -- (-621.946) [-616.208] (-618.507) (-617.628) * (-620.657) [-616.667] (-618.321) (-617.464) -- 0:00:31
      479000 -- (-618.923) [-615.937] (-620.832) (-615.645) * [-619.436] (-618.962) (-616.755) (-620.075) -- 0:00:31
      479500 -- (-615.984) [-615.819] (-620.606) (-619.418) * (-616.609) (-615.505) [-623.215] (-617.970) -- 0:00:31
      480000 -- [-619.565] (-619.138) (-616.151) (-616.739) * [-616.941] (-617.925) (-620.127) (-619.535) -- 0:00:31

      Average standard deviation of split frequencies: 0.012634

      480500 -- (-617.563) [-616.267] (-616.786) (-623.529) * [-617.437] (-619.713) (-618.968) (-623.373) -- 0:00:31
      481000 -- [-616.629] (-617.484) (-618.779) (-620.497) * [-619.610] (-619.305) (-618.068) (-619.026) -- 0:00:31
      481500 -- (-619.700) (-619.534) (-618.198) [-622.232] * [-619.196] (-617.168) (-621.484) (-616.707) -- 0:00:31
      482000 -- (-616.690) (-616.980) (-620.148) [-618.018] * (-622.188) (-620.481) [-618.116] (-625.789) -- 0:00:31
      482500 -- [-619.248] (-615.543) (-616.513) (-621.314) * (-616.713) (-617.255) (-616.851) [-619.456] -- 0:00:31
      483000 -- (-618.832) [-618.364] (-619.584) (-619.911) * (-620.877) (-617.901) [-618.245] (-616.224) -- 0:00:31
      483500 -- (-621.772) [-617.221] (-618.981) (-616.770) * (-618.794) [-617.023] (-617.020) (-621.071) -- 0:00:30
      484000 -- (-616.118) (-617.666) [-617.141] (-618.110) * [-615.711] (-616.727) (-616.150) (-616.848) -- 0:00:30
      484500 -- (-616.337) [-618.494] (-617.304) (-617.961) * (-616.083) [-618.318] (-616.229) (-622.049) -- 0:00:30
      485000 -- (-615.826) [-616.289] (-617.443) (-618.456) * (-616.811) (-617.216) [-616.988] (-618.628) -- 0:00:30

      Average standard deviation of split frequencies: 0.012781

      485500 -- [-616.995] (-616.140) (-617.976) (-621.153) * (-621.878) (-618.187) (-618.234) [-617.198] -- 0:00:30
      486000 -- (-621.314) [-616.330] (-618.862) (-619.010) * [-615.764] (-618.058) (-619.741) (-617.005) -- 0:00:30
      486500 -- (-620.026) (-619.658) (-618.213) [-616.402] * (-616.520) [-617.597] (-618.149) (-619.368) -- 0:00:30
      487000 -- (-616.337) [-618.402] (-617.412) (-616.649) * [-616.189] (-617.415) (-617.857) (-621.359) -- 0:00:30
      487500 -- (-615.455) (-618.830) (-617.037) [-615.835] * (-619.554) (-616.517) (-616.215) [-620.582] -- 0:00:30
      488000 -- (-616.773) (-616.867) [-617.305] (-619.207) * (-617.482) (-617.128) [-616.416] (-619.801) -- 0:00:30
      488500 -- (-618.728) (-615.551) (-615.859) [-617.377] * (-619.304) (-617.635) [-615.714] (-616.413) -- 0:00:31
      489000 -- (-616.499) (-618.331) (-616.804) [-617.232] * (-617.804) (-619.661) (-617.325) [-617.647] -- 0:00:31
      489500 -- (-617.009) [-620.463] (-616.379) (-618.908) * [-618.103] (-618.268) (-616.226) (-620.160) -- 0:00:31
      490000 -- [-615.806] (-620.059) (-616.256) (-618.409) * (-617.862) [-617.048] (-615.953) (-617.725) -- 0:00:31

      Average standard deviation of split frequencies: 0.012772

      490500 -- (-616.869) (-618.917) (-616.481) [-619.089] * [-616.908] (-615.775) (-617.518) (-615.201) -- 0:00:31
      491000 -- [-616.683] (-618.744) (-617.114) (-616.872) * (-617.915) (-615.731) (-616.674) [-615.556] -- 0:00:31
      491500 -- [-615.998] (-618.247) (-617.135) (-621.530) * (-618.379) (-617.738) [-618.627] (-616.895) -- 0:00:31
      492000 -- (-616.228) (-617.679) [-618.632] (-617.567) * [-619.192] (-617.407) (-618.476) (-615.768) -- 0:00:30
      492500 -- (-617.560) [-616.892] (-615.960) (-616.866) * (-618.298) (-618.239) (-619.027) [-616.090] -- 0:00:30
      493000 -- (-617.260) [-616.900] (-615.922) (-618.861) * (-616.185) (-619.344) (-618.210) [-616.090] -- 0:00:30
      493500 -- (-618.242) [-616.663] (-619.696) (-619.780) * [-616.126] (-617.939) (-616.070) (-616.196) -- 0:00:30
      494000 -- [-615.736] (-618.224) (-617.330) (-621.671) * [-615.496] (-618.062) (-621.957) (-619.037) -- 0:00:30
      494500 -- (-617.826) (-616.789) (-617.526) [-616.014] * (-615.532) [-618.329] (-619.363) (-617.233) -- 0:00:30
      495000 -- (-616.293) (-617.436) [-618.400] (-616.191) * (-619.123) (-616.694) [-618.179] (-615.822) -- 0:00:30

      Average standard deviation of split frequencies: 0.012299

      495500 -- (-617.131) (-616.239) [-615.682] (-617.410) * (-618.903) (-616.848) [-617.152] (-616.081) -- 0:00:30
      496000 -- (-617.525) (-615.899) [-617.660] (-617.765) * (-618.195) (-615.699) [-617.455] (-616.924) -- 0:00:30
      496500 -- (-618.557) [-618.375] (-618.126) (-621.434) * (-617.202) [-616.283] (-618.096) (-617.626) -- 0:00:30
      497000 -- [-621.244] (-616.991) (-616.296) (-619.973) * (-617.076) (-618.701) (-619.953) [-617.229] -- 0:00:30
      497500 -- (-620.247) [-618.083] (-615.696) (-616.630) * (-622.187) (-619.336) [-618.115] (-616.382) -- 0:00:30
      498000 -- [-615.866] (-616.834) (-618.055) (-616.333) * (-617.473) (-616.813) (-617.258) [-619.838] -- 0:00:30
      498500 -- (-615.769) (-617.103) [-617.724] (-616.097) * (-616.586) (-619.017) [-617.878] (-617.134) -- 0:00:30
      499000 -- [-615.743] (-616.247) (-617.024) (-615.330) * (-617.208) [-622.247] (-617.516) (-615.711) -- 0:00:30
      499500 -- (-615.200) [-617.142] (-616.650) (-615.998) * [-616.495] (-620.331) (-616.217) (-616.435) -- 0:00:30
      500000 -- (-620.563) (-617.597) (-616.889) [-615.525] * (-620.043) [-616.210] (-617.023) (-617.927) -- 0:00:30

      Average standard deviation of split frequencies: 0.011652

      500500 -- (-617.858) [-617.031] (-617.988) (-615.984) * [-619.322] (-619.666) (-617.187) (-619.030) -- 0:00:29
      501000 -- (-618.944) [-616.013] (-617.672) (-618.972) * (-617.870) (-620.863) [-616.512] (-621.086) -- 0:00:29
      501500 -- (-616.158) (-616.705) [-617.475] (-617.894) * [-617.371] (-617.523) (-618.449) (-620.875) -- 0:00:29
      502000 -- (-619.001) (-618.079) (-616.512) [-615.690] * (-615.928) [-616.131] (-618.097) (-617.977) -- 0:00:29
      502500 -- [-617.697] (-617.854) (-617.636) (-620.427) * (-618.540) (-617.024) (-616.025) [-616.981] -- 0:00:29
      503000 -- (-616.419) (-618.330) [-616.997] (-618.452) * (-619.754) (-616.971) [-618.890] (-616.133) -- 0:00:29
      503500 -- (-617.409) (-620.575) (-616.239) [-619.574] * (-618.549) (-617.555) [-621.465] (-616.957) -- 0:00:29
      504000 -- (-617.449) (-615.965) [-617.444] (-617.064) * (-619.262) (-618.338) (-617.259) [-617.322] -- 0:00:29
      504500 -- (-615.963) [-619.998] (-618.369) (-617.246) * [-617.568] (-617.047) (-618.116) (-619.885) -- 0:00:29
      505000 -- [-617.820] (-616.718) (-618.088) (-617.238) * (-617.111) (-616.724) [-616.311] (-619.933) -- 0:00:30

      Average standard deviation of split frequencies: 0.011878

      505500 -- (-619.987) [-616.318] (-617.749) (-619.044) * (-616.283) (-618.406) (-620.280) [-615.633] -- 0:00:30
      506000 -- [-618.069] (-618.341) (-615.358) (-620.847) * (-617.052) (-618.505) [-617.871] (-616.219) -- 0:00:30
      506500 -- (-616.927) [-617.531] (-616.844) (-619.030) * [-616.621] (-616.419) (-616.448) (-616.181) -- 0:00:30
      507000 -- [-620.485] (-619.480) (-618.304) (-617.207) * (-619.166) (-617.236) (-616.094) [-619.174] -- 0:00:30
      507500 -- (-618.323) [-618.743] (-619.106) (-616.707) * (-616.556) (-616.652) (-617.398) [-618.425] -- 0:00:30
      508000 -- (-616.491) (-617.814) (-622.280) [-617.065] * [-616.658] (-618.490) (-619.742) (-616.213) -- 0:00:30
      508500 -- (-615.808) (-620.392) [-620.346] (-616.263) * [-617.904] (-617.963) (-618.984) (-616.222) -- 0:00:29
      509000 -- (-617.956) (-621.155) [-620.968] (-617.558) * [-618.040] (-617.976) (-618.483) (-617.322) -- 0:00:29
      509500 -- (-615.910) (-624.663) [-619.638] (-616.390) * (-616.002) (-621.298) (-617.256) [-618.296] -- 0:00:29
      510000 -- [-617.880] (-620.461) (-617.101) (-616.558) * (-618.434) (-615.832) (-618.708) [-618.823] -- 0:00:29

      Average standard deviation of split frequencies: 0.011250

      510500 -- (-619.978) (-618.962) [-616.722] (-619.820) * [-617.726] (-615.417) (-616.673) (-620.420) -- 0:00:29
      511000 -- (-621.311) [-619.036] (-617.010) (-619.703) * (-618.683) (-616.574) (-616.336) [-621.737] -- 0:00:29
      511500 -- (-619.292) [-615.677] (-616.843) (-618.854) * [-617.412] (-617.774) (-617.113) (-616.443) -- 0:00:29
      512000 -- [-616.383] (-616.718) (-617.704) (-616.024) * [-617.335] (-618.057) (-615.630) (-615.760) -- 0:00:29
      512500 -- (-619.582) (-619.911) (-616.446) [-615.857] * (-620.395) (-619.399) (-617.521) [-616.239] -- 0:00:29
      513000 -- (-618.969) (-616.063) (-618.779) [-617.577] * [-618.120] (-626.589) (-616.990) (-618.941) -- 0:00:29
      513500 -- [-617.090] (-620.988) (-619.328) (-616.932) * (-617.802) [-616.697] (-616.942) (-616.954) -- 0:00:29
      514000 -- (-615.839) [-620.942] (-619.801) (-618.118) * (-616.013) (-616.114) (-620.691) [-615.790] -- 0:00:29
      514500 -- (-619.243) (-619.877) (-616.605) [-617.137] * [-615.600] (-621.245) (-617.414) (-617.689) -- 0:00:29
      515000 -- (-617.652) (-618.315) (-615.460) [-618.184] * (-615.971) [-616.922] (-619.689) (-617.328) -- 0:00:29

      Average standard deviation of split frequencies: 0.011077

      515500 -- (-619.570) (-617.559) (-618.212) [-617.043] * (-615.790) [-616.871] (-615.671) (-619.785) -- 0:00:29
      516000 -- [-617.681] (-620.514) (-619.765) (-620.631) * (-618.845) (-617.110) (-617.563) [-617.881] -- 0:00:29
      516500 -- [-615.817] (-618.194) (-623.399) (-617.746) * [-618.738] (-617.966) (-617.919) (-620.491) -- 0:00:29
      517000 -- (-616.070) (-617.342) (-618.307) [-618.633] * (-617.091) (-615.988) (-616.979) [-616.841] -- 0:00:28
      517500 -- [-616.017] (-619.579) (-617.914) (-622.001) * (-616.090) (-615.941) (-619.637) [-616.921] -- 0:00:28
      518000 -- (-617.152) [-619.574] (-616.594) (-619.104) * (-618.393) [-617.030] (-622.832) (-618.713) -- 0:00:28
      518500 -- (-618.896) (-624.588) (-617.071) [-619.418] * (-616.707) (-619.791) [-618.814] (-616.069) -- 0:00:28
      519000 -- (-618.882) (-625.308) (-617.094) [-616.333] * (-619.307) (-618.409) (-619.239) [-617.269] -- 0:00:28
      519500 -- [-619.104] (-616.262) (-617.918) (-617.810) * [-616.511] (-622.883) (-620.778) (-616.678) -- 0:00:28
      520000 -- [-616.568] (-621.756) (-617.472) (-615.589) * (-618.318) (-616.253) (-617.772) [-618.413] -- 0:00:28

      Average standard deviation of split frequencies: 0.010921

      520500 -- (-617.234) (-618.694) (-619.689) [-616.052] * [-618.846] (-619.097) (-621.516) (-620.332) -- 0:00:28
      521000 -- [-619.176] (-621.542) (-618.870) (-618.039) * (-618.898) (-618.860) (-620.171) [-618.222] -- 0:00:28
      521500 -- (-616.091) [-617.279] (-620.024) (-615.851) * [-616.198] (-621.815) (-618.045) (-622.376) -- 0:00:28
      522000 -- [-617.877] (-616.298) (-618.742) (-617.057) * (-616.488) (-616.919) [-618.644] (-615.750) -- 0:00:29
      522500 -- (-617.687) (-617.376) (-616.553) [-615.641] * (-616.303) (-619.878) [-617.891] (-615.912) -- 0:00:29
      523000 -- (-617.772) [-617.636] (-617.537) (-618.225) * (-617.474) [-617.659] (-618.397) (-619.635) -- 0:00:29
      523500 -- (-615.671) (-616.293) [-616.865] (-617.157) * (-621.692) (-618.919) (-618.550) [-618.948] -- 0:00:29
      524000 -- (-616.162) (-617.357) (-617.368) [-618.410] * (-627.741) [-617.329] (-618.241) (-618.807) -- 0:00:29
      524500 -- [-616.381] (-616.227) (-620.178) (-618.288) * (-619.988) (-616.694) (-618.330) [-619.654] -- 0:00:29
      525000 -- [-616.133] (-618.308) (-617.244) (-619.126) * [-615.948] (-616.405) (-617.734) (-615.963) -- 0:00:28

      Average standard deviation of split frequencies: 0.011035

      525500 -- [-616.154] (-617.378) (-622.638) (-616.365) * (-616.218) (-616.810) [-615.843] (-616.536) -- 0:00:28
      526000 -- (-617.065) (-616.919) [-617.147] (-617.375) * [-617.158] (-616.427) (-615.985) (-620.470) -- 0:00:28
      526500 -- [-620.450] (-617.988) (-619.128) (-620.372) * (-619.336) [-615.643] (-616.820) (-615.901) -- 0:00:28
      527000 -- [-622.147] (-620.839) (-617.714) (-618.764) * (-617.602) [-616.043] (-616.077) (-615.320) -- 0:00:28
      527500 -- (-621.234) (-620.285) (-617.794) [-618.587] * (-620.128) [-617.702] (-623.831) (-616.976) -- 0:00:28
      528000 -- (-618.523) (-619.253) [-617.083] (-619.159) * (-620.078) (-617.472) (-616.969) [-617.102] -- 0:00:28
      528500 -- (-619.051) (-619.728) (-616.156) [-617.217] * (-621.834) (-618.104) [-621.115] (-617.655) -- 0:00:28
      529000 -- [-616.236] (-617.257) (-616.971) (-617.194) * (-621.874) [-619.702] (-616.663) (-619.048) -- 0:00:28
      529500 -- (-616.789) (-617.142) (-615.267) [-619.317] * (-616.562) (-617.790) [-618.221] (-619.292) -- 0:00:28
      530000 -- (-620.000) (-616.963) [-615.609] (-619.599) * (-617.424) [-616.675] (-616.254) (-621.940) -- 0:00:28

      Average standard deviation of split frequencies: 0.011271

      530500 -- (-618.383) [-617.730] (-616.894) (-619.488) * [-618.157] (-620.551) (-616.854) (-617.906) -- 0:00:28
      531000 -- [-616.363] (-617.163) (-616.510) (-618.999) * (-616.443) (-615.889) [-617.289] (-616.198) -- 0:00:28
      531500 -- (-619.971) [-615.543] (-618.766) (-615.636) * (-617.654) [-617.489] (-618.732) (-617.230) -- 0:00:28
      532000 -- (-618.010) (-616.856) (-616.616) [-618.795] * [-617.556] (-618.684) (-618.670) (-619.761) -- 0:00:28
      532500 -- (-616.610) [-617.397] (-622.076) (-616.433) * (-616.717) (-620.441) (-616.836) [-616.180] -- 0:00:28
      533000 -- (-619.008) (-618.574) [-615.882] (-617.645) * (-618.530) [-617.220] (-617.187) (-618.459) -- 0:00:28
      533500 -- (-617.213) (-617.340) [-616.227] (-619.375) * (-618.461) (-618.439) [-616.095] (-616.155) -- 0:00:27
      534000 -- (-619.086) (-619.389) [-617.815] (-617.119) * (-619.704) (-617.030) [-617.703] (-615.711) -- 0:00:27
      534500 -- (-619.632) (-615.818) (-617.208) [-617.114] * [-618.909] (-619.128) (-619.176) (-615.520) -- 0:00:27
      535000 -- (-616.774) [-616.023] (-619.439) (-617.596) * (-618.166) (-618.945) (-619.785) [-616.073] -- 0:00:27

      Average standard deviation of split frequencies: 0.011158

      535500 -- (-618.919) [-616.845] (-617.896) (-617.044) * [-618.892] (-616.464) (-621.756) (-616.591) -- 0:00:27
      536000 -- (-617.629) (-619.901) (-617.828) [-618.252] * [-616.306] (-617.353) (-623.356) (-618.830) -- 0:00:27
      536500 -- (-617.129) (-619.476) [-617.227] (-617.270) * (-617.235) [-616.916] (-620.521) (-620.555) -- 0:00:27
      537000 -- [-620.016] (-620.769) (-617.557) (-616.481) * (-618.884) (-617.372) [-618.951] (-615.988) -- 0:00:27
      537500 -- (-615.887) [-618.318] (-616.361) (-617.732) * [-618.052] (-616.390) (-617.301) (-616.434) -- 0:00:27
      538000 -- (-617.877) [-619.226] (-617.402) (-618.159) * (-619.307) (-616.603) [-620.394] (-620.199) -- 0:00:27
      538500 -- (-618.342) [-619.930] (-618.105) (-616.809) * [-618.869] (-616.460) (-617.059) (-620.358) -- 0:00:27
      539000 -- (-616.232) [-616.685] (-616.895) (-618.894) * (-619.106) (-617.194) [-618.166] (-618.196) -- 0:00:28
      539500 -- (-622.930) [-618.131] (-618.557) (-619.310) * (-618.430) (-618.414) (-617.005) [-621.180] -- 0:00:28
      540000 -- (-617.265) (-617.054) (-619.248) [-622.275] * (-615.789) [-616.840] (-615.506) (-617.292) -- 0:00:28

      Average standard deviation of split frequencies: 0.010626

      540500 -- (-623.704) (-617.177) (-617.288) [-619.232] * (-617.563) (-616.592) [-616.385] (-617.998) -- 0:00:28
      541000 -- [-616.654] (-618.792) (-620.011) (-616.309) * (-616.323) [-619.195] (-617.871) (-618.310) -- 0:00:27
      541500 -- [-617.157] (-616.758) (-616.946) (-618.070) * (-621.343) (-617.996) (-617.461) [-616.321] -- 0:00:27
      542000 -- (-617.004) [-617.980] (-616.894) (-619.354) * [-618.317] (-616.014) (-615.908) (-617.054) -- 0:00:27
      542500 -- (-619.231) (-616.437) (-616.029) [-619.217] * (-620.215) (-616.564) [-615.620] (-617.376) -- 0:00:27
      543000 -- (-617.717) (-618.129) [-616.119] (-620.946) * (-616.422) (-617.599) (-615.548) [-617.022] -- 0:00:27
      543500 -- [-618.239] (-618.043) (-617.462) (-621.241) * (-620.542) [-616.651] (-619.148) (-619.633) -- 0:00:27
      544000 -- (-618.037) (-617.464) [-617.945] (-617.000) * (-618.487) [-616.843] (-620.177) (-616.151) -- 0:00:27
      544500 -- (-618.953) [-617.843] (-617.176) (-617.611) * (-618.829) (-616.087) [-616.156] (-617.274) -- 0:00:27
      545000 -- (-617.545) (-617.263) [-615.826] (-619.217) * (-618.962) (-616.277) (-619.786) [-615.770] -- 0:00:27

      Average standard deviation of split frequencies: 0.010145

      545500 -- (-617.393) (-616.410) [-618.966] (-618.854) * (-618.299) [-616.314] (-621.233) (-616.920) -- 0:00:27
      546000 -- [-616.739] (-618.886) (-622.783) (-619.755) * (-617.316) (-618.310) [-616.652] (-618.392) -- 0:00:27
      546500 -- (-616.582) (-617.056) (-619.794) [-618.160] * [-619.822] (-620.907) (-620.821) (-616.869) -- 0:00:27
      547000 -- [-617.328] (-618.738) (-619.014) (-616.289) * (-616.195) (-617.060) [-617.020] (-615.676) -- 0:00:27
      547500 -- [-616.220] (-618.867) (-620.574) (-617.144) * (-621.809) (-620.896) [-616.794] (-615.682) -- 0:00:27
      548000 -- [-617.246] (-617.956) (-619.000) (-617.420) * (-619.855) (-617.742) (-616.093) [-617.160] -- 0:00:27
      548500 -- [-618.300] (-622.396) (-616.962) (-617.133) * (-617.096) (-619.100) (-617.177) [-617.350] -- 0:00:27
      549000 -- (-618.090) (-618.863) [-617.627] (-621.026) * [-617.823] (-615.474) (-620.177) (-618.650) -- 0:00:27
      549500 -- [-617.197] (-618.724) (-621.151) (-618.684) * (-618.764) (-621.572) [-619.072] (-620.151) -- 0:00:27
      550000 -- [-621.300] (-619.854) (-617.183) (-619.045) * (-616.595) (-616.106) (-619.458) [-618.181] -- 0:00:27

      Average standard deviation of split frequencies: 0.010433

      550500 -- (-617.408) [-618.851] (-617.512) (-620.308) * [-616.552] (-616.768) (-617.751) (-617.663) -- 0:00:26
      551000 -- (-619.712) (-617.025) [-616.239] (-622.440) * (-616.658) [-616.117] (-617.480) (-619.961) -- 0:00:26
      551500 -- (-616.228) (-617.198) [-619.366] (-619.139) * (-621.693) (-617.892) (-617.353) [-617.457] -- 0:00:26
      552000 -- [-616.231] (-617.810) (-617.162) (-619.775) * (-625.824) (-619.530) (-620.609) [-620.974] -- 0:00:26
      552500 -- [-617.806] (-615.754) (-616.340) (-622.334) * [-616.661] (-617.209) (-621.438) (-621.345) -- 0:00:26
      553000 -- [-617.303] (-617.929) (-616.855) (-615.783) * (-616.410) (-615.898) (-620.763) [-617.185] -- 0:00:26
      553500 -- [-615.891] (-616.777) (-620.414) (-615.791) * (-617.512) (-617.727) (-619.926) [-617.647] -- 0:00:26
      554000 -- (-618.695) (-616.681) [-617.651] (-617.674) * (-615.865) [-618.045] (-619.586) (-616.222) -- 0:00:26
      554500 -- [-617.249] (-618.746) (-617.199) (-617.527) * (-615.846) (-618.641) (-617.550) [-616.977] -- 0:00:26
      555000 -- (-622.198) (-617.780) [-618.812] (-616.453) * (-618.648) (-618.302) [-615.848] (-623.428) -- 0:00:26

      Average standard deviation of split frequencies: 0.010492

      555500 -- [-616.876] (-616.431) (-617.420) (-620.003) * [-618.816] (-621.887) (-615.723) (-618.861) -- 0:00:27
      556000 -- (-616.869) (-623.958) (-616.628) [-618.708] * (-616.985) [-617.569] (-619.732) (-618.646) -- 0:00:27
      556500 -- [-618.444] (-619.252) (-617.359) (-620.105) * (-616.640) (-616.623) (-616.642) [-616.357] -- 0:00:27
      557000 -- (-619.543) [-620.016] (-618.889) (-623.429) * (-616.704) (-619.298) [-616.636] (-616.362) -- 0:00:27
      557500 -- [-616.965] (-617.855) (-616.599) (-616.240) * (-620.837) (-615.899) [-615.991] (-619.016) -- 0:00:26
      558000 -- [-615.772] (-616.503) (-617.832) (-618.061) * (-615.987) (-620.241) (-616.868) [-618.224] -- 0:00:26
      558500 -- [-615.880] (-617.739) (-619.654) (-618.634) * (-619.309) (-617.288) (-618.543) [-617.877] -- 0:00:26
      559000 -- (-623.016) [-616.087] (-622.537) (-617.932) * (-618.452) (-619.216) [-615.498] (-618.430) -- 0:00:26
      559500 -- [-620.982] (-616.947) (-621.303) (-616.066) * [-618.999] (-618.186) (-617.262) (-618.696) -- 0:00:26
      560000 -- [-617.288] (-620.731) (-616.831) (-617.691) * (-618.421) (-615.575) (-618.292) [-618.016] -- 0:00:26

      Average standard deviation of split frequencies: 0.010352

      560500 -- (-618.063) (-619.061) [-618.132] (-619.662) * [-617.582] (-617.300) (-618.825) (-617.814) -- 0:00:26
      561000 -- [-618.332] (-616.826) (-616.619) (-617.161) * (-618.571) (-620.630) [-619.418] (-619.041) -- 0:00:26
      561500 -- (-618.928) (-617.263) (-616.169) [-615.717] * (-618.048) (-618.778) [-618.136] (-616.749) -- 0:00:26
      562000 -- (-616.335) [-618.041] (-619.316) (-616.972) * [-616.626] (-619.366) (-616.650) (-617.317) -- 0:00:26
      562500 -- (-618.665) (-619.449) (-623.777) [-618.180] * (-616.330) (-617.902) (-617.805) [-617.629] -- 0:00:26
      563000 -- (-623.371) [-618.445] (-618.869) (-619.003) * (-616.860) [-617.532] (-615.564) (-616.890) -- 0:00:26
      563500 -- (-618.785) (-617.615) [-617.358] (-617.471) * (-619.736) (-616.448) [-616.604] (-618.037) -- 0:00:26
      564000 -- (-618.463) (-619.609) [-617.298] (-617.594) * (-615.939) [-615.978] (-616.318) (-618.114) -- 0:00:26
      564500 -- (-616.433) (-616.875) [-616.165] (-615.948) * (-616.566) (-618.456) (-617.974) [-620.092] -- 0:00:26
      565000 -- (-619.411) [-616.876] (-615.893) (-616.339) * (-621.191) (-616.366) [-615.651] (-618.533) -- 0:00:26

      Average standard deviation of split frequencies: 0.010411

      565500 -- [-615.994] (-621.168) (-618.081) (-615.324) * (-620.516) (-615.628) (-618.707) [-620.108] -- 0:00:26
      566000 -- (-615.813) [-617.646] (-615.802) (-615.807) * [-615.694] (-617.864) (-619.958) (-619.704) -- 0:00:26
      566500 -- (-617.404) [-617.505] (-620.019) (-616.178) * (-616.377) [-619.032] (-616.211) (-620.027) -- 0:00:26
      567000 -- [-618.600] (-616.808) (-617.034) (-616.099) * (-617.087) (-616.101) [-617.007] (-618.849) -- 0:00:25
      567500 -- (-615.522) (-617.695) (-618.641) [-617.140] * (-618.373) (-615.928) [-618.643] (-621.596) -- 0:00:25
      568000 -- [-615.674] (-618.007) (-616.673) (-617.337) * [-618.934] (-616.204) (-615.779) (-617.515) -- 0:00:25
      568500 -- [-615.674] (-616.102) (-617.396) (-617.186) * [-617.323] (-616.889) (-615.922) (-617.693) -- 0:00:25
      569000 -- (-618.356) (-619.226) [-615.804] (-618.127) * (-618.633) (-617.924) (-616.418) [-616.978] -- 0:00:25
      569500 -- [-617.542] (-618.616) (-618.030) (-616.222) * [-619.906] (-617.891) (-617.061) (-618.091) -- 0:00:25
      570000 -- [-619.406] (-618.748) (-617.891) (-620.638) * (-619.264) [-617.761] (-619.920) (-622.451) -- 0:00:25

      Average standard deviation of split frequencies: 0.010629

      570500 -- (-617.397) (-617.298) [-615.843] (-619.548) * [-615.808] (-616.380) (-618.008) (-620.064) -- 0:00:25
      571000 -- [-617.329] (-619.657) (-617.227) (-617.139) * (-618.709) (-615.839) [-616.097] (-620.229) -- 0:00:25
      571500 -- (-618.085) (-616.960) (-617.366) [-617.726] * (-619.270) [-617.262] (-616.661) (-618.339) -- 0:00:25
      572000 -- (-618.481) [-616.017] (-617.399) (-619.802) * (-617.097) (-618.865) [-617.027] (-619.428) -- 0:00:26
      572500 -- (-621.669) (-619.141) [-618.506] (-620.085) * (-616.450) (-617.707) [-618.633] (-629.975) -- 0:00:26
      573000 -- (-618.694) (-620.357) [-615.743] (-619.696) * [-616.423] (-621.935) (-618.492) (-617.971) -- 0:00:26
      573500 -- (-620.775) [-616.886] (-618.692) (-617.466) * (-617.841) (-618.289) (-617.428) [-616.666] -- 0:00:26
      574000 -- (-617.465) [-616.022] (-620.639) (-617.327) * [-617.113] (-620.813) (-620.942) (-618.261) -- 0:00:25
      574500 -- (-617.481) (-616.425) (-618.926) [-622.263] * (-618.344) (-617.786) (-621.156) [-617.330] -- 0:00:25
      575000 -- [-619.958] (-625.840) (-618.309) (-619.605) * (-617.599) [-618.502] (-618.406) (-618.935) -- 0:00:25

      Average standard deviation of split frequencies: 0.010748

      575500 -- [-617.073] (-620.082) (-619.939) (-620.540) * (-619.217) [-616.979] (-618.506) (-617.235) -- 0:00:25
      576000 -- [-617.431] (-616.501) (-618.038) (-617.008) * (-619.582) (-616.807) [-617.184] (-621.995) -- 0:00:25
      576500 -- (-616.184) (-615.932) [-619.652] (-615.594) * (-619.495) [-619.225] (-619.941) (-617.034) -- 0:00:25
      577000 -- (-617.011) (-615.508) (-626.130) [-615.553] * (-617.396) [-619.545] (-617.456) (-622.331) -- 0:00:25
      577500 -- (-618.918) (-618.180) [-622.945] (-616.112) * (-619.915) (-616.649) (-617.275) [-618.812] -- 0:00:25
      578000 -- (-616.113) [-616.710] (-616.168) (-615.410) * (-615.905) [-617.239] (-616.500) (-618.593) -- 0:00:25
      578500 -- [-616.529] (-616.356) (-618.317) (-617.839) * (-618.067) (-617.964) (-617.308) [-619.339] -- 0:00:25
      579000 -- (-615.992) [-617.795] (-617.309) (-617.676) * (-618.311) (-618.358) (-616.567) [-617.921] -- 0:00:25
      579500 -- [-621.530] (-616.481) (-617.682) (-617.733) * (-617.598) [-616.319] (-617.602) (-618.074) -- 0:00:25
      580000 -- [-618.446] (-615.554) (-618.157) (-617.249) * [-615.782] (-615.573) (-618.132) (-620.251) -- 0:00:25

      Average standard deviation of split frequencies: 0.011257

      580500 -- [-620.847] (-618.402) (-621.651) (-618.576) * [-617.028] (-623.838) (-616.106) (-618.710) -- 0:00:25
      581000 -- (-617.207) (-616.465) [-616.480] (-617.030) * (-618.634) (-622.990) [-617.819] (-616.807) -- 0:00:25
      581500 -- [-616.785] (-615.743) (-618.036) (-616.756) * (-616.675) (-620.320) (-620.873) [-619.482] -- 0:00:25
      582000 -- (-617.534) (-616.565) (-622.064) [-617.449] * [-616.790] (-617.300) (-617.706) (-618.709) -- 0:00:25
      582500 -- (-618.217) (-620.570) [-619.079] (-619.008) * (-618.474) (-618.972) [-617.048] (-617.327) -- 0:00:25
      583000 -- [-616.435] (-621.669) (-618.587) (-615.770) * (-620.961) [-619.151] (-618.312) (-615.360) -- 0:00:25
      583500 -- (-620.261) (-618.058) (-616.030) [-616.341] * (-618.171) [-616.306] (-621.333) (-615.382) -- 0:00:24
      584000 -- [-615.276] (-618.272) (-622.824) (-619.878) * [-618.299] (-617.108) (-619.155) (-616.707) -- 0:00:24
      584500 -- [-619.981] (-621.437) (-619.406) (-618.982) * (-618.883) [-616.959] (-616.665) (-619.099) -- 0:00:24
      585000 -- (-618.809) (-620.829) (-618.306) [-616.371] * [-615.864] (-617.716) (-618.422) (-620.376) -- 0:00:24

      Average standard deviation of split frequencies: 0.011530

      585500 -- [-619.510] (-620.163) (-618.564) (-616.390) * [-618.859] (-627.001) (-615.745) (-616.122) -- 0:00:24
      586000 -- (-616.611) [-619.521] (-621.124) (-617.182) * (-619.776) (-625.938) [-618.902] (-620.161) -- 0:00:24
      586500 -- (-616.666) (-615.776) (-616.454) [-617.435] * [-618.597] (-616.456) (-616.423) (-621.256) -- 0:00:24
      587000 -- (-620.207) (-619.612) [-617.470] (-618.211) * [-617.099] (-615.816) (-617.547) (-618.158) -- 0:00:24
      587500 -- (-617.884) [-618.025] (-617.687) (-618.947) * (-619.786) [-616.763] (-617.353) (-619.299) -- 0:00:24
      588000 -- (-618.945) [-616.096] (-616.593) (-616.912) * (-622.132) [-616.453] (-617.022) (-617.105) -- 0:00:24
      588500 -- [-618.646] (-617.681) (-616.400) (-615.926) * [-618.090] (-620.065) (-617.488) (-617.675) -- 0:00:24
      589000 -- (-617.747) [-619.571] (-617.374) (-617.619) * (-618.921) [-617.566] (-620.211) (-617.986) -- 0:00:25
      589500 -- [-618.363] (-616.796) (-619.604) (-619.965) * (-618.562) (-617.970) (-618.424) [-619.149] -- 0:00:25
      590000 -- (-619.244) (-621.955) (-619.904) [-622.352] * (-618.968) [-619.767] (-620.842) (-616.745) -- 0:00:25

      Average standard deviation of split frequencies: 0.011173

      590500 -- [-615.836] (-618.744) (-616.590) (-618.973) * (-618.953) [-616.398] (-616.775) (-615.969) -- 0:00:24
      591000 -- (-616.957) (-619.343) (-620.694) [-619.662] * (-618.886) (-616.837) [-615.903] (-619.969) -- 0:00:24
      591500 -- (-617.917) (-618.027) [-617.484] (-617.264) * (-623.783) (-616.240) [-617.782] (-619.093) -- 0:00:24
      592000 -- (-617.648) (-616.356) [-617.027] (-619.340) * (-618.179) (-617.958) (-617.788) [-616.805] -- 0:00:24
      592500 -- [-617.940] (-618.302) (-616.475) (-616.023) * (-618.295) (-617.207) [-618.318] (-618.165) -- 0:00:24
      593000 -- (-617.759) [-618.119] (-617.370) (-620.115) * [-618.103] (-616.504) (-616.334) (-616.732) -- 0:00:24
      593500 -- (-617.278) (-616.342) [-616.313] (-619.636) * [-615.568] (-617.305) (-616.683) (-617.441) -- 0:00:24
      594000 -- (-620.519) [-616.345] (-620.263) (-617.463) * (-615.888) [-617.161] (-616.706) (-619.157) -- 0:00:24
      594500 -- (-615.552) (-615.389) [-616.966] (-616.966) * [-617.442] (-617.427) (-616.834) (-616.648) -- 0:00:24
      595000 -- (-615.522) (-617.618) [-617.039] (-617.581) * (-621.369) (-616.774) [-618.748] (-617.086) -- 0:00:24

      Average standard deviation of split frequencies: 0.011126

      595500 -- (-617.197) [-620.453] (-615.671) (-617.089) * (-616.053) (-618.093) [-616.985] (-615.864) -- 0:00:24
      596000 -- (-618.049) [-620.828] (-616.038) (-618.624) * (-616.639) (-616.992) [-617.479] (-616.029) -- 0:00:24
      596500 -- [-617.175] (-615.719) (-617.025) (-618.130) * (-616.960) (-615.914) (-618.055) [-616.487] -- 0:00:24
      597000 -- (-618.700) (-616.533) [-616.927] (-617.727) * [-618.843] (-616.342) (-615.778) (-617.249) -- 0:00:24
      597500 -- (-618.259) (-621.210) [-619.204] (-618.891) * (-618.228) [-617.695] (-618.625) (-619.635) -- 0:00:24
      598000 -- (-620.648) [-617.623] (-616.601) (-619.517) * (-616.852) [-617.396] (-616.673) (-616.469) -- 0:00:24
      598500 -- [-617.587] (-618.739) (-616.389) (-623.209) * (-618.450) (-620.886) (-616.510) [-616.667] -- 0:00:24
      599000 -- (-616.767) [-619.973] (-618.569) (-624.491) * [-616.976] (-618.926) (-618.094) (-619.037) -- 0:00:24
      599500 -- (-616.512) (-620.153) (-618.262) [-617.978] * (-617.677) [-618.484] (-618.259) (-616.272) -- 0:00:24
      600000 -- (-622.449) [-622.226] (-615.898) (-617.214) * (-619.302) (-617.123) (-617.424) [-616.276] -- 0:00:24

      Average standard deviation of split frequencies: 0.010307

      600500 -- (-620.428) (-618.420) (-615.616) [-619.257] * (-621.017) [-617.477] (-615.599) (-617.956) -- 0:00:23
      601000 -- (-616.665) [-616.583] (-623.998) (-617.467) * [-618.783] (-616.703) (-619.061) (-617.263) -- 0:00:23
      601500 -- (-618.722) (-616.946) (-615.657) [-617.203] * (-619.207) (-617.762) (-617.138) [-617.111] -- 0:00:23
      602000 -- (-619.060) (-618.241) [-617.215] (-618.178) * (-618.578) (-619.352) [-617.157] (-617.250) -- 0:00:23
      602500 -- (-616.555) (-618.858) [-618.512] (-616.744) * [-618.066] (-619.387) (-617.972) (-616.592) -- 0:00:23
      603000 -- [-619.313] (-617.672) (-617.487) (-621.679) * (-616.985) [-617.231] (-617.168) (-619.326) -- 0:00:23
      603500 -- [-618.015] (-617.360) (-616.405) (-616.336) * (-620.842) [-620.190] (-615.787) (-617.877) -- 0:00:23
      604000 -- (-618.580) (-619.627) [-616.362] (-617.550) * (-619.990) (-616.849) (-615.554) [-617.913] -- 0:00:23
      604500 -- (-616.450) (-617.061) (-617.038) [-615.386] * (-619.775) (-616.932) (-616.933) [-616.367] -- 0:00:23
      605000 -- (-618.996) (-619.288) [-617.451] (-615.897) * (-617.411) (-616.193) (-616.597) [-618.443] -- 0:00:23

      Average standard deviation of split frequencies: 0.009853

      605500 -- (-616.249) (-620.476) (-616.485) [-615.973] * (-617.673) [-617.376] (-618.784) (-621.828) -- 0:00:24
      606000 -- [-617.110] (-619.869) (-615.849) (-616.685) * (-617.294) (-618.410) [-617.382] (-617.431) -- 0:00:24
      606500 -- (-621.831) (-618.523) [-615.859] (-617.280) * [-617.798] (-618.149) (-617.120) (-616.561) -- 0:00:24
      607000 -- (-617.541) (-616.953) [-617.929] (-616.383) * (-616.857) (-617.990) [-616.062] (-616.461) -- 0:00:23
      607500 -- (-617.314) (-616.498) (-617.642) [-618.319] * [-616.467] (-617.579) (-618.193) (-619.818) -- 0:00:23
      608000 -- [-616.825] (-616.544) (-617.613) (-618.747) * (-618.447) (-619.797) [-616.097] (-616.614) -- 0:00:23
      608500 -- (-616.340) (-619.282) [-616.614] (-620.417) * (-617.538) (-618.193) (-617.630) [-618.460] -- 0:00:23
      609000 -- [-616.235] (-618.585) (-616.131) (-616.692) * (-617.883) [-617.594] (-615.723) (-623.705) -- 0:00:23
      609500 -- (-617.354) (-616.066) [-616.847] (-618.920) * (-618.756) (-616.740) [-615.648] (-617.266) -- 0:00:23
      610000 -- (-616.987) (-618.032) [-618.336] (-624.398) * (-617.601) (-615.617) [-616.201] (-620.587) -- 0:00:23

      Average standard deviation of split frequencies: 0.009675

      610500 -- (-616.161) (-620.207) (-617.427) [-618.098] * (-622.221) (-616.164) (-616.809) [-617.411] -- 0:00:23
      611000 -- (-617.680) (-619.631) (-616.120) [-623.227] * (-618.722) [-617.596] (-615.891) (-616.346) -- 0:00:23
      611500 -- [-616.675] (-619.084) (-616.022) (-619.136) * (-618.676) (-617.159) [-616.289] (-616.570) -- 0:00:23
      612000 -- (-615.698) (-617.998) (-615.871) [-620.637] * (-620.265) [-616.737] (-616.898) (-618.282) -- 0:00:23
      612500 -- (-616.540) (-620.276) [-618.100] (-620.974) * [-622.142] (-615.788) (-616.582) (-617.444) -- 0:00:23
      613000 -- (-617.604) [-617.154] (-619.690) (-616.711) * [-622.413] (-619.669) (-617.381) (-615.902) -- 0:00:23
      613500 -- [-616.835] (-616.211) (-619.609) (-616.871) * (-617.575) (-617.760) (-615.757) [-619.079] -- 0:00:23
      614000 -- (-617.922) (-616.204) (-621.000) [-618.351] * (-619.064) (-618.250) (-620.139) [-617.659] -- 0:00:23
      614500 -- (-616.978) (-616.846) [-620.036] (-619.285) * [-617.983] (-620.479) (-617.928) (-617.004) -- 0:00:23
      615000 -- (-616.794) (-619.509) (-619.527) [-617.675] * (-615.950) (-615.732) [-617.253] (-617.757) -- 0:00:23

      Average standard deviation of split frequencies: 0.009693

      615500 -- [-616.334] (-615.961) (-615.358) (-618.056) * (-617.130) (-619.791) [-617.067] (-617.436) -- 0:00:23
      616000 -- (-616.553) (-617.333) [-617.059] (-615.969) * (-617.291) [-617.575] (-615.998) (-617.529) -- 0:00:23
      616500 -- (-616.232) [-618.228] (-617.631) (-618.620) * (-617.380) [-619.048] (-617.811) (-617.571) -- 0:00:23
      617000 -- (-616.613) [-615.254] (-618.976) (-616.047) * [-617.982] (-615.676) (-620.040) (-616.982) -- 0:00:22
      617500 -- (-617.577) (-616.551) [-618.907] (-617.182) * (-616.916) (-617.797) (-620.140) [-615.962] -- 0:00:22
      618000 -- (-616.684) [-617.388] (-618.648) (-617.779) * (-617.814) (-616.499) (-617.575) [-615.936] -- 0:00:22
      618500 -- (-618.090) (-617.650) (-618.272) [-615.793] * (-615.843) [-615.950] (-622.902) (-616.445) -- 0:00:22
      619000 -- [-617.655] (-617.680) (-625.870) (-623.354) * [-615.977] (-617.925) (-621.318) (-616.108) -- 0:00:22
      619500 -- (-616.620) (-619.377) [-620.121] (-619.856) * (-619.399) [-620.125] (-616.657) (-621.967) -- 0:00:22
      620000 -- (-616.423) [-619.196] (-616.359) (-618.518) * (-622.735) [-616.173] (-615.738) (-616.921) -- 0:00:22

      Average standard deviation of split frequencies: 0.008608

      620500 -- (-618.029) (-617.083) (-617.180) [-615.900] * (-624.100) [-616.799] (-616.374) (-616.288) -- 0:00:22
      621000 -- (-617.617) [-615.416] (-617.138) (-619.386) * (-615.712) [-617.589] (-617.348) (-621.417) -- 0:00:22
      621500 -- (-618.729) (-615.993) [-616.516] (-615.255) * (-615.516) (-617.316) [-619.173] (-619.019) -- 0:00:22
      622000 -- (-616.227) (-622.202) (-620.627) [-618.161] * (-617.375) (-616.739) [-620.114] (-616.678) -- 0:00:22
      622500 -- (-615.652) (-619.249) [-618.119] (-617.424) * (-616.263) (-616.354) [-618.765] (-620.661) -- 0:00:23
      623000 -- [-617.215] (-619.019) (-617.491) (-621.592) * (-620.239) [-616.588] (-616.344) (-617.879) -- 0:00:22
      623500 -- [-615.957] (-620.141) (-618.037) (-620.599) * (-617.129) (-619.528) (-615.780) [-618.846] -- 0:00:22
      624000 -- [-617.977] (-618.427) (-618.134) (-620.411) * [-616.497] (-615.931) (-620.564) (-618.397) -- 0:00:22
      624500 -- [-618.744] (-616.576) (-617.021) (-616.600) * (-618.120) (-616.721) (-616.986) [-616.603] -- 0:00:22
      625000 -- (-616.668) (-618.225) [-618.016] (-618.045) * (-616.234) (-617.904) [-616.596] (-618.541) -- 0:00:22

      Average standard deviation of split frequencies: 0.008986

      625500 -- (-620.393) [-616.850] (-621.727) (-618.882) * (-621.497) (-621.483) [-616.504] (-622.604) -- 0:00:22
      626000 -- [-617.914] (-617.697) (-616.004) (-619.341) * [-618.288] (-619.112) (-617.215) (-624.694) -- 0:00:22
      626500 -- [-619.596] (-616.725) (-619.074) (-621.154) * (-619.084) [-619.344] (-618.624) (-617.937) -- 0:00:22
      627000 -- (-616.986) [-616.758] (-617.242) (-617.383) * (-620.761) (-617.612) (-616.314) [-620.178] -- 0:00:22
      627500 -- (-616.735) (-617.056) (-618.743) [-616.730] * (-621.410) (-616.822) (-617.428) [-619.726] -- 0:00:22
      628000 -- (-616.477) [-616.917] (-619.601) (-617.735) * (-621.279) [-616.944] (-616.839) (-617.867) -- 0:00:22
      628500 -- (-616.664) [-617.648] (-617.670) (-616.937) * (-616.829) (-616.232) [-617.175] (-618.298) -- 0:00:22
      629000 -- [-619.814] (-619.549) (-616.827) (-616.139) * (-616.638) [-617.857] (-617.735) (-616.102) -- 0:00:22
      629500 -- (-619.039) [-619.759] (-616.416) (-616.592) * (-616.888) (-617.841) [-618.010] (-616.062) -- 0:00:22
      630000 -- (-618.424) (-616.097) [-616.507] (-617.932) * [-616.793] (-619.952) (-615.346) (-616.663) -- 0:00:22

      Average standard deviation of split frequencies: 0.008571

      630500 -- (-619.482) (-618.500) [-619.232] (-617.139) * (-617.157) (-617.166) (-616.999) [-616.304] -- 0:00:22
      631000 -- [-622.786] (-617.428) (-616.909) (-619.359) * (-617.119) (-617.337) [-616.886] (-619.045) -- 0:00:22
      631500 -- (-618.203) (-617.052) [-616.723] (-618.956) * (-617.153) [-620.689] (-617.867) (-619.675) -- 0:00:22
      632000 -- [-616.799] (-617.965) (-616.623) (-615.938) * [-616.265] (-619.803) (-617.357) (-617.542) -- 0:00:22
      632500 -- (-618.504) (-617.115) (-618.608) [-616.029] * (-616.946) (-616.694) [-618.358] (-617.271) -- 0:00:22
      633000 -- [-619.180] (-618.632) (-619.423) (-616.598) * (-617.824) (-621.147) [-616.119] (-619.752) -- 0:00:22
      633500 -- (-619.911) (-615.885) (-616.358) [-615.673] * (-617.673) (-617.602) (-618.841) [-616.786] -- 0:00:21
      634000 -- (-621.794) [-615.595] (-617.078) (-615.785) * [-615.547] (-615.844) (-617.048) (-619.270) -- 0:00:21
      634500 -- (-617.679) [-615.876] (-618.512) (-615.738) * [-622.309] (-615.324) (-616.081) (-617.301) -- 0:00:21
      635000 -- (-617.620) (-617.278) [-617.976] (-616.054) * (-617.966) (-621.489) (-616.133) [-616.144] -- 0:00:21

      Average standard deviation of split frequencies: 0.008845

      635500 -- (-618.172) (-616.147) (-616.545) [-617.449] * (-616.717) (-620.906) [-617.337] (-617.975) -- 0:00:21
      636000 -- [-616.778] (-616.801) (-616.707) (-616.851) * [-616.339] (-616.380) (-615.369) (-617.322) -- 0:00:21
      636500 -- (-617.696) [-616.204] (-617.553) (-615.826) * (-615.531) [-619.471] (-615.877) (-616.695) -- 0:00:21
      637000 -- (-619.056) (-619.411) [-617.911] (-617.309) * [-618.115] (-616.031) (-616.091) (-618.944) -- 0:00:21
      637500 -- [-618.730] (-620.359) (-618.069) (-617.331) * (-616.492) [-615.741] (-618.804) (-618.630) -- 0:00:21
      638000 -- (-618.848) (-615.608) (-616.944) [-617.244] * (-616.358) (-616.023) [-617.426] (-618.944) -- 0:00:21
      638500 -- [-622.724] (-616.802) (-616.657) (-615.874) * [-616.921] (-616.659) (-617.074) (-616.874) -- 0:00:21
      639000 -- (-620.715) (-617.294) (-616.284) [-615.861] * [-617.250] (-620.170) (-617.946) (-617.126) -- 0:00:22
      639500 -- (-621.914) (-617.637) (-615.622) [-616.271] * (-616.503) (-615.684) (-618.780) [-617.294] -- 0:00:21
      640000 -- (-617.217) (-620.106) (-617.899) [-618.190] * (-616.172) (-617.671) (-618.188) [-618.369] -- 0:00:21

      Average standard deviation of split frequencies: 0.008584

      640500 -- (-619.443) [-617.503] (-615.904) (-618.782) * (-617.684) (-615.973) [-616.746] (-616.916) -- 0:00:21
      641000 -- (-616.786) [-618.024] (-618.838) (-618.659) * (-617.105) (-617.539) (-617.555) [-620.138] -- 0:00:21
      641500 -- (-615.274) (-619.649) [-618.008] (-621.936) * (-616.491) (-619.507) (-618.332) [-618.020] -- 0:00:21
      642000 -- (-619.575) [-616.641] (-616.912) (-621.471) * (-617.662) [-618.070] (-616.788) (-616.840) -- 0:00:21
      642500 -- (-617.251) [-617.386] (-619.263) (-623.475) * (-621.016) [-617.886] (-617.794) (-617.284) -- 0:00:21
      643000 -- [-617.833] (-616.996) (-616.890) (-621.449) * (-617.342) (-617.280) [-616.400] (-617.075) -- 0:00:21
      643500 -- (-617.895) (-617.479) [-617.117] (-621.156) * (-622.173) [-617.372] (-616.525) (-617.116) -- 0:00:21
      644000 -- (-619.378) [-616.958] (-617.442) (-620.862) * (-619.792) (-621.307) [-617.334] (-617.091) -- 0:00:21
      644500 -- [-617.513] (-616.659) (-616.634) (-618.605) * (-616.657) (-616.985) [-616.945] (-615.444) -- 0:00:21
      645000 -- (-617.361) (-616.682) [-616.211] (-617.412) * (-617.541) [-617.107] (-618.245) (-617.569) -- 0:00:21

      Average standard deviation of split frequencies: 0.008611

      645500 -- (-617.633) (-615.647) (-618.614) [-617.869] * (-617.457) (-621.922) (-617.436) [-616.556] -- 0:00:21
      646000 -- (-617.312) [-618.248] (-619.245) (-617.862) * (-616.571) (-617.730) (-616.621) [-616.740] -- 0:00:21
      646500 -- (-618.133) (-619.732) [-617.247] (-617.964) * [-617.974] (-618.420) (-616.696) (-617.387) -- 0:00:21
      647000 -- (-618.040) (-617.293) [-615.964] (-617.923) * (-625.850) (-617.912) [-617.751] (-617.070) -- 0:00:21
      647500 -- [-617.878] (-617.827) (-617.079) (-617.946) * (-616.340) [-616.947] (-620.458) (-616.992) -- 0:00:21
      648000 -- (-619.918) [-615.898] (-615.876) (-616.911) * (-616.992) [-617.583] (-622.317) (-617.972) -- 0:00:21
      648500 -- [-616.651] (-617.196) (-621.427) (-616.213) * (-618.735) (-616.506) (-617.037) [-617.000] -- 0:00:21
      649000 -- (-616.854) [-615.467] (-616.364) (-615.516) * [-616.494] (-619.709) (-620.327) (-618.993) -- 0:00:21
      649500 -- (-618.494) (-617.996) (-616.989) [-615.677] * (-618.756) [-618.245] (-622.897) (-616.259) -- 0:00:21
      650000 -- (-626.794) (-618.370) [-617.374] (-617.343) * (-618.445) (-616.235) [-618.377] (-615.962) -- 0:00:21

      Average standard deviation of split frequencies: 0.007680

      650500 -- [-618.090] (-616.274) (-619.141) (-617.655) * (-618.210) [-617.530] (-615.966) (-617.408) -- 0:00:20
      651000 -- (-624.872) [-615.662] (-617.087) (-616.314) * [-618.111] (-619.788) (-619.336) (-616.836) -- 0:00:20
      651500 -- (-616.584) (-616.738) [-617.285] (-615.599) * (-617.154) [-616.884] (-618.030) (-619.300) -- 0:00:20
      652000 -- (-618.577) (-618.327) (-618.347) [-616.416] * (-616.612) (-618.343) [-616.661] (-617.448) -- 0:00:20
      652500 -- (-617.756) (-617.740) (-616.618) [-616.017] * (-618.136) [-616.725] (-616.619) (-615.768) -- 0:00:20
      653000 -- (-619.228) (-620.709) (-616.476) [-616.362] * (-617.417) (-618.383) [-617.979] (-616.115) -- 0:00:20
      653500 -- (-617.497) (-619.474) (-615.832) [-615.870] * (-617.126) (-616.502) (-616.769) [-615.935] -- 0:00:20
      654000 -- (-616.676) [-617.088] (-617.129) (-618.808) * (-618.114) (-617.425) [-624.724] (-619.394) -- 0:00:20
      654500 -- (-617.412) (-618.237) [-616.064] (-618.434) * (-617.171) [-618.361] (-617.548) (-617.352) -- 0:00:20
      655000 -- (-616.376) (-617.898) (-616.660) [-616.600] * (-617.568) [-616.871] (-617.311) (-616.760) -- 0:00:20

      Average standard deviation of split frequencies: 0.007282

      655500 -- (-618.340) (-617.066) [-615.752] (-616.837) * [-619.377] (-616.973) (-618.211) (-616.923) -- 0:00:20
      656000 -- (-618.233) [-617.385] (-620.540) (-623.300) * (-621.807) (-616.439) (-619.488) [-616.449] -- 0:00:20
      656500 -- [-616.161] (-619.658) (-619.806) (-617.138) * (-615.639) [-616.766] (-616.625) (-617.534) -- 0:00:20
      657000 -- (-616.108) (-618.874) (-616.304) [-616.426] * [-616.256] (-619.899) (-617.007) (-618.414) -- 0:00:20
      657500 -- (-616.281) [-619.117] (-620.237) (-616.867) * [-617.177] (-618.619) (-617.613) (-618.647) -- 0:00:20
      658000 -- (-617.764) [-618.226] (-619.159) (-616.267) * (-618.956) (-620.184) [-616.601] (-617.986) -- 0:00:20
      658500 -- (-615.552) (-622.632) (-621.306) [-618.345] * [-617.039] (-616.218) (-620.189) (-620.061) -- 0:00:20
      659000 -- [-615.827] (-619.021) (-618.773) (-617.230) * (-617.390) (-618.392) (-618.113) [-619.300] -- 0:00:20
      659500 -- (-618.101) [-617.633] (-617.191) (-618.189) * (-620.626) (-617.398) [-617.116] (-617.778) -- 0:00:20
      660000 -- (-615.916) [-618.717] (-618.568) (-617.251) * (-617.354) (-616.554) (-616.778) [-616.891] -- 0:00:20

      Average standard deviation of split frequencies: 0.007421

      660500 -- (-616.486) (-621.193) (-618.751) [-624.272] * [-620.758] (-617.701) (-620.429) (-616.068) -- 0:00:20
      661000 -- (-616.191) (-618.977) [-621.153] (-616.787) * (-617.348) (-616.124) [-620.576] (-620.564) -- 0:00:20
      661500 -- (-625.884) (-620.455) [-616.734] (-619.870) * [-618.392] (-615.959) (-616.879) (-618.953) -- 0:00:20
      662000 -- (-618.146) (-617.471) (-617.305) [-620.840] * [-616.046] (-617.401) (-617.064) (-616.811) -- 0:00:20
      662500 -- [-616.018] (-615.535) (-617.086) (-616.497) * (-618.588) (-620.332) [-621.900] (-618.957) -- 0:00:20
      663000 -- (-621.634) [-616.863] (-618.056) (-619.871) * (-619.383) (-622.230) (-616.861) [-615.888] -- 0:00:20
      663500 -- (-624.151) [-618.627] (-617.380) (-616.554) * (-616.675) (-622.877) [-620.233] (-619.030) -- 0:00:20
      664000 -- (-620.808) (-616.736) (-618.336) [-618.257] * (-618.141) (-616.028) [-617.606] (-619.337) -- 0:00:20
      664500 -- [-622.119] (-618.749) (-619.674) (-619.345) * (-624.416) [-620.583] (-617.856) (-616.791) -- 0:00:20
      665000 -- (-616.656) (-615.681) [-621.151] (-616.790) * (-618.742) [-617.269] (-619.786) (-617.023) -- 0:00:20

      Average standard deviation of split frequencies: 0.007456

      665500 -- (-615.494) (-618.536) [-618.750] (-618.853) * (-617.366) (-617.168) (-616.935) [-616.405] -- 0:00:20
      666000 -- (-616.497) (-616.924) [-618.029] (-617.559) * (-620.505) [-616.702] (-619.798) (-618.059) -- 0:00:20
      666500 -- (-616.786) (-617.799) [-619.705] (-621.214) * [-619.389] (-617.008) (-616.927) (-616.328) -- 0:00:20
      667000 -- (-620.880) [-617.570] (-620.229) (-616.321) * (-616.913) (-621.391) (-619.934) [-616.197] -- 0:00:19
      667500 -- (-616.350) (-617.296) (-617.591) [-616.628] * (-622.573) (-615.748) (-616.910) [-617.018] -- 0:00:19
      668000 -- [-617.311] (-617.132) (-618.941) (-618.583) * [-616.531] (-616.255) (-619.860) (-616.929) -- 0:00:19
      668500 -- (-618.288) (-622.213) (-616.495) [-617.402] * (-619.928) (-618.455) [-620.606] (-616.818) -- 0:00:19
      669000 -- (-615.770) (-618.462) (-617.209) [-616.820] * (-618.820) (-619.126) [-620.944] (-620.104) -- 0:00:19
      669500 -- (-617.558) (-616.307) (-618.417) [-619.600] * (-618.936) (-618.235) (-623.474) [-619.778] -- 0:00:19
      670000 -- [-617.873] (-617.930) (-618.305) (-618.851) * (-616.881) (-621.297) [-616.945] (-617.685) -- 0:00:19

      Average standard deviation of split frequencies: 0.007779

      670500 -- (-617.067) (-616.885) (-621.963) [-618.147] * (-617.594) (-622.794) (-616.074) [-619.017] -- 0:00:19
      671000 -- (-617.434) [-617.426] (-617.328) (-624.083) * (-618.297) [-617.536] (-615.745) (-622.585) -- 0:00:19
      671500 -- (-621.372) (-619.497) [-619.414] (-618.355) * (-620.499) (-618.275) (-617.359) [-617.003] -- 0:00:19
      672000 -- (-618.396) (-616.009) [-619.053] (-619.427) * (-617.382) (-615.787) (-618.128) [-616.287] -- 0:00:19
      672500 -- (-621.406) [-618.291] (-620.336) (-619.757) * [-619.731] (-617.563) (-619.167) (-619.371) -- 0:00:19
      673000 -- (-617.802) [-617.339] (-616.689) (-617.503) * [-620.788] (-616.199) (-617.529) (-615.869) -- 0:00:19
      673500 -- (-620.255) (-619.658) (-616.402) [-617.079] * (-620.312) (-617.578) (-617.634) [-615.720] -- 0:00:19
      674000 -- (-617.032) (-617.136) (-616.340) [-615.978] * (-619.738) (-617.248) (-617.091) [-615.727] -- 0:00:19
      674500 -- (-616.448) (-616.900) (-617.921) [-616.814] * (-622.888) [-620.227] (-622.157) (-616.775) -- 0:00:19
      675000 -- (-616.930) [-617.142] (-617.880) (-618.288) * [-616.275] (-617.736) (-618.384) (-616.544) -- 0:00:19

      Average standard deviation of split frequencies: 0.007810

      675500 -- (-617.854) [-615.748] (-618.709) (-620.528) * (-616.753) (-617.673) [-616.156] (-616.578) -- 0:00:19
      676000 -- (-619.136) (-616.441) (-618.241) [-617.561] * (-617.734) (-619.568) (-616.156) [-619.740] -- 0:00:19
      676500 -- (-619.326) (-616.387) (-616.369) [-617.384] * (-618.374) [-617.998] (-617.203) (-620.251) -- 0:00:19
      677000 -- [-618.323] (-617.204) (-617.461) (-616.062) * (-616.355) [-616.021] (-617.452) (-619.839) -- 0:00:19
      677500 -- [-616.795] (-618.679) (-615.401) (-618.593) * (-617.470) (-618.329) [-617.185] (-618.209) -- 0:00:19
      678000 -- (-617.120) [-619.817] (-617.115) (-617.835) * (-618.603) (-617.281) (-617.035) [-615.995] -- 0:00:19
      678500 -- (-616.876) [-616.736] (-618.972) (-616.066) * (-622.533) [-618.264] (-615.315) (-617.267) -- 0:00:19
      679000 -- (-618.970) (-617.514) [-616.566] (-616.865) * [-617.980] (-617.967) (-618.461) (-618.658) -- 0:00:19
      679500 -- (-619.729) (-616.231) (-616.819) [-618.816] * (-620.444) [-617.852] (-617.204) (-615.945) -- 0:00:19
      680000 -- (-615.848) (-616.851) [-616.701] (-624.355) * (-619.208) [-616.729] (-616.514) (-617.245) -- 0:00:19

      Average standard deviation of split frequencies: 0.008218

      680500 -- (-618.529) (-618.311) (-617.373) [-616.646] * (-617.093) (-615.651) (-616.300) [-616.291] -- 0:00:19
      681000 -- [-616.580] (-619.466) (-616.012) (-618.064) * (-617.848) (-617.919) (-615.772) [-616.480] -- 0:00:19
      681500 -- (-618.145) [-616.526] (-619.290) (-618.106) * [-617.185] (-617.400) (-616.554) (-620.223) -- 0:00:19
      682000 -- (-616.255) (-616.452) [-618.568] (-616.812) * [-615.605] (-617.717) (-616.816) (-623.468) -- 0:00:19
      682500 -- (-616.209) (-618.918) (-616.441) [-617.199] * (-615.690) (-617.219) (-618.584) [-616.830] -- 0:00:19
      683000 -- (-619.301) (-618.704) (-616.637) [-618.720] * (-616.358) (-616.955) (-616.846) [-618.691] -- 0:00:19
      683500 -- (-617.439) (-617.933) [-617.726] (-618.956) * (-617.769) (-616.682) [-620.074] (-617.671) -- 0:00:18
      684000 -- (-616.773) (-618.250) (-617.349) [-620.575] * (-617.557) [-616.557] (-615.762) (-616.408) -- 0:00:18
      684500 -- (-618.607) (-618.112) [-618.617] (-617.271) * (-616.937) (-616.337) (-617.350) [-616.556] -- 0:00:18
      685000 -- (-621.427) (-617.733) (-619.499) [-618.533] * (-617.189) [-617.210] (-618.740) (-620.043) -- 0:00:18

      Average standard deviation of split frequencies: 0.008613

      685500 -- (-616.901) [-622.253] (-616.101) (-617.979) * (-617.567) (-621.556) (-618.056) [-619.073] -- 0:00:18
      686000 -- (-617.317) (-618.928) [-616.353] (-619.101) * (-618.527) (-617.695) [-617.581] (-619.137) -- 0:00:18
      686500 -- (-618.564) [-615.322] (-615.613) (-619.444) * (-620.356) (-618.307) [-618.531] (-622.219) -- 0:00:18
      687000 -- (-616.579) (-617.888) (-618.037) [-616.742] * (-618.842) [-617.455] (-617.015) (-617.144) -- 0:00:18
      687500 -- [-616.734] (-619.968) (-618.150) (-618.478) * (-621.920) (-616.555) (-617.279) [-619.970] -- 0:00:18
      688000 -- (-617.624) (-616.086) (-617.421) [-617.349] * (-615.461) (-618.995) (-617.426) [-618.255] -- 0:00:18
      688500 -- (-617.831) [-617.806] (-616.718) (-620.955) * (-616.417) (-620.751) [-617.671] (-618.339) -- 0:00:18
      689000 -- (-620.610) (-617.594) (-619.465) [-618.025] * [-616.202] (-619.435) (-616.648) (-618.409) -- 0:00:18
      689500 -- (-619.966) [-619.655] (-617.956) (-622.132) * (-616.742) [-616.692] (-616.829) (-619.931) -- 0:00:18
      690000 -- (-618.237) (-618.412) [-619.717] (-619.187) * (-621.228) (-619.513) (-616.583) [-617.148] -- 0:00:18

      Average standard deviation of split frequencies: 0.008372

      690500 -- [-619.857] (-616.331) (-622.815) (-617.090) * (-618.446) [-616.569] (-617.524) (-618.760) -- 0:00:18
      691000 -- (-618.270) [-616.122] (-618.149) (-617.041) * [-620.481] (-617.846) (-616.616) (-618.490) -- 0:00:18
      691500 -- [-617.312] (-620.132) (-618.207) (-619.072) * [-616.853] (-619.015) (-620.989) (-618.790) -- 0:00:18
      692000 -- (-618.784) [-618.589] (-616.264) (-615.546) * (-615.256) (-619.101) [-618.876] (-617.325) -- 0:00:18
      692500 -- (-622.156) (-619.552) [-616.485] (-618.086) * (-619.052) (-617.221) (-616.030) [-617.296] -- 0:00:18
      693000 -- (-617.593) [-616.693] (-615.975) (-623.519) * [-619.278] (-618.659) (-618.872) (-618.790) -- 0:00:18
      693500 -- (-619.348) [-620.134] (-619.470) (-617.373) * (-617.855) (-620.195) [-615.199] (-617.825) -- 0:00:18
      694000 -- (-617.428) (-616.425) (-620.741) [-617.473] * [-616.348] (-619.928) (-617.971) (-617.574) -- 0:00:18
      694500 -- [-616.399] (-624.359) (-616.455) (-616.749) * (-615.723) (-616.390) [-617.329] (-617.240) -- 0:00:18
      695000 -- (-617.039) (-616.975) (-618.499) [-617.564] * (-615.667) (-621.189) [-617.567] (-617.414) -- 0:00:18

      Average standard deviation of split frequencies: 0.007857

      695500 -- (-617.805) (-616.760) (-617.343) [-617.380] * (-616.638) (-617.859) (-619.141) [-616.345] -- 0:00:18
      696000 -- (-617.014) [-617.498] (-616.448) (-618.446) * [-621.976] (-619.183) (-617.027) (-617.864) -- 0:00:18
      696500 -- (-616.459) (-618.479) [-616.672] (-618.161) * (-617.577) (-621.930) [-616.389] (-616.123) -- 0:00:18
      697000 -- (-616.616) (-620.183) (-619.055) [-615.970] * (-623.607) [-617.309] (-618.177) (-617.283) -- 0:00:18
      697500 -- (-616.349) (-620.887) (-618.255) [-615.728] * [-616.312] (-617.227) (-623.516) (-616.665) -- 0:00:18
      698000 -- (-617.297) (-617.545) [-615.788] (-618.665) * (-616.682) (-616.588) [-617.000] (-617.288) -- 0:00:18
      698500 -- (-616.024) (-621.999) (-618.904) [-616.676] * (-615.784) (-616.813) (-616.537) [-616.805] -- 0:00:18
      699000 -- [-616.599] (-621.049) (-616.387) (-619.848) * [-616.894] (-617.487) (-617.333) (-620.511) -- 0:00:18
      699500 -- (-621.128) (-618.069) (-617.767) [-617.005] * (-617.181) (-622.697) (-616.518) [-617.538] -- 0:00:18
      700000 -- (-620.107) (-616.050) (-617.835) [-616.586] * [-615.978] (-620.165) (-617.057) (-616.572) -- 0:00:18

      Average standard deviation of split frequencies: 0.008118

      700500 -- (-618.219) (-617.373) (-615.777) [-616.091] * [-615.551] (-617.825) (-616.264) (-616.677) -- 0:00:17
      701000 -- [-617.688] (-618.871) (-619.949) (-616.457) * (-617.865) [-617.380] (-615.623) (-618.592) -- 0:00:17
      701500 -- (-618.243) (-621.007) [-617.442] (-616.417) * (-618.321) [-618.641] (-617.800) (-618.032) -- 0:00:17
      702000 -- [-615.450] (-619.258) (-617.468) (-616.146) * (-617.489) (-618.847) (-617.760) [-616.992] -- 0:00:17
      702500 -- (-617.265) [-618.667] (-617.095) (-618.297) * (-617.680) [-617.277] (-618.022) (-616.693) -- 0:00:17
      703000 -- (-619.995) [-617.086] (-618.720) (-618.559) * (-623.763) [-618.840] (-618.348) (-616.923) -- 0:00:17
      703500 -- (-620.032) (-616.619) (-618.477) [-618.662] * [-618.410] (-616.665) (-620.380) (-620.788) -- 0:00:17
      704000 -- (-618.501) [-617.103] (-619.507) (-619.209) * (-619.302) (-616.883) [-620.096] (-619.718) -- 0:00:17
      704500 -- (-617.889) (-617.312) (-616.915) [-618.002] * (-617.053) (-616.579) [-621.299] (-617.008) -- 0:00:17
      705000 -- (-616.585) [-618.484] (-618.255) (-616.740) * (-616.910) [-616.668] (-619.704) (-620.223) -- 0:00:17

      Average standard deviation of split frequencies: 0.007790

      705500 -- [-617.771] (-618.305) (-619.518) (-619.642) * [-618.725] (-620.874) (-615.915) (-616.710) -- 0:00:17
      706000 -- (-620.527) (-622.121) [-616.325] (-617.636) * (-619.940) (-616.881) (-615.966) [-616.053] -- 0:00:17
      706500 -- (-618.089) [-619.284] (-616.356) (-617.746) * (-617.669) (-621.253) (-622.680) [-618.535] -- 0:00:17
      707000 -- (-616.062) (-618.320) [-616.023] (-617.467) * (-616.698) (-618.086) [-623.633] (-616.621) -- 0:00:17
      707500 -- [-616.960] (-618.365) (-618.475) (-615.266) * [-621.872] (-617.654) (-618.327) (-617.043) -- 0:00:17
      708000 -- [-616.827] (-621.397) (-621.616) (-616.393) * (-619.514) (-618.933) (-618.833) [-615.899] -- 0:00:17
      708500 -- [-617.123] (-618.026) (-618.275) (-620.023) * (-618.194) (-616.638) [-619.457] (-619.875) -- 0:00:17
      709000 -- [-618.577] (-619.227) (-616.469) (-618.071) * (-616.818) (-617.207) (-618.149) [-615.431] -- 0:00:17
      709500 -- (-618.188) (-618.453) [-617.823] (-618.275) * [-616.207] (-617.938) (-616.704) (-618.832) -- 0:00:17
      710000 -- [-617.649] (-622.382) (-619.542) (-619.832) * (-617.021) [-617.319] (-620.126) (-618.118) -- 0:00:17

      Average standard deviation of split frequencies: 0.007518

      710500 -- (-617.663) (-617.852) [-620.086] (-621.243) * (-619.262) (-616.480) [-617.734] (-619.483) -- 0:00:17
      711000 -- (-617.644) (-616.067) (-618.401) [-616.131] * (-617.173) (-616.751) (-620.101) [-619.318] -- 0:00:17
      711500 -- (-615.561) (-616.174) [-620.215] (-618.978) * (-618.505) [-617.844] (-617.034) (-616.905) -- 0:00:17
      712000 -- [-618.754] (-623.594) (-618.083) (-621.209) * (-616.671) (-620.735) (-617.632) [-617.324] -- 0:00:17
      712500 -- (-620.845) (-616.102) [-615.637] (-619.552) * [-617.130] (-617.282) (-618.736) (-615.826) -- 0:00:17
      713000 -- (-619.300) [-619.201] (-619.531) (-618.359) * [-616.494] (-616.979) (-616.937) (-617.928) -- 0:00:17
      713500 -- [-618.288] (-616.107) (-624.383) (-618.092) * (-617.631) [-617.494] (-617.859) (-616.294) -- 0:00:17
      714000 -- [-616.711] (-615.678) (-617.319) (-618.172) * (-620.422) (-621.416) [-620.207] (-617.863) -- 0:00:17
      714500 -- (-621.850) [-616.566] (-616.967) (-617.174) * (-621.273) (-616.778) [-617.928] (-617.143) -- 0:00:17
      715000 -- (-617.457) (-618.915) (-618.206) [-618.469] * (-617.337) [-617.130] (-617.972) (-616.754) -- 0:00:17

      Average standard deviation of split frequencies: 0.007769

      715500 -- [-617.858] (-619.198) (-618.587) (-617.835) * (-616.798) (-616.175) (-616.076) [-616.290] -- 0:00:17
      716000 -- (-619.579) [-621.866] (-617.945) (-618.619) * (-617.430) (-618.384) (-616.746) [-616.358] -- 0:00:17
      716500 -- (-618.480) (-618.622) [-616.368] (-618.821) * (-617.412) (-618.013) [-616.468] (-617.014) -- 0:00:17
      717000 -- (-615.760) [-616.943] (-620.705) (-619.122) * (-619.862) [-618.476] (-616.523) (-617.040) -- 0:00:16
      717500 -- (-616.856) (-616.623) (-617.416) [-617.905] * (-617.787) (-616.369) (-619.805) [-616.906] -- 0:00:16
      718000 -- (-620.697) [-618.048] (-619.322) (-617.744) * [-617.425] (-621.222) (-616.923) (-619.240) -- 0:00:16
      718500 -- [-616.854] (-616.684) (-615.851) (-617.248) * (-616.487) [-618.802] (-616.140) (-619.049) -- 0:00:16
      719000 -- (-617.347) (-617.217) [-616.463] (-617.167) * (-618.298) (-620.764) (-617.884) [-615.898] -- 0:00:16
      719500 -- (-615.894) (-615.338) (-615.789) [-617.077] * (-618.837) (-617.824) [-615.971] (-616.742) -- 0:00:16
      720000 -- (-615.880) [-623.202] (-618.085) (-617.659) * (-615.941) [-617.412] (-616.437) (-615.741) -- 0:00:16

      Average standard deviation of split frequencies: 0.007239

      720500 -- (-617.064) [-622.040] (-620.585) (-617.810) * [-615.774] (-617.370) (-615.937) (-616.061) -- 0:00:16
      721000 -- (-617.237) (-617.308) [-616.174] (-618.957) * (-618.562) [-616.187] (-616.205) (-621.077) -- 0:00:16
      721500 -- (-616.699) (-615.994) (-616.423) [-615.819] * (-617.252) (-623.657) (-620.464) [-620.530] -- 0:00:16
      722000 -- (-616.627) (-619.405) (-616.356) [-618.340] * (-616.415) (-615.754) [-617.287] (-618.438) -- 0:00:16
      722500 -- (-618.149) (-618.027) [-616.425] (-617.500) * [-618.489] (-616.116) (-618.246) (-620.181) -- 0:00:16
      723000 -- (-617.418) [-616.733] (-616.010) (-616.677) * (-619.901) (-617.008) [-623.586] (-622.771) -- 0:00:16
      723500 -- (-616.598) (-615.745) [-620.767] (-615.386) * (-617.250) (-617.395) (-616.017) [-616.324] -- 0:00:16
      724000 -- (-615.656) (-615.818) (-618.111) [-616.380] * (-618.140) (-615.800) [-616.022] (-618.144) -- 0:00:16
      724500 -- (-616.658) (-616.865) (-616.710) [-619.333] * (-615.936) [-619.422] (-615.971) (-619.179) -- 0:00:16
      725000 -- (-616.555) (-618.672) (-616.936) [-618.792] * (-616.167) (-617.670) (-618.955) [-618.016] -- 0:00:16

      Average standard deviation of split frequencies: 0.007532

      725500 -- [-618.907] (-617.969) (-617.378) (-620.931) * (-616.233) (-616.978) [-616.783] (-618.100) -- 0:00:16
      726000 -- [-616.087] (-617.971) (-616.244) (-620.122) * (-618.197) [-617.166] (-617.818) (-617.188) -- 0:00:16
      726500 -- (-616.495) [-619.363] (-615.703) (-621.566) * [-618.897] (-622.160) (-616.550) (-619.325) -- 0:00:16
      727000 -- [-616.318] (-617.042) (-618.899) (-615.885) * (-618.454) (-626.457) [-618.668] (-622.311) -- 0:00:16
      727500 -- (-616.526) (-620.020) (-618.436) [-616.168] * [-617.754] (-627.471) (-617.370) (-617.527) -- 0:00:16
      728000 -- [-615.716] (-620.460) (-620.228) (-615.822) * (-618.627) (-627.159) (-617.668) [-616.699] -- 0:00:16
      728500 -- (-617.196) [-621.446] (-618.937) (-620.428) * (-617.993) (-626.452) [-619.869] (-616.465) -- 0:00:16
      729000 -- (-616.619) (-617.787) [-616.113] (-618.458) * (-624.172) (-617.207) [-617.587] (-617.824) -- 0:00:16
      729500 -- [-617.446] (-618.661) (-619.293) (-615.990) * (-617.380) [-616.648] (-617.191) (-616.377) -- 0:00:16
      730000 -- [-618.209] (-617.956) (-624.637) (-620.215) * (-617.163) [-619.208] (-617.433) (-620.505) -- 0:00:16

      Average standard deviation of split frequencies: 0.007871

      730500 -- (-618.700) (-617.777) (-618.596) [-615.871] * (-615.804) [-616.620] (-617.408) (-616.819) -- 0:00:16
      731000 -- (-617.326) (-618.208) (-618.195) [-617.879] * (-618.174) (-618.778) (-618.431) [-616.364] -- 0:00:16
      731500 -- (-616.668) [-618.568] (-617.668) (-616.841) * (-617.548) (-619.231) [-618.097] (-617.368) -- 0:00:16
      732000 -- (-622.759) (-618.816) (-615.429) [-616.923] * [-617.341] (-616.290) (-616.426) (-618.979) -- 0:00:16
      732500 -- [-617.308] (-617.153) (-615.558) (-617.031) * (-619.411) [-616.743] (-618.096) (-615.876) -- 0:00:16
      733000 -- (-618.056) (-616.838) (-615.776) [-618.923] * (-618.858) (-615.802) [-617.590] (-617.521) -- 0:00:16
      733500 -- (-616.153) [-615.786] (-618.981) (-616.396) * (-620.263) [-617.653] (-616.058) (-616.387) -- 0:00:15
      734000 -- (-616.562) [-619.171] (-618.719) (-616.699) * (-616.821) (-616.107) (-620.388) [-617.045] -- 0:00:15
      734500 -- [-618.001] (-618.284) (-622.494) (-615.454) * (-621.508) [-617.106] (-620.216) (-616.371) -- 0:00:15
      735000 -- (-619.233) (-621.294) (-618.631) [-615.618] * (-620.006) (-616.071) [-618.486] (-615.824) -- 0:00:15

      Average standard deviation of split frequencies: 0.007729

      735500 -- (-618.944) [-617.747] (-618.006) (-616.020) * (-619.952) (-618.326) (-619.052) [-616.567] -- 0:00:15
      736000 -- (-619.381) (-617.130) (-618.799) [-616.815] * [-616.931] (-616.308) (-619.747) (-615.698) -- 0:00:15
      736500 -- (-616.848) [-617.243] (-618.719) (-616.511) * (-619.679) (-619.828) (-620.540) [-616.760] -- 0:00:15
      737000 -- (-620.390) (-617.646) (-615.819) [-618.298] * (-619.708) (-619.141) [-617.924] (-623.655) -- 0:00:15
      737500 -- [-616.856] (-621.548) (-616.474) (-618.831) * (-617.013) [-620.087] (-620.545) (-616.523) -- 0:00:15
      738000 -- (-616.995) (-616.615) [-617.216] (-622.714) * [-616.933] (-619.994) (-617.909) (-619.222) -- 0:00:15
      738500 -- [-620.782] (-617.545) (-620.981) (-619.962) * (-617.183) [-618.138] (-616.774) (-617.855) -- 0:00:15
      739000 -- (-619.437) (-621.350) (-616.356) [-622.803] * (-616.122) (-617.073) [-619.328] (-618.016) -- 0:00:15
      739500 -- (-618.538) (-620.062) [-615.439] (-619.757) * (-616.123) (-615.983) (-620.862) [-615.945] -- 0:00:15
      740000 -- (-617.224) (-617.519) (-616.823) [-616.353] * (-617.048) [-616.449] (-619.407) (-622.268) -- 0:00:15

      Average standard deviation of split frequencies: 0.007765

      740500 -- (-618.232) (-618.713) (-615.775) [-618.348] * (-616.875) (-616.999) [-622.159] (-618.796) -- 0:00:15
      741000 -- (-623.750) (-616.532) (-616.037) [-616.513] * (-619.231) [-616.993] (-618.859) (-618.002) -- 0:00:15
      741500 -- (-616.258) [-618.050] (-620.959) (-619.913) * (-619.787) [-617.594] (-620.498) (-616.541) -- 0:00:15
      742000 -- (-616.350) (-617.250) (-622.072) [-616.303] * (-616.905) (-621.186) (-616.693) [-619.984] -- 0:00:15
      742500 -- (-616.959) (-615.823) (-618.748) [-616.065] * (-616.620) (-618.629) (-619.792) [-617.620] -- 0:00:15
      743000 -- (-617.890) [-616.517] (-618.754) (-618.801) * (-617.611) [-618.183] (-618.714) (-618.723) -- 0:00:15
      743500 -- (-616.572) (-618.826) (-618.476) [-618.127] * (-615.952) [-616.496] (-616.317) (-621.256) -- 0:00:15
      744000 -- (-618.067) (-616.141) (-621.631) [-617.117] * (-616.087) (-618.524) [-619.830] (-618.608) -- 0:00:15
      744500 -- (-620.543) (-617.361) (-616.623) [-616.129] * (-618.082) (-617.569) (-617.763) [-616.027] -- 0:00:15
      745000 -- (-617.727) [-616.896] (-616.325) (-622.454) * (-617.465) (-617.792) (-615.977) [-619.601] -- 0:00:15

      Average standard deviation of split frequencies: 0.007372

      745500 -- (-618.589) (-617.141) (-616.126) [-617.657] * (-617.728) (-617.361) (-617.816) [-620.427] -- 0:00:15
      746000 -- [-616.148] (-616.616) (-617.215) (-620.196) * (-617.234) [-617.459] (-616.690) (-618.383) -- 0:00:15
      746500 -- (-616.539) (-617.999) [-618.205] (-616.517) * [-615.972] (-616.408) (-617.262) (-616.605) -- 0:00:15
      747000 -- (-620.941) [-615.595] (-617.313) (-617.661) * (-615.594) [-621.064] (-618.163) (-617.436) -- 0:00:15
      747500 -- (-619.925) (-617.635) [-615.797] (-619.409) * (-617.007) (-617.731) [-616.338] (-617.917) -- 0:00:15
      748000 -- (-617.173) [-616.421] (-620.233) (-628.854) * (-619.838) (-618.072) [-621.420] (-619.008) -- 0:00:15
      748500 -- (-618.523) [-616.490] (-618.043) (-621.182) * (-616.867) (-616.597) (-616.112) [-615.978] -- 0:00:15
      749000 -- (-617.024) [-617.153] (-618.647) (-621.139) * (-625.071) (-619.992) [-618.430] (-617.214) -- 0:00:15
      749500 -- (-617.244) [-616.971] (-619.151) (-618.229) * (-616.141) (-618.064) [-619.785] (-621.736) -- 0:00:15
      750000 -- (-618.825) (-620.032) (-616.928) [-618.258] * [-615.822] (-616.671) (-618.290) (-618.736) -- 0:00:15

      Average standard deviation of split frequencies: 0.007201

      750500 -- (-617.428) (-621.920) [-616.444] (-623.495) * (-616.779) (-620.422) [-621.349] (-617.691) -- 0:00:14
      751000 -- (-619.350) [-623.900] (-616.151) (-619.136) * (-618.633) (-616.651) [-618.502] (-619.323) -- 0:00:14
      751500 -- [-616.818] (-623.899) (-617.772) (-617.417) * [-618.172] (-621.103) (-616.913) (-618.441) -- 0:00:14
      752000 -- (-616.741) (-618.393) [-616.904] (-617.223) * (-615.914) (-621.571) [-618.380] (-616.717) -- 0:00:14
      752500 -- [-616.906] (-616.888) (-616.128) (-617.023) * (-617.597) (-617.060) (-616.269) [-616.994] -- 0:00:14
      753000 -- (-616.056) (-618.009) (-616.259) [-616.349] * (-617.591) (-627.239) [-616.765] (-616.356) -- 0:00:14
      753500 -- (-616.560) (-617.639) (-617.062) [-616.544] * (-618.313) [-619.743] (-616.438) (-618.124) -- 0:00:14
      754000 -- (-616.173) (-617.789) [-618.018] (-616.517) * (-621.331) [-617.728] (-616.690) (-619.727) -- 0:00:14
      754500 -- (-617.469) [-622.874] (-615.526) (-618.721) * (-618.972) (-619.565) (-616.684) [-618.239] -- 0:00:14
      755000 -- [-618.796] (-618.703) (-619.935) (-620.419) * [-615.771] (-615.633) (-618.498) (-619.993) -- 0:00:14

      Average standard deviation of split frequencies: 0.007025

      755500 -- (-616.610) (-616.587) [-619.617] (-624.648) * [-617.243] (-616.545) (-620.561) (-617.413) -- 0:00:14
      756000 -- [-616.848] (-620.702) (-617.336) (-620.386) * (-618.213) [-617.036] (-624.491) (-623.308) -- 0:00:14
      756500 -- (-618.506) [-618.051] (-619.281) (-618.818) * (-617.400) [-616.951] (-617.538) (-618.443) -- 0:00:14
      757000 -- (-619.838) (-620.332) [-619.576] (-616.793) * (-619.943) (-619.903) (-617.917) [-615.699] -- 0:00:14
      757500 -- (-617.788) (-620.108) [-615.678] (-620.120) * (-618.122) (-621.633) (-616.449) [-617.694] -- 0:00:14
      758000 -- (-621.353) (-617.483) (-617.930) [-618.557] * (-617.228) [-616.223] (-616.018) (-617.031) -- 0:00:14
      758500 -- (-619.736) (-619.855) [-618.844] (-617.018) * (-620.476) [-620.128] (-616.380) (-618.130) -- 0:00:14
      759000 -- (-616.965) (-617.598) (-617.544) [-617.073] * (-617.382) (-620.764) (-618.522) [-617.518] -- 0:00:14
      759500 -- [-616.521] (-616.336) (-618.696) (-616.534) * (-616.860) [-618.600] (-617.010) (-616.973) -- 0:00:14
      760000 -- (-618.424) (-619.801) (-617.157) [-617.644] * [-616.550] (-616.816) (-622.731) (-619.019) -- 0:00:14

      Average standard deviation of split frequencies: 0.007271

      760500 -- [-619.360] (-619.333) (-615.885) (-618.036) * (-617.452) (-619.246) (-621.489) [-620.151] -- 0:00:14
      761000 -- (-617.285) (-617.703) [-616.022] (-617.285) * (-618.979) [-615.652] (-619.040) (-617.224) -- 0:00:14
      761500 -- (-615